spacer

EBI Dbfetch

ID   D85414; SV 1; linear; mRNA; STD; MUS; 5470 BP.
XX
AC   D85414; D10714;
XX
DT   13-JUN-1996 (Rel. 48, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus mRNA, partial cds.
XX
KW   developmentally down-regulated expression; Nedd4;
KW   NPC-expressed, developmentally down-regulated genes.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5470
RA   Kumar S.;
RT   ;
RL   Submitted (22-MAY-1996) to the INSDC.
RL   Sharad Kumar, Hanson Centre for Cancer Research, Institute of Medical and
RL   Veterinary Science; Frome Road, Adelaide, SA 5000, Australia
RL   (E-mail:skumar@immuno.imvs.sa.gov.au, Tel:+61-8-222-3738,
RL   Fax:+61-8-222-3139)
XX
RN   [2]
RA   Kumar S.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1016/0006-291X(92)91747-E.
RX   PUBMED; 1378265.
RA   Kumar S., Tomooka Y., Noda M.;
RT   "Identification of a set of genes with developmentally down-regulated
RT   expression in the mouse brain";
RL   Biochem. Biophys. Res. Commun. 185(3):1155-1161(1992).
XX
DR   MD5; 838dd5eab102828c6920add26d0e5eb6.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
DR   EuropePMC; PMC114644; 11602704.
DR   EuropePMC; PMC87143; 11416145.
XX
CC   D10714:Submitted(16-Mar-1992) to DDBJ by:Sharad Kumar
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5470
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /clone_lib="lambda Uni Zap vector"
FT                   /cell_type="neural precursor"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2874
FT                   /codon_start=1
FT                   /gene="Nedd4"
FT                   /note="possible ubiquitin protein ligase"
FT                   /db_xref="GOA:P46935"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="PDB:3M7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46935"
FT                   /protein_id="BAA12803.1"
FT                   /translation="HACSNPAPQASRAAAERVPPLLAARPCTPARSRSGPPPPQRRLLL
FT                   LFLSPSLSVSRSLSPLQPSRGASSSMSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGS
FT                   PGSDVTDTCEPPCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKK
FT                   DILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFD
FT                   ENRLTRDDFLGQVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
FT                   KNGSEDENADQAEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNH
FT                   ESRRTQWKRPSPDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVRE
FT                   DENTEYSGQAVQSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQT
FT                   CIFEEQPTLPVLLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIP
FT                   AHLRGKTDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYS
FT                   RDYKRKYEFFRRKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFD
FT                   GEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKF
FT                   IGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTEL
FT                   DLRFIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEG
FT                   FFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWM
FT                   MDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDL
FT                   PPYESFDELWDKLQMAIENTQGFDGVD"
XX
SQ   Sequence 5470 BP; 1534 A; 1258 C; 1247 G; 1431 T; 0 other;
     cacgcttgct ccaacccagc cccccaagcc tcgcgcgcag ccgcagagcg ggtcccgccc        60
     cttctcgccg cgcgcccctg caccccagcg cgctcccgga gtgggcctcc tccgccgcag       120
     cgacgcctcc tcctcctctt cctctctcct tctctctcgg tctctcgctc tctctcgccg       180
