spacer

EBI Dbfetch

ID   D89871; SV 1; linear; mRNA; STD; MUS; 2614 BP.
XX
AC   D89871;
XX
DT   15-DEC-1997 (Rel. 53, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for serine protease, complete cds.
XX
KW   serine protease.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2614
RA   Yamaguchi N.;
RT   ;
RL   Submitted (14-DEC-1996) to the INSDC.
RL   Nozomi Yamaguchi, Kyoto Pref. Univ. Med., Department of Cell biology;
RL   Kawaramachi Hirokoji, Kamigyo-ku, Kyoto 602 Japan, Kyoto 602, Japan
RL   (E-mail:nozomi@koto.kpu-m.ac.jp, Tel:+81-75-251-5848, Fax:+81-75-251-5848)
XX
RN   [2]
RX   DOI; 10.1006/bbrc.1997.7417.
RX   PUBMED; 9344839.
RA   Yamamura Y., Yamashiro K., Tsuruoka N., Nakazato H., Tsujimura A.,
RA   Yamaguchi N.;
RT   "Molecular cloning of a novel brain-specific serine protease with a
RT   kringle-like structure and three scavenger receptor cysteine-rich motifs";
RL   Biochem. Biophys. Res. Commun. 239(2):386-392(1997).
XX
DR   MD5; 075d3f4cdc682f27820fb91e8af48702.
DR   Ensembl-Gn; ENSMUSG00000027978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029603; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2614
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             245..2530
FT                   /codon_start=1
FT                   /product="serine protease"
FT                   /note="Brain-Specific Serine Proyease(BSSP-3)"
FT                   /db_xref="GOA:O08762"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR017448"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="MGI:MGI:1100881"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08762"
FT                   /protein_id="BAA23986.1"
FT                   /translation="MALARCVLAVILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYL
FT                   PSSRRPPRTPRFPLPLRIPAAQRPQVLSTGHTPPTIPRRCGAGESWGNATNLGVPCLHW
FT                   DEVPPFLERSPPASWAELRGQPHNFCRSPDGSGRPWCFYRNAQGKVDWGYCDCGQGPAL
FT                   PVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFG
FT                   EGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKST
FT                   HEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVS
FT                   CSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRV
FT                   EVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGN
FT                   EKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRI
FT                   IGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAV
FT                   RVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPA
FT                   CLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLC
FT                   AGNLQEDNRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVP
FT                   WIKSVTSL"
FT   polyA_signal    2553..2558
XX
SQ   Sequence 2614 BP; 614 A; 671 C; 799 G; 530 T; 0 other;
     cgagggtggg gtggaggtcg gactccgggc tacagagctc ctggcgctca tcgcctctgg        60
     ctccagcctt tgcttcgcgg ggctgaccct ttgggtcccg gtgtgatcct ccagctgccc       120
     cgggggctgg gacagcaggg cggcggcgcg agcgtgggag ggggctctag gactctgccg       180
     gccccgcccc gccccctccg cggggacccg gagcccagca tggaccacac tcggcgccgc       240
     agccatggcg ctcgcccgct gcgtgctggc tgtgatttta ggggcactgt ctgtagtggc       300
     ccgcgctgat ccggtctcgc gctctcccct tcaccgcccg catccgtccc caccgcgttc       360
     ccaacacgcg cactaccttc ccagctcgcg gcggccaccc aggaccccgc gcttcccgct       420
     cccgctgcgg atccccgctg cccagcgccc gcaggtcctc agcaccgggc acacgccccc       480
     gacgattcca cgccgctgcg gggcaggaga gtcgtggggc aatgccacca acctcggcgt       540
     cccgtgtcta cactgggacg aggtgccgcc cttcctggag cggtcgcccc cggccagttg       600
     ggctgagctg cgagggcagc cgcacaactt ctgccggagc ccggatggct cgggcagacc       660
     ttggtgcttc tatcggaatg cccagggcaa agtagactgg ggctactgcg attgtggtca       720
     aggcccggcg ttgcccgtca ttcgccttgt tggtgggaac agtgggcatg aaggtcgagt       780
     ggagctgtac cacgctggcc agtgggggac catctgtgac gaccaatggg acaatgcaga       840
     cgcagacgtc atctgtaggc agctggggct cagtggcatt gccaaagcat ggcatcaggc       900
     acattttggg gaaggatctg gcccaatatt gttggatgaa gtacgctgca ccggaaacga       960
     gctgtcaatt gagcaatgtc caaagagttc ctggggcgaa cataactgtg gccataaaga      1020
     agatgctgga gtgtcttgtg ttcctctaac agatggtgtc atcagactgg caggaggaaa      1080
     aagtacccat gaaggtcgcc tggaggtcta ctacaagggg cagtggggga cagtctgtga      1140
     tgatggctgg actgagatga acacatacgt ggcttgtcga ctgctgggat ttaaatacgg      1200
     caaacagtcc tctgtgaacc attttgatgg cagcaacagg cccatatggc tggatgacgt      1260
     cagctgctca ggaaaagaag tcagcttcat tcagtgttcc aggagacagt ggggaaggca      1320
     tgactgcagc catagagaag atgtgggcct cacctgctat cctgacagcg atggacatag      1380
     gctttctcca ggttttccca tcagactagt ggatggagag aataagaagg aaggacgagt      1440
     ggaggttttt gtcaatggcc aatggggaac aatctgcgat gacggatgga ccgataagca      1500
     tgcagctgtg atctgccggc agcttggcta taagggtcct gccagagcaa ggactatggc      1560
     ttattttggg gaaggaaaag gccccatcca catggataat gtgaagtgca caggaaatga      1620
     gaaggccctg gctgactgtg tcaaacaaga cattggaagg cacaactgcc gccacagtga      1680
     ggatgcagga gtcatctgtg actatttaga gaagaaagca tcaagtagtg gtaataaaga      1740
     gatgctctca tctggatgtg gactgaggtt actgcaccgt cggcagaaac ggatcattgg      1800
     tgggaacaat tctttaaggg gtgcctggcc ttggcaggct tccctcaggc tgaggtcggc      1860
     ccatggagac ggcaggctgc tttgtggagc tacccttctg agtagctgct gggtcctgac      1920
     agctgcacac tgcttcaaaa ggtacggaaa caactcgagg agctatgcag ttcgagttgg      1980
     ggattatcat actctggtac cagaggagtt tgaacaagaa ataggggttc aacagattgt      2040
     gattcacagg aactacaggc cagacagaag cgactatgac attgccctgg ttagattgca      2100
     aggaccaggg gagcaatgtg ccagactaag cacccacgtt ttgccagcct gtttacctct      2160
     atggagagag aggccacaga aaacagcctc caactgtcac ataacaggat ggggagacac      2220
     aggtcgtgcc tactcaagaa ctctacaaca agctgctgtg cctctgttac ccaagaggtt      2280
     ttgtaaagag aggtacaagg gactatttac tgggagaatg ctctgtgctg ggaacctcca      2340
     agaagacaac cgtgtggaca gctgccaggg agacagtgga ggaccactca tgtgtgaaaa      2400
     gcctgatgag tcctgggttg tgtatggggt gacttcctgg gggtatggat gtggagtcaa      2460
     agacactcct ggagtttata ccagagtccc cgcctttgta ccttggataa aaagtgtcac      2520
     cagtctgtaa cttatggaaa gctcaagaaa atagtaaaac agtaaccatt cagtcttcat      2580
     acttggcacc atgccagaaa aaaaaaaaaa aaaa                                  2614
//


spacer
spacer