Dbfetch

ID   DQ021878; SV 1; linear; mRNA; STD; MUS; 429 BP.
XX
AC   DQ021878;
XX
DT   01-APR-2006 (Rel. 87, Created)
DT   01-APR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Mus musculus perinatal myosin heavy chain (Myh8) mRNA, 5' UTR and partial
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-429
RA   Dennehey B.K., Leinwand L.A., Krauter K.S.;
RT   "Diversity in Transcriptional Start Site Selection and Alternative Splicing
RT   Affects the 5' UTR of Mouse Striated Muscle Myosin Transcripts";
RL   Unpublished.
XX
RN   [2]
RP   1-429
RA   Dennehey B.K., Krauter K.S.;
RT   ;
RL   Submitted (29-APR-2005) to the INSDC.
RL   Molecular, Cellular and Developmental Biology, University of Colorado at
RL   Boulder, CB 347, Boulder, CO 80309, USA
XX
DR   MD5; 5d59788d47fd4a37bc9b2b8f7197454c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..429
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="between MYH4 and MYH13"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo (15-17 dpc)"
FT                   /db_xref="taxon:10090"
FT   gene            1..>429
FT                   /gene="Myh8"
FT   5'UTR           1..137
FT                   /gene="Myh8"
FT   CDS             138..>429
FT                   /codon_start=1
FT                   /gene="Myh8"
FT                   /product="perinatal myosin heavy chain"
FT                   /note="transcript variant 4; alternatively spliced"
FT                   /db_xref="GOA:Q1WNQ0"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WNQ0"
FT                   /protein_id="AAY42759.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT"
XX
SQ   Sequence 429 BP; 128 A; 97 C; 111 G; 93 T; 0 other;
     aaactctata ctatatgtgc aggactgctg atcatcacta acggggacac ttcttgtttc        60
     acagtgaagg acaggcgtga ctctacgttt tcatccagag ctccatagct gaaacctcgg       120
     ctaaataagt agcagccatg agtgcgggtt cggacgcgga gatggctatt tttggcgaag       180
     ctgctcctta cctccgaaaa tcggagaagg agaggattga ggcccaaaat aagccttttg       240
     acgcaaaaac atctgtcttt gtggcggagc ccaaggagtc ttatgtgaaa agcgttatac       300
     aaagcaagga tggagggaaa gtgaccgtga agacggaaag tggagcaact ctcaccgtca       360
     aggaagatca agtcttcccc atgaaccctc ccaaatatga caagatcgag gacatggcca       420
     tgatgaccc                                                               429
//