Dbfetch

ID   D82344; SV 1; linear; mRNA; STD; HUM; 3029 BP.
XX
AC   D82344;
XX
DT   15-FEB-1997 (Rel. 50, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for NBPhox, complete cds.
XX
KW   NBPhox.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3029
RA   Yokoyama M.;
RT   ;
RL   Submitted (21-DEC-1995) to the INSDC.
RL   Masahiro Yokoyama, Japan Tobacco, Inc., Pharmaceutical Frontier Research
RL   Laboratories; 13-2 Fukuura 1-chome, Kanazawa-ku, Yokohama, Kanagawa
RL   236-0004, Japan (E-mail:masahiro.yokoyama@ims.jti.co.jp, Tel:045-786-7693,
RL   Fax:045-786-7692)
XX
RN   [2]
RX   DOI; 10.1093/dnares/3.5.311.
RX   PUBMED; 9039501.
RA   Yokoyama M., Nishi Y., Yoshii J., Okubo K., Matsubara K.;
RT   "Identification and cloning of neuroblastoma-specific and nerve
RT   tissue-specific genes through compiled expression profiles";
RL   DNA Res. 3(5):311-320(1996).
XX
DR   MD5; 610d9cf1e6e2a3eef85e40280214073e.
DR   Ensembl-Gn; ENSG00000109132; homo_sapiens.
DR   Ensembl-Tr; ENST00000226382; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3029
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="NBPhox"
FT                   /cell_line="IMR-32"
FT                   /cell_type="Neuroblastoma"
FT                   /db_xref="taxon:9606"
FT   CDS             361..1305
FT                   /codon_start=1
FT                   /product="NBPhox"
FT                   /db_xref="GOA:Q99453"
FT                   /db_xref="H-InvDB:HIT000101772.14"
FT                   /db_xref="HGNC:HGNC:9143"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99453"
FT                   /protein_id="BAA11555.1"
FT                   /translation="MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYN
FT                   PIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTT
FT                   FTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAA
FT                   AAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAG
FT                   APGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPIT
FT                   SIPDSLGGPFGSVLSSLQRPNGAKAALVKSSMF"
XX
SQ   Sequence 3029 BP; 692 A; 816 C; 800 G; 721 T; 0 other;
     ttaaattcta attagagatg caggaatcaa tgatagggag gttggacagc tcagttcccc        60
     agtgccagcc caatagacgg atgagttatt gtcatgtaaa aagcgccagc aataagacca       120
     accgctttgc tattgtccaa gtggaaagag ccaagtttat tatgaggact atatgctcta       180
     gagacctcag acaaggcatc tcataggagg ctttttcata aaactaggct ctgctggtag       240
     taaggaggcc agtttggagg caggcgttga gctgtgcaca tctccccact ccagccacct       300
     tctccatatc catcttttat ttcatttttc cacttggctg agccatccag aaccttttca       360
     atgtataaaa tggaatattc ttacctcaat tcctctgcct acgagtcctg tatggctggg       420
     atggacacct cgagcctggc ttcagcctat gctgacttca gttcctgcag ccaggccagt       480
     ggcttccagt ataacccgat aaggaccact tttggggcca cgtccggctg cccttccctc       540
     acgccgggat cctgcagcct gggcaccctc agggaccacc agagcagtcc gtacgccgca       600
     gttccttaca aactcttcac ggaccacggc ggcctcaacg agaagcgcaa gcagcggcgc       660
     atccgcacca ctttcaccag tgcccagctc aaagagctgg aaagggtctt cgcggagact       720