     ctgcagccta gtaggggcgc ttcgtccagc atgagctcgg acatggcagc cgacgagtcg       240
     gaggccccag tactctcgga ggacgaggta tgggagtttt gcctggataa gacagaagat       300
     ggtggcggat cccccggaag tgatgttaca gacacttgtg agcctccatg tggatgctgg       360
     gagttgaatc cgaattccct ggaagaggag cacgtgctgt tcactgctga tccgtacctg       420
     gagctccaca acgatgacac acgagttgtg agagtgaagg ttatagctgg cataggcctg       480
     gccaagaaag acatcttggg agccagtgat ccttacgtaa gagtgacatt gtatgacccg       540
     atgagtggaa tccttaccag cgtgcagaca aaaactatca aaaagtcttt gaatccaaaa       600
     tggaatgaag aaatactgtt cagggtcctt ccacagcgac accgcattct tttcgaagtg       660
     tttgatgaaa atcgtttgac aagagatgat ttcctaggtc aagtggatgt ccctctctat       720
     cctttaccga ctgaaaaccc aagaatggag agaccatata catttaagga ttttgttctt       780
     catccaagaa gtcacaaatc aagagttaaa ggttatctga gattaaaaat gacttattta       840
     cctaaaaatg gctcagaaga tgaaaatgca gaccaggctg aggagttaga gcctggctgg       900
     gttgttttgg accaaccaga tgctgccact catttgccgc atccaccaga accctctccc       960
     ctacctccag gatgggaaga gaggcaggat gtccttggaa ggacctacta cgtaaaccat      1020
     gaatctagaa gaacacagtg gaaaaggcca agccctgacg atgacctcac ggatgaagac      1080
     aatgatgata tgcagctgca agcgcagcga gcattcacca ccaggcggca gatatcggag      1140
     gatgtggatg gccctgacaa ccgggagtcc cctgagaatt gggaaatcgt acgagaagat      1200
     gaaaacaccg agtatagtgg tcaggctgtc cagtcacctc catcgggtca cattgatgtg      1260
     cagactcacc ttgcagaaga gtttaatacc agacttgccg tgtgtggaaa tccagccacc      1320
     agccagccgg ttaccagctc aaatcattcc agcagaggag gcagcttgca gacctgtatc      1380
     tttgaggaac agcctacact tcctgtgctt ttgcctactt catctggatt gccaccaggt      1440
     tgggaagaaa aacaagatga cagaggaaga tcatactatg tagaccacaa ctctaaaacc      1500
     accacatggt ccaagcccac catgcaggat gatccaagat cgaaaatccc tgctcatctg      1560
     agaggaaaga ctgactccaa tgacctggga cccttacctc caggctggga agaaagaacc      1620
     cacacagatg ggcgagtctt cttcataaac cacaatataa agaagaccca gtgggaagat      1680
     cctcgcctgc agaacgtggc aatcactgga ccagcagtgc cctactccag agattacaag      1740
     agaaagtacg agttcttcag aaggaagctc aagaagcaga ctgacattcc aaacaaattt      1800
     gaaatgaagc ttcgccgcgc aaacattctg gaggattctt accggaggat tatgggtgtg      1860
     aagagagctg acttgctcaa ggccagactc tggattgagt ttgatggtga aaagggcctt      1920
     gactatggag gggttgccag agagtggttc ttcctcatct cgaaggaaat gttcaaccct      1980
     tactacggcc tgtttgaata ttctgctacg gataattaca ccctacagat aaatcctaac      2040
     tcgggcttgt gtaatgaaga tcacctctca tacttcaagt tcattggccg tgtggctggg      2100
     atggcagttt atcatggcaa gctgttggat gggtttttca tccgtccgtt ttacaagatg      2160
     atgcttcaga aactgataac actgcacgac atggagtccg tggatagtga atattacagt      2220
     tctctgcgat ggattcttga aaatgacccg acggagctgg acctgagatt tatcatagat      2280
     gaagaacttt ttggacagac acatcagcac gaactgaaaa ccggaggatc agagattgtt      2340
     gtcaccaata agaacaaaaa ggagtatatc taccttgtaa tacaatggcg atttgtgaac      2400
     cgtatccaga agcaaatggc agcttttaaa gagggatttt ttgaactgat accacaggat      2460
     ctcatcaaga tatttgatga aaatgagcta gagcttctca tgtgtggtct gggagatgtg      2520
     gatgtgaacg actggcggga acacacaaaa tacaaaaatg gctacagcat gaaccaccag      2580
     gtcatccact ggttctggaa ggctgtttgg atgatggatt cggaaaaaag aatacgctta      2640
     cttcagtttg tcactggcac atcccgtgtg ccgatgaatg ggtttgctga actctatggc      2700
     tcgaatggac cacaatcctt cacagtggaa caatggggca cccctgataa gctgccaaga      2760
     gcacacacct gcttcaatcg cctggacctg ccaccctacg aatcctttga cgaactctgg      2820
     gataaacttc agatggcaat tgagaacaca cagggctttg atggcgttga ttagattaca      2880
