spacer

EBI Dbfetch

ID   DQ235685; SV 1; linear; genomic DNA; STD; HUM; 324 BP.
XX
AC   DQ235685;
XX
DT   09-NOV-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14XX allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-324
RX   DOI; 10.1111/j.1399-0039.2006.00669.x.
RX   PUBMED; 17026471.
RA   Chen Q., Zou H., Xu X.H., Luo M., Wang J., Zuo Y.Q., Chen Y.H., Chen X.H.,
RA   Chen X.L., Yao Z.Q., Song N., Zeng J., Mi X.Y., Sun S.X., Wang J.X.,
RA   Zhao T.M.;
RT   "Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles
RT   identified in a southwest Chinese population";
RL   Tissue Antigens 68(4):339-343(2006).
XX
RN   [2]
RP   1-324
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   "Identification of a novel HLA-DRB1 allele (DRB1*14XX) with a DRB1*04
RT   sequence motif";
RL   Unpublished.
XX
RN   [3]
RP   1-324
RA   Chen Q., Zou H., Xu X.-H., Zuo Y.-Q., Luo M., Chen X.-H., Chen Y.-H.,
RA   Song N., Chen X.-L., Yao Z.-Q., Mi X.-Y., Wang J.-X., Zhao T.-M.;
RT   ;
RL   Submitted (10-OCT-2005) to the INSDC.
RL   MCIGS, NIAID, National Institutes of Health, Bldg. 50, Room 5511, 50 South
RL   Drive, Bethesda, MD 20892, USA
XX
DR   MD5; c55d5f42a0daf2f1cc3aa6c2d78ba381.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..324
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="12973"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>324
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT   mRNA            <16..>285
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT   CDS             <16..>285
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /product="MHC class II antigen"
FT                   /note="human leukocyte antigen DRB1; similar to DRB1*1416;
FT                   contains the DR4-specific QVKH motif"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:57"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="ABB52004.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            16..285
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14XX"
FT                   /number=2
FT   variation       180
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /note="results in tyrosine to histidine substitution"
XX
SQ   Sequence 324 BP; 63 A; 81 C; 121 G; 59 T; 0 other;
     ttcttgtccc cccagcacgt ttcttggagc aggttaaaca tgagtgtcat ttcttcaatg        60
     ggacggagcg ggtgcggttc ctggacagat acttccataa ccaggaggag ttcgtgcgct       120
     tcgacagcga cgtgggggag taccgggcgg tgacggagct ggggcggcct gctgcggagt       180
     actggaacag ccagaaggac atcctggaag acgagcgggc cgcggtggac acctactgca       240
     gacacaacta cggggttgtg gagagcttca cagtgcagcg gcgaggtgag cgcggcgcgg       300
     ggcggggcct gagtccctgt gagc                                              324
//


spacer
spacer