Dbfetch

ID   D87812; SV 1; linear; mRNA; STD; HUM; 2565 BP.
XX
AC   D87812; D64178;
XX
DT   19-OCT-1996 (Rel. 49, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens mRNA for carnitine palmitoyltransferase I, complete cds.
XX
KW   carnitine palmitoyltransferase I; CPTI-M.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2565
RA   Yamazaki N.;
RT   ;
RL   Submitted (12-SEP-1996) to the INSDC.
RL   Naoshi Yamazaki, University of Tokushima, Faculty of Pharmaceutical
RL   Sciences; 1 Shomachi, Tokushima, Tokushima 770, Japan
RL   (E-mail:yamazaki@ph.tokushima-u.ac.jp, Tel:0886-33-7279, Fax:0886-33-5196)
XX
RN   [2]
RP   1-2565
RX   DOI; 10.1016/0167-4781(96)00069-3.
RX   PUBMED; 8679700.
RA   Yamazaki N., Shinohara Y., Shima A., Yamanaka Y., Terada H.;
RT   "Isolation and characterization of cDNA and genomic clones encoding human
RT   muscle type carnitine palmitoyltransferase I";
RL   Biochim. Biophys. Acta 1307(2):157-161(1996).
XX
DR   MD5; 95a13d11d279c0414e6be4a3cee04d02.
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
CC   D64178:Submitted (10-Sep-1996) to by:Yasuo Shinohara
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2565
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="heart"
FT                   /clone="39H11"
FT                   /db_xref="taxon:9606"
FT   CDS             20..2338
FT                   /codon_start=1
FT                   /product="carnitine palmitoyltransferase I"
FT                   /EC_number="2.3.1.21"
FT                   /note="homologous to rat muscle type"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000101964.12"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR032476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /protein_id="BAA13461.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
FT                   PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKY
FT                   LVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAM
FT                   IMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHK
FT                   GRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAF
FT                   FSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFT
FT                   LISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTR
FT                   LQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQL
FT                   AHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQK
FT                   AAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQI
FT                   RMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNH
FT                   IRKALLDIADLFQVPKAYS"
FT   regulatory      2536..2541
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2565 BP; 557 A; 758 C; 700 G; 550 T; 0 other;
     gtgccgacca acccccagga tggcggaagc tcaccaggcc gtggccttcc agttcacggt        60
     gaccccagac ggggtcgact tccggctcag tcgggaggcc ctgaaacacg tctacctgtc       120
     tgggatcaac tcctggaaga aacgcctgat ccgcatcaag aatggcatcc tcaggggcgt       180
     gtaccctggc agccccacca gctggctggt cgtcatcatg gcaacagtgg gttcctcctt       240
     ctgcaacgtg gacatctcct tggggctggt cagttgcatc cagagatgcc tccctcaggg       300
     gtgtggcccc taccagaccc cgcagacccg ggcacttctc agcatggcca tcttctccac       360
     gggcgtctgg gtgacgggca tcttcttctt ccgccaaacc ctgaagctgc ttctctgcta       420
     ccatgggtgg atgtttgaga tgcatggcaa gaccagcaac ttgaccagga tctgggctat       480
     gtgtatccgc cttctatcca gccggcaccc tatgctctac agcttccaga catctctgcc       540
     caagcttcct gtgcccaggg tgtcagccac aattcagcgg tacctagagt ctgtgcgccc       600
     cttgttggat gatgaggaat attaccgcat ggagttgctg gccaaagaat tccaggacaa       660
     gactgccccc aggctgcaga aatacctggt gctcaagtca tggtgggcaa gtaactatgt       720
     gagtgactgg tgggaagagt acatctacct tcgaggcagg agccctctca tggtgaacag       780
     caactattat gtcatggacc ttgtgctcat caagaataca gacgtgcagg cagcccgcct       840
     gggaaacatc atccacgcca tgatcatgta tcgccgtaaa ctggaccgtg aagaaatcaa       900
     gcctgtgatg gcactgggca tagtgcctat gtgctcctac cagatggaga ggatgttcaa       960
     caccactcgg atcccgggca aggacacaga tgtgctacag cacctctcag acagccggca      1020
     cgtggctgtc taccacaagg gacgcttctt caagctgtgg ctctatgagg gcgcccgtct      1080
     gctcaagcct caggatctgg agatgcagtt ccagaggatc ctggacgacc cctccccacc      1140
     tcagcctggg gaggagaagc tggcagccct cactgcagga ggaagggtgg agtgggcgca      1200
     ggcacgccag gccttcttta gctctggaaa gaataaggct gccttggagg ccatcgagcg      1260
     tgccgctttc ttcgtggccc tggatgagga atcctactcc tatgaccccg aagatgaggc      1320
     cagcctcagc ctctatggca aggccctgct acatggcaac tgctacaaca ggtggtttga      1380
     caaatccttc actctcattt ccttcaagaa tggccagttg ggtctcaatg cagagcatgc      1440
     gtgggcagat gctcccatca ttgggcacct ctgggagttt gtcctgggca cagacagctt      1500
     ccacctgggc tacacggaga ccgggcactg cctgggcaaa ccgaaccctg cgctcgcacc      1560
     tcctacacgg ctgcagtggg acattccaaa acagtgccag gcggtcatcg agagttccta      1620
     ccaggtggcc aaggcgttgg cagacgacgt ggagttgtac tgcttccagt tcctgccctt      1680
     tggcaaaggc ctcatcaaga agtgccggac cagccctgat gcctttgtgc agatcgcgct      1740
     gcagctggct cacttccggg acaggggtaa gttctgcctg acctatgagg cctcaatgac      1800
     cagaatgttc cgggagggac ggactgagac tgtgcgttcc tgtaccagcg agtccacagc      1860
     ctttgtgcag gccatgatgg aggggtccca cacaaaagca gacctgcgag atctcttcca      1920
     gaaggctgct aagaagcacc agaatatgta ccgcctggcc atgaccgggg cagggatcga      1980
     caggcacctc ttctgccttt acttggtctc caagtaccta ggagtcagct ctcctttcct      2040
     tgctgaggtg ctctcggaac cctggcgtct ctccaccagc cagatccccc aatcccagat      2100
     ccgcatgttc gacccagagc agcaccccaa tcacctgggc gctggaggtg gctttggccc      2160
     tgtagcagat gatggctatg gagtttccta catgattgca ggcgagaaca cgatcttctt      2220
     ccacatctcc agcaagttct caagctcaga gacgaacgcc cagcgctttg gaaaccacat      2280
     ccgcaaagcc ctgctggaca ttgctgatct tttccaagtt cccaaggcct acagctgaag      2340
     cccttaggta cctgtgtttt gtttgggaac tcggaggccc tccccctccc ccagctcaga      2400
     ccacagaggt ggcaagagaa gggctgaagc tggaagactg ttcatgaggg acttgtgtga      2460
     cctgctttga aatgtgtgac tctgctgagt gacgtaggct ctgagatagc tgtccacgcc      2520
     cacgtgtttg cttggaataa atacttgcct cagaaccttc aaaaa                      2565
//