spacer

EBI Dbfetch

ID   DQ021877; SV 1; linear; mRNA; STD; MUS; 435 BP.
XX
AC   DQ021877;
XX
DT   01-APR-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus perinatal myosin heavy chain (Myh8) mRNA, 5' UTR and partial
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-435
RA   Dennehey B.K., Leinwand L.A., Krauter K.S.;
RT   "Diversity in Transcriptional Start Site Selection and Alternative Splicing
RT   Affects the 5' UTR of Mouse Striated Muscle Myosin Transcripts";
RL   Unpublished.
XX
RN   [2]
RP   1-435
RA   Dennehey B.K., Krauter K.S.;
RT   ;
RL   Submitted (29-APR-2005) to the INSDC.
RL   Molecular, Cellular and Developmental Biology, University of Colorado at
RL   Boulder, CB 347, Boulder, CO 80309, USA
XX
DR   MD5; d310a4a706a5c906ae89dd558af64ba2.
DR   Ensembl-Gn; ENSMUSG00000055775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108685; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..435
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="between MYH4 and MYH13"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo (15-17 dpc)"
FT                   /db_xref="taxon:10090"
FT   gene            1..>435
FT                   /gene="Myh8"
FT   5'UTR           1..143
FT                   /gene="Myh8"
FT   CDS             144..>435
FT                   /codon_start=1
FT                   /gene="Myh8"
FT                   /product="perinatal myosin heavy chain"
FT                   /note="transcript variant 3; alternatively spliced"
FT                   /db_xref="GOA:Q1WNQ0"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WNQ0"
FT                   /protein_id="AAY42758.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT"
XX
SQ   Sequence 435 BP; 127 A; 108 C; 112 G; 88 T; 0 other;
     agcatcagca cttctgttcc tatataagca gggctgcccc tcacacccta tctccgccaa        60
     gagcccagag tgaaggacag gcgtgactct acgttttcat ccagagctcc atagctgaaa       120
     cctcggctaa ataagtagca gccatgagtg cgggttcgga cgcggagatg gctatttttg       180
     gcgaagctgc tccttacctc cgaaaatcgg agaaggagag gattgaggcc caaaataagc       240
     cttttgacgc aaaaacatct gtctttgtgg cggagcccaa ggagtcttat gtgaaaagcg       300
     ttatacaaag caaggatgga gggaaagtga ccgtgaagac ggaaagtgga gcaactctca       360
     ccgtcaagga agatcaagtc ttccccatga accctcccaa atatgacaag atcgaggaca       420
     tggccatgat gaccc                                                        435
//


spacer
spacer