Dbfetch

ID   D88310; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   D88310;
XX
DT   01-NOV-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens DNA for HLA-DRB1 antigen, partial cds.
XX
KW   HLA-DRB1 antigen; HLA-DRB1*1406Var.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kashiwase K.;
RT   ;
RL   Submitted (08-OCT-1996) to the INSDC.
RL   Kouichi Kashiwase, Japanese Central Red Cross Blood Center, 3rd Laboratory;
RL   Hiroo 4-1-31, Shibuya-ku, Tokyo 150, Japan (E-mail:kasiwase@hla.jrc.or.jp,
RL   Tel:03-3406-1211, Fax:03-3406-7892)
XX
RN   [2]
RP   1-270
RA   Kouichi K.;
RT   "Sequence of new allele";
RL   Unpublished.
XX
DR   MD5; e718eb14a725464e821d844ff92ae28d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="JC6094"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /product="HLA-DRB1 antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:29"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="BAA13587.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1*1406Var"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 66 C; 99 G; 48 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//