     cactaccccg acatctacac tcgggaggag ctggccctga agatcgacct cacagaggcg       780
     cgagtccagg tgtggttcca gaaccgccgc gccaagtttc gcaagcagga gcgcgcagcg       840
     gcagccgcag cggccgcggc caagaacggc tcctcgggca aaaagtctga ctcttccagg       900
     gacgacgaga gcaaagaggc caagagcact gacccggaca gcactggggg cccaggtccc       960
     aatcccaacc ccacccccag ctgcggggcg aatggaggcg gcggcggcgg gcccagcccg      1020
     gctggagctc cgggggcggc ggggcccggg ggcccgggag gcgaacccgg caagggcggc      1080
     gcagcagcag cggcggcggc cgcggcagcg gcggcggcgg cagcggcagc ggcggcagct      1140
     ggaggcctgg ctgcggctgg gggccctgga caaggctggg ctcccggccc cggccccatc      1200
     acctccatcc cggattcgct tgggggtccc ttcggcagcg tcctatcttc gctccaaaga      1260
     cccaacggtg ccaaagccgc cttagtgaag agcagtatgt tctgatctgg aatcctgcgg      1320
     cggcggcggc ggcggcgaca gcgggcgagc cagggcccgg gcgggcgagt gggcgagcgg      1380
     gtaggcccaa ggctattgtc gtcgctgctg ccatggcttt ttcattgagg gcctaaagta      1440
     atcgcgctaa gaataaaggg aaaacggcgt cgccctcatt tcaaccccac tcctaccccc      1500
     ttcctcaacc cccaaacaaa acaaacaaac ttccctggct tcgcacctgc ctggggcctc      1560
     gcagcggggc cagggctccg cctgctgatc gggggttgtg agcagcgcgg cctggacgcg      1620
     gggcactctc agggggctgt gtctgcgtgt cagtttgtgt ctgtctcggg gaatgtgtgt      1680
     ctgtggccca agcaggtgac aggaagagat ggggggcctc aaccaactta gtgacttgtt      1740
     tagaaaaaaa agacaaaaaa gtaaaaataa aaacaaaaaa gttggaaggc agaaaccatt      1800
     aaaaaacaaa aagccaacaa cccagaaagg tttaaaaaac ataaggaaaa aaaagacaaa      1860
     ttaaaggagg ggctagggga gaagctgcag ctggagctga aggctcgatc ttgtgaaccc      1920
     ctaaatccgc tccctcctaa cagcacggat tctcttgggg ctcttcttca gggaagagta      1980
     gggacgccgt tccagccccc cttcctatcg tgtccttggg ttcgggtcac tgcggcgacg      2040
     acttgctcag actgtcccgg cggccggagt gactttctcg cacccccttg cctgtcccac      2100
     ctcgctgaac accatcccgc cattagcgca tcggaacccc acacagttgc aactcccaac      2160
     cccgaatctt tgcagccgtt cggccctgaa agatgcccta tccatgagat gccttttcat      2220
     ctgcaaactc tgcaaaatgt gtctcatgtt tcgcaactct ttttttcccc ctcgctcccg      2280
     cctaccccgt cggcattttc ttcttccacc agcttttact gaactttttg gcactgcttt      2340
     ggattggggt caattgcagt ccacgtaact ggctgcagag aaatctaccg agcaaggaaa      2400
     aggcacacac acacgtttgc aggggtgtct cggtttgcat ttctgttgga atgatccgaa      2460
     ctggactcac atcctgtatg gtggatggac tgtatattga gggttccatt cttcgcgcag      2520
     tttagacatc tctgttttga ttctttgttg ttgtttttat tttaaaaggc acaaactcta      2580
     gatattagtt gaatgttgag gctttaactt tttcggtgtc tttctacaac tgtgttctgt      2640
     gactcaattg tatcgtgtta atatcagtgc agactgtctc ctctacgtga ccgtataatg      2700
     tttttctcgt cttgtagtct ctatggcgtg tctttatggt gtaataaggt tctcacgggg      2760
     tcaatctttt gtgtttagag aggccacggt tcagacaatg gtatatattt ttgttatcag      2820
     gtgcatgtct gtctgatttc tttttttttc ctgttggact atgtttgtga acataattgt      2880
     cataagttat gtttcagatt tttgaattta tttatatgtg ttataatgaa tgcttctatt      2940
     taaaagggaa atatttctac atgtgcttat agttttccaa gagtgtacca ttaacttgat      3000
     tgttgataat aaaaaccaaa agcaagtct                                        3029
//