     aaaaaaaaca agctgtggtg tcttgtacac catagtttct aagcaaaagc aaaaacaaaa      2940
     tcacatttta acattttcca gatagtttct aaaagatggt cactggctct tcccaccgag      3000
     accagaggac agtttatcca tgatttagcc accaccatgc tgacctgttc acttgtccag      3060
     ttactttgtc cagttgttgg ggttcatgtg tacggcaggc tgtgagtcct gtacgcctga      3120
     gttcttaccc tatctcatct tgctaggcac atccttctga aactactgag attccaactg      3180
     tgaaatatct gtaatgagta gctggtggga aaaatttgat gctttttaaa gatgaaattt      3240
     ggacaaagaa agtctttaat gattagtata ctgcgacata cttagtacca catgtcgcta      3300
     cttattctgt agacctgcct agtgtacctt atcgcctaga accttgaagc cgctttggtt      3360
     gatgtatcac acgtgttttt agtcacttaa gtcactagtg tttaaaaaaa aaaatgtact      3420
     cttcacttgg gaagtatttc acgtttgtta gcatgcagct tgagccttaa caggcgatta      3480
     tggagacaag tggagcaagc ttttattgca gtgtgtagtg agtcttaggc ctcctttttg      3540
     cctgtgcatc ctaaggctag agtcattatg tgttagtgcg ttagaattcc ttcaaacacg      3600
     aaacaagctc cacaacgcag tgtttctaag catgccgtga agaaccgagt tccatgtatg      3660
     acttgccctt accagccact cttcacgctt gcagtcacgt agtacatacg tgtttacgga      3720
     gttcattatg tttacagatt aagcgaattt ctgtagttgc atttttatat ttttagtatc      3780
     acattagtat ataaaaattt gtttaaaata accaaagagt agttcaatgc ataatttgta      3840
     tgaatttgtt accaagtttc ttatgctttc taaaaaatac tgtttccatt gaaattatgt      3900
     ttaatcaaag tcaagacctt gggaaatgct acagtgagtc ccacatagtc accttgaggc      3960
     acaggaagag gttccatgca tgcatctgca cacatgagca gtgctggctg ctgtgcaccg      4020
     ggcccttgga tgaagccatc agcactgaca tccagccccg tcttcatcct caggcttaga      4080
     aacaagtggg atggtgactt tacagtcagt ggaagtaaga gcccgcagaa taacaaaggc      4140
     agaaggacag gaaagcgagg tccgagtccg actgtgaggt catatctgcc aaggctcctt      4200
     ctagtcagct tacactggtg attatgcgga aaatgctctt agatatgaga aaagcaatgt      4260
     ggcatgtaat gagttagtgt aagcttgtgt tataaacttt ccgaatgctt ataagtagcc      4320
     tgtgggagct gtaagaaata cttggggcca ttgatttaag cttgttggct ctaacatgac      4380
     taatacctgt cagcccatgg tagggatttc agtgacagta gtggaaacgc tttccacaga      4440
     ccacaccact atgttgatcg gtgaaagaca cccccaggcc agtgcatgct tccagagtgt      4500
     cctgatcagt cagccaggca tggccaccgt ccagtgttga ttttttatca ttagccagct      4560
     gagcctgcag cacggggctc atttccccgt ctggcagact gggcccactc attctgtctc      4620
     tcaaggctat ggtaagttct taaaggggta cttttctgca agccaccaga gtctgagtca      4680
     gctgtcccct cccagtaagc atgttcacct aaagtgattt agcctaggcg aggaggatcc      4740
     ctactacgtg ctggattatg tgtgtgttca tgtaaggatt tcagcgtcaa aagttcactt      4800
     cctccatagt ggcaaaataa cactaatatg ggctggtgtg ttatctggag tgcccccatt      4860
     gtgtggaaca agggtgaaaa cagaactgta cacggttgtt cagtgtcgtc cccagaactc      4920
     atccccagca gggcttagaa aacacgagct tccttcctcc ttcacactca ttttcctttg      4980
     gatgattcag tgacatcaca gaacctggtg tcccctccat cccaggtgtg tagtaatggt      5040
     ccgaaggacc ctggctggaa cacacagccc ccatgctagt gcatgaaaca ctcgttgata      5100
     ttctaccact ggggcattgt ggagtcacat tcacgaaaca cgaagccttg tacttctcta      5160
     gaaaagtgtt ttagcctact ttttctctaa tccccacccc aacaaatgaa acacaaaatt      5220
     gcattacaaa agcaaaccca aatggtattt gttttcgatt ttatttatac cgctcgagtt      5280
     attccttata cgtatcaagt taaactcaat tggttttaat gataagctat ttgacattgt      5340
     ttttaaattt tttcttatat ggtaaatgta tatccagatt aaggtatcga aatttattgc      5400
     ataaactata aaatcatttt caaaatctca attccacaaa taaagttcta ttctgatttt      5460
     aaaaacaaaa                                                             5470
//


spacer
spacer