spacer

EBI Dbfetch

ID   D61380; SV 2; linear; mRNA; STD; HUM; 822 BP.
XX
AC   D61380;
XX
DT   28-JUL-1995 (Rel. 44, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens mRNA for DJ-1 protein, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Ariga H., Nagakubo D., Maeda J., Taira T., Iguchi-Ariga S.M.;
RT   ;
RL   Submitted (26-JUN-1995) to the INSDC.
RL   Hiroyoshi Ariga, Hokkaido University, Graduate School of Pharmaceutical
RL   Sciences; Kita 12, Nishi 6, Kita-ku, Sapporo, Hokkaido 060-0812, Japan
RL   (E-mail:hiro@pharm.hokudai.ac.jp, Tel:81-11-706-3745, Fax:81-11-706-4988)
XX
RN   [2]
RX   DOI; 10.1006/bbrc.1997.6132.
RX   PUBMED; 9070310.
RA   Nagakubo D., Taita T., Kitaura H., Ikeda M., Tamai K., Iguchi-Ariga S.M.,
RA   Ariga H.;
RT   "DJ-1, a novel oncogene product";
RL   Biochem. Biophys. Res. Commun. 231(2):509-513(1997).
XX
DR   MD5; aada03abc046c135152e7cc1ee6dfccf.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
DR   EuropePMC; PMC16559; 10840051.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="DJ-1"
FT                   /cell_line="HeLa"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..6
FT   CDS             7..576
FT                   /codon_start=1
FT                   /product="DJ-1 protein"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="H-InvDB:HIT000101667.13"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /protein_id="BAA09603.2"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAA
FT                   ICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALNGKEVAAQVKAPLVLKD"
FT   3'UTR           577..822
FT   polyA_signal    780..784
XX
SQ   Sequence 822 BP; 247 A; 164 C; 215 G; 196 T; 0 other;
     ataaaaatgg cttccaaaag agctctggtc atcctggcta aaggagcaga ggaaatggag        60
     acggtcatcc ctgtagatgt catgaggcga gctgggatta aggtcaccgt tgcaggcctg       120
     gctggaaaag acccagtaca gtgtagccgt gatgtggtca tttgtcctga tgccagcctt       180
     gaagatgcaa aaaaagaggg accatatgat gtggtggttc taccaggagg taatctgggc       240
     gcacagaatt tatctgagtc tgctgctgtg aaggagatac tgaaggagca ggaaaaccgg       300
     aagggcctga tagccgccat ctgtgcaggt cctactgctc tgttggctca tgaaataggt       360
     tttggaagta aagttacaac acaccctctt gctaaagaca aaatgatgaa tggaggtcat       420
     tacacctact ctgagaatcg tgtggaaaaa gacggcctga ttcttacaag ccgggggcct       480
     gggaccagct tcgagtttgc gcttgcaatt gttgaagccc tgaatggcaa ggaggtggcg       540
     gctcaagtga aggctccact tgttcttaaa gactagagca gcgaactgcg acgatcactt       600
     agagaaacag gccgttagga atccattctc actgtgttcg ctctaaacaa aacagtggta       660
     ggttaatgtg ttcagaagtc gctgtcctta ctacttttgc ggaagtatgg aagtcacaac       720
     tacacagaga tttctcagcc tacaaattgt gtctatacat ttctaagcct tgtttgcaga       780
     ataaacaggg catttagcaa actaaaaaaa aaaaaaaaaa aa                          822
//


spacer
spacer