spacer

EBI Dbfetch

ID   DQ250650; SV 1; linear; genomic DNA; STD; HUM; 517 BP.
XX
AC   DQ250650;
XX
DT   11-JAN-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*120201 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-517
RA   Hur S.S., Lee M.N., Park S.Y., Kwon O.J.;
RT   "Novel HLA-DRB1*120201 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-517
RA   Hur S.S., Lee M.N., Park S.Y., Kwon O.J.;
RT   ;
RL   Submitted (19-OCT-2005) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..517
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>517
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT   mRNA            <206..>475
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <206..>475
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="ABC59072.1"
FT                   /translation="RFLEYSTGECYFFNGTERVLLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            206..475
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /number=2
XX
SQ   Sequence 517 BP; 82 A; 143 C; 191 G; 101 T; 0 other;
     gttttcccgc ctggtccccc aggcccccgt tcgcctcagg aagacggagg atgagctcct        60
     gggctgcagg tggtgggcgt tgcgggtggg gccggttaag gttcccagtg cctgcacccc       120
     acccagggag ccccggatgg tggcgtcgct gtcagtgtct tctcaggagg ccacctgtgt       180
     gactggatcg ttcgtgtccc cacagcacgt ttcttggagt actctacggg tgagtgttat       240
     ttcttcaatg ggacggagcg ggtgctgtta ctggagagac acttccataa ccaggaggag       300
     ctcctgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       360
     gtcgccgagt cctggaacag ccagaaggac ttcctggaag acaggcgcgc cgcggtggac       420
     acctattgca gacacaacta cggggctgtg gagagcttca cagtgcagcg gcgaggtgag       480
     cgcggcgcgg ggcggggcct gagtccctgt gagctgg                                517
//


spacer
spacer