Dbfetch

ID   D86177; SV 1; linear; mRNA; STD; MUS; 2403 BP.
XX
AC   D86177;
XX
DT   22-OCT-1996 (Rel. 49, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for phosphatidylinositol 4-phosphate 5-kinase type
DE   I-beta, complete cds.
XX
KW   phosphatidylinositol 4-phosphate 5-kinase type I-beta.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2403
RA   Ishihara H.;
RT   ;
RL   Submitted (21-JUN-1996) to the INSDC.
RL   Hisamitsu Ishihara, University of Tokyo, Third department of Internal
RL   Medicine; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113, Japan
RL   (Tel:81-3-3815-5411(ex.3111), Fax:81-3-5800-6798)
XX
RN   [2]
RP   1-2403
RA   Ishihara H.;
RT   "Mouse mRNA for phosphatidylinositol 4-phosphate 5-kinase type I-beta,
RT   complete cds.";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1074/jbc.271.39.23611.
RX   PUBMED; 8798574.
RA   Ishihara H., Shibasaki Y., Kizuki N., Katagiri H., Yazaki Y., Asano T.,
RA   Oka Y.;
RT   "Cloning of cDNAs encoding two isoforms of 68-kDa type I
RT   phosphatidylinositol-4-phosphate 5-kinase";
RL   J Biol Chem 271(39):23611-23614(1996).
XX
DR   MD5; 80e78200652288956673cd5a4f691bc0.
DR   Ensembl-Gn; ENSMUSG00000028126; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027566; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027525; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027537; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027270; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027985; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026720; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027247; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027386; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027357; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027495; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027384; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028039; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026802; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000107233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107236; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062312; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0062337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0062273; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062263; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061949; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062761; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062251; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0061920; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0062027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0062002; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0062168; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062002; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062953; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061789; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061222; mus_musculus_wsbeij.
DR   EuropePMC; PMC155223; 12748291.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2403
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="MIN6"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             270..1910
FT                   /product="phosphatidylinositol 4-phosphate 5-kinase type
FT                   I-beta"
FT                   /db_xref="GOA:P70182"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="MGI:MGI:107929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70182"
FT                   /protein_id="BAA13031.1"
FT                   /translation="MASASSGPAAAGFSSLDAGAPAGTAAASGIKRATVSEGPSASVMP
FT                   VKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESI
FT                   FFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGA
FT                   SGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGK
FT                   NIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKDREKTLPTFKDLDFLQDIPDGLFL
FT                   DADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAP
FT                   QKALYSTAMESIQGEARRGGTVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKK
FT                   LEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRS
FT                   GPSGNSCTSQLMASGEHRAQVTTKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSF
FT                   SPVVGQPLQILNLSSTLEKLDVAESEFTH"
XX
SQ   Sequence 2403 BP; 574 A; 625 C; 616 G; 588 T; 0 other;
     ccggggcccg gctcaagtgt tcctgtctgg taagagaagg tagctttggc ggagagcagt        60
     tcaagttgct aggaaggtgc gagactgcag ctctccccca tgccgggcaa gtggtgcggt       120
     cctgagcttg tcctggagcc tgaacaacgc ctgtgagaag cccgccgaac gcgggttctg       180
     tgaagagacg tggggaagat tcgattccga gaaaaggaaa agccggattg aaagggagcg       240
     aagccgcaga gggggagggg gctgccaaga tggcgtccgc ctcctcaggg ccagcggcgg       300
     ccgggttttc atcccttgat gccggggccc ctgctggtac cgcagcagca tctggaatca       360
     agagagccac agtatctgag ggaccttccg cctctgtcat gcctgttaaa aaaataggcc       420
     atcgaagtgt tgattcctct ggagagacta catacaagaa gacaacttca tcagccttga       480
     aaggtgccat ccagttaggc atcactcaca ctgtgggcag cctgagcacc aaaccagagc       540
     gtgatgtcct catgcaagac ttctacgtgg tggagagcat ctttttcccc agtgaaggca       600
     gcaacctgac accggctcac cattacaatg actttcgatt caagacctat gcgcctgttg       660
     ccttccgtta cttcagagag ctctttggca tccggcctga tgattacttg tactcccttt       720
     gcagtgagcc attgattgaa ctctccaatt ctggagctag tggttccctc ttctatgtgt       780
     ccagtgatga tgaattcatc attaagaccg tccagcataa agaagcagaa tttctgcaga       840
     agttgcttcc aggatactac atgaatctta accaaaaccc tcgtactttg ctgcccaaat       900
     tttatggatt gtactgtgtg caagcaggcg gcaagaacat acgaattgtg gtgatgaaca       960
     atctcttgcc tcggtcagtc aaaatgcata tgaaatatga cctgaagggt tcaacttaca      1020
     agcggcgggc ttctcagaaa gaccgagaga aaactctccc cacctttaaa gacctggact      1080
     tcctacaaga tatccctgac ggcctatttt tggatgctga catgtacagt gctctgtgta      1140
     agactctaca gcgtgactgt ttggtgctgc agagcttcaa gataatggac tacagcctgt      1200
     tgatgtccat ccacaacatg gaccatgcac agagggagcc cacgagcaat gacacacagt      1260
     actcggctga cacgcgcaga ccagccccac agaaggcgct ctattccaca gctatggaat      1320
     ccatccaggg cgaggctcga cggggcggca ctgtggagac tgaggaccac atgggtggca      1380
     tccctgcccg gaataacaaa ggagaaaggc tcctgcttta tattggcatc attgatattc      1440
     ttcagtccta caggtttgtt aagaagttgg agcactcttg gaaagcactg gtccatgatg      1500
     gggatacggt gtcagtgcat cgtccaggct tctatgctga gcggttccag cgtttcatgt      1560
     gcaacacagt gttcaagaag attcccttga agccttctcc taccaaaaag tttcggtctg      1620
     gcccgtcttt ctctcggcga tcaggcccca gcggcaactc ctgcacctcc cagctgatgg      1680
     cctctgggga acacagagca caagtgacca ccaaggcgga agtggagcca gatgtacacc      1740
     ttgggcgtcc tgatgtctta cctcagactc cacctttgga ggaaataagt gagggttcac      1800
     ctgttcctgg ccccagtttc tcacctgtag ttggacaacc tttgcaaata ctaaatttga      1860
     gttcaacctt ggaaaagctt gatgttgcag agtcagagtt cacccactga gcagtgagcc      1920
     tcagaagacc tgaaacaaga ctctgctgtc gctttgatcc caagatgtca gcccttgccc      1980
     caggaatgct gaatcgtctt cttggtcatc aacagaggag agaatgtgga gctagcaggg      2040
     ctctgacact gtctcccctt cctctgggca gtagtgcctt tgacagttga ggacagcatc      2100
     gtccccacca ctccagaagt gggtggcgtg aattttccac tgcctgccat ggcttctata      2160
     gctgaatatt tttccagacc cccattcttt gtgctgacat ggggttgctg gactggtggt      2220
     ttcctcctgt ttacctttct cctggagctg gactcttcat ttcctcagga cggactgact      2280
     ggacattgtt cctgccattg gctctcccgc tgggtctgtg gagactccca atgatttgta      2340
     taaaggtgtt tgggggaaag taaggatcat cccttactcc caaccttctt ttccttaaaa      2400
     aaa                                                                    2403
//