spacer

EBI Dbfetch

ID   DQ021879; SV 1; linear; mRNA; STD; MUS; 364 BP.
XX
AC   DQ021879;
XX
DT   01-APR-2006 (Rel. 87, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus perinatal myosin heavy chain (Myh8) mRNA, 5' UTR and partial
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-364
RA   Dennehey B.K., Leinwand L.A., Krauter K.S.;
RT   "Diversity in Transcriptional Start Site Selection and Alternative Splicing
RT   Affects the 5' UTR of Mouse Striated Muscle Myosin Transcripts";
RL   Unpublished.
XX
RN   [2]
RP   1-364
RA   Dennehey B.K., Krauter K.S.;
RT   ;
RL   Submitted (29-APR-2005) to the INSDC.
RL   Molecular, Cellular and Developmental Biology, University of Colorado at
RL   Boulder, CB 347, Boulder, CO 80309, USA
XX
DR   MD5; fa9dfb3b47ebe30800640defb6bdbcad.
DR   Ensembl-Gn; ENSMUSG00000055775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108685; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..364
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="between MYH4 and MYH13"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo (15-17 dpc)"
FT                   /db_xref="taxon:10090"
FT   gene            1..>364
FT                   /gene="Myh8"
FT   5'UTR           1..72
FT                   /gene="Myh8"
FT   variation       4
FT                   /gene="Myh8"
FT                   /replace=""
FT   CDS             73..>364
FT                   /codon_start=1
FT                   /gene="Myh8"
FT                   /product="perinatal myosin heavy chain"
FT                   /note="transcript variant 5; alternatively spliced"
FT                   /db_xref="GOA:Q1WNQ0"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WNQ0"
FT                   /protein_id="AAY42760.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT"
XX
SQ   Sequence 364 BP; 105 A; 84 C; 92 G; 83 T; 0 other;
     ctgcactttt gctttttctt tctctcttcc atgtcctcaa aagctgaaac ctcggctaaa        60
     taagtagcag ccatgagtgc gggttcggac gcggagatgg ctatttttgg cgaagctgct       120
     ccttacctcc gaaaatcgga gaaggagagg attgaggccc aaaataagcc ttttgacgca       180
     aaaacatctg tctttgtggc ggagcccaag gagtcttatg tgaaaagcgt tatacaaagc       240
     aaggatggag ggaaagtgac cgtgaagacg gaaagtggag caactctcac cgtcaaggaa       300
     gatcaagtct tccccatgaa ccctcccaaa tatgacaaga tcgaggacat ggccatgatg       360
     accc                                                                    364
//


spacer
spacer