spacer

EBI Dbfetch

ID   DQ179036; SV 1; linear; genomic DNA; STD; HUM; 220 BP.
XX
AC   DQ179036;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1501new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-220
RA   Klein R.R., Spychaj K., Baier D., Thiele B.H.;
RT   "Identification of 10 novel human HLA class II alleles by sequence-based
RT   typing (six DRB1-, two DRB3-alleles, one DRB5- and one DQB1 allele)";
RL   Unpublished.
XX
RN   [2]
RP   1-220
RA   Klein R.R., Spychaj K., Baier D., Thiele B.H.;
RT   ;
RL   Submitted (22-AUG-2005) to the INSDC.
RL   Institut fuer Immunologie und Genetik, Hellmut-Hartert-Str. 1,
RL   Kaiserslautern 67655, Germany
XX
DR   MD5; 241ee85bb4b3591af3b5ffa66ed71d1d.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..220
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>220
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501new"
FT   mRNA            <1..>220
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>220
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501new"
FT                   /product="MHC class II antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q3LTJ8"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LTJ8"
FT                   /protein_id="ABA06594.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDILEQARAAVDTYCRHNYGVV"
FT   exon            <1..>220
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501new"
FT                   /number=2
XX
SQ   Sequence 220 BP; 44 A; 54 C; 83 G; 39 T; 0 other;
     ggagtgtcat ttcttcaatg ggacggagcg ggtgcggttc ctggacagat acttctataa        60
     ccaggaggag tccgtgcgct tcgacagcga cgtcggggag ttccgggcgg tgacggagct       120
     ggggcggcct gacgctgagt actggaacag ccagaaggac atcctggagc aggcgcgggc       180
     cgcggtggac acctactgca gacacaacta cggggttgtg                             220
//


spacer
spacer