Dbfetch

ID   DQ021876; SV 1; linear; mRNA; STD; MUS; 426 BP.
XX
AC   DQ021876;
XX
DT   01-APR-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus perinatal myosin heavy chain (Myh8) mRNA, 5' UTR and partial
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-426
RA   Dennehey B.K., Leinwand L.A., Krauter K.S.;
RT   "Diversity in Transcriptional Start Site Selection and Alternative Splicing
RT   Affects the 5' UTR of Mouse Striated Muscle Myosin Transcripts";
RL   Unpublished.
XX
RN   [2]
RP   1-426
RA   Dennehey B.K., Krauter K.S.;
RT   ;
RL   Submitted (29-APR-2005) to the INSDC.
RL   Molecular, Cellular and Developmental Biology, University of Colorado at
RL   Boulder, CB 347, Boulder, CO 80309, USA
XX
DR   MD5; e7e51df4cbc1ad748688b790097b9408.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..426
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="between MYH4 and MYH13"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo (15-17 dpc)"
FT                   /db_xref="taxon:10090"
FT   gene            1..>426
FT                   /gene="Myh8"
FT   5'UTR           1..134
FT                   /gene="Myh8"
FT   CDS             135..>426
FT                   /codon_start=1
FT                   /gene="Myh8"
FT                   /product="perinatal myosin heavy chain"
FT                   /note="transcript variant 2; alternatively spliced"
FT                   /db_xref="GOA:Q1WNQ0"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WNQ0"
FT                   /protein_id="AAY42757.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT"
XX
SQ   Sequence 426 BP; 124 A; 105 C; 110 G; 87 T; 0 other;
     acttctgttc ctatataagc agggctgccc ctcacaccct atctccgcca agagcccaga        60
     gtgaaggaca ggcgtgactc tacgttttca tccagagctc catagctgaa acctcggcta       120
     aataagtagc agccatgagt gcgggttcgg acgcggagat ggctattttt ggcgaagctg       180
     ctccttacct ccgaaaatcg gagaaggaga ggattgaggc ccaaaataag ccttttgacg       240
     caaaaacatc tgtctttgtg gcggagccca aggagtctta tgtgaaaagc gttatacaaa       300
     gcaaggatgg agggaaagtg accgtgaaga cggaaagtgg agcaactctc accgtcaagg       360
     aagatcaagt cttccccatg aaccctccca aatatgacaa gatcgaggac atggccatga       420
     tgaccc                                                                  426
//