spacer

EBI Dbfetch

ID   D50621; SV 1; linear; mRNA; STD; MUS; 2338 BP.
XX
AC   D50621;
XX
DT   26-MAY-1995 (Rel. 43, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus mRNA for PSD-95/SAP90A, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2338
RA   Kohmura N.;
RT   ;
RL   Submitted (19-MAY-1995) to the INSDC.
RL   Naohiro Kohmura, National Institute for Physiological Sciences, Laboratory
RL   of Neurobiology and Behavioral Genetics; 38 Nishigonaka, Myodaiji, Okazaki,
RL   Aichi 444, Japan (URL:kohmura@nips.ac.jp, Tel:81-564-55-7744,
RL   Fax:81-564-55-7741)
XX
RN   [2]
RP   1-2338
RA   Kohmura N., Yagi T.;
RT   "Mouse Homologue of Rat PSD-95/SAP90A";
RL   Unpublished.
XX
DR   MD5; a4dcd97064b826a91aa90a410b467af6.
DR   Ensembl-Gn; ENSMUSG00000020886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108589; mus_musculus.
DR   EuropePMC; PMC18858; 11070096.
DR   EuropePMC; PMC2139813; 9314537.
DR   EuropePMC; PMC2652390; 19243221.
DR   EuropePMC; PMC29359; 11172053.
DR   EuropePMC; PMC30212; 11226313.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2338
FT                   /organism="Mus musculus"
FT                   /strain="DBA/2"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda ZAP"
FT                   /clone="14"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             58..2232
FT                   /codon_start=1
FT                   /product="PSD-95/SAP90A"
FT                   /function="guanylate kinase"
FT                   /db_xref="GOA:Q62108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR016313"
FT                   /db_xref="InterPro:IPR019583"
FT                   /db_xref="InterPro:IPR019590"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1277959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62108"
FT                   /protein_id="BAA09297.1"
FT                   /translation="MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTL
FT                   EAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGA
FT                   AAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKIIEIKL
FT                   IKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLED
FT                   VMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTD
FT                   YPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISF
FT                   ILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSR
FT                   FEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFHFGD
FT                   VLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGRE
FT                   DSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEID
FT                   GRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAV
FT                   RRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEG
FT                   DSFEEIYHKVKRVIEDLSGPYIWVPARERL"
XX
SQ   Sequence 2338 BP; 570 A; 685 C; 643 G; 440 T; 0 other;
     gcaaaactcc aatgaagtca gagcccccta ctcgccgccg cggccaggcc ccccaacatg        60
     gactgtctct gtatagtgac aaccaagaaa taccgctacc aagatgaaga cacgccccct       120
     ctggaacaca gcccggccca cctccccaac caggccaatt ctccccctgt gattgtcaac       180
     acggacaccc tagaagcccc aggatatgag ttgcaggtga acggaacaga gggggagatg       240
     gagtatgagg agatcacatt ggaaaggggt aactcaggtc tgggcttcag catcgcaggt       300
     ggcaccgaca acccacacat cggtgacgac ccatccatct ttatcaccaa gatcattcct       360
     ggtggggctg cagcccagga tggccgcctc agggtcaacg acagcatcct gtttgtcaat       420
     gaagtggatg tccgggaggt gacccattca gctgcagtgg aggccctcaa agaggcgggt       480
     tccatcgttc gcctctacgt catgcgccgg aaacccccag ctgagaagat catagagatc       540
     aagcttatca aagggcctaa aggacttggc ttcagcatcg cagggggcgt tgggaaccag       600
     cacatccctg gagataatag catctacgta accaagatca tcgaaggagg cgctgcccac       660
     aaggatggca ggttgcagat cggagacaag atcctggcgg tcaacagtgt ggggctagag       720
     gatgtcatgc atgaggacgc cgtggcagcc ctgaagaaca catatgacgt tgtgtaccta       780
     aaggtggcca agcccagcaa tgcctacctg agtgacagct atgctccccc agacatcaca       840
     acctcatatt ctcagcacct ggacaatgag atcagtcata gcagctactt gggcaccgac       900
     taccccacag ccatgacccc cacttcccct cggcgctact cccccgtggc caaggacctg       960
     ctaggggagg aagatattcc ccgggaacca aggcggatcg tgatccatcg gggctccacc      1020
     ggcctgggct tcaacattgt gggcggcgag gacggtgaag gcatcttcat ctccttcatc      1080
     cttgctgggg gtccagctga cctcagtggg gagctacgga agggggacca gatcctgtcg      1140
     gtcaatggtg ttgacctccg caatgccagt catgaacagg ctgccattgc cctgaagaac      1200
     gcgggtcaga cggtcacgat catcgctcag tataaaccag aagagtatag ccgattcgag      1260
     gccaagatcc atgatcttcg ggaacagctt atgaatagta gcctgggctc agggactgca      1320
     tctctgcgaa gcaaccccaa gcggggcttc tatatcaggg ccctgtttga ctacgacaag      1380
     accaaggact gcggtttctt gagccaggcc ctgagcttcc actttgggga tgtgcttcat      1440
     gtaattgacg ccagcgacga agagtggtgg caagcgcggc gggtccactc tgacagtgag      1500
     accgatgaca ttggcttcat tcccagcaaa cggcgggtcg agcgacgaga gtggtcaagg      1560
     ttaaaggcca aggactgggg ctccagctct ggatcacagg gtcgagaaga ctcggttctg      1620
     agctatgaga cggtgacgca gatggaagtg cactacgctc gccccatcat catccttggg      1680
     cctaccaaag accgtgccaa cgatgatctt ctctccgagt tccccgacaa gtttggatcc      1740
     tgtgtccctc atacgacacg tcctaagcgg gaatatgaga tagacggccg cgattaccac      1800
     tttgtctcct cccgggagaa aatggagaag gacattcagg cgcacaagtt cattgaggct      1860
     ggccagtaca acagccacct ctacgggacc agcgtccagt ctgtgcgaga ggtagcagag      1920
     caggggaagc actgcatcct tgatgtctca gccaatgccg tgcggcggct gcaggcggcc      1980
     cacctgcacc ctatcgccat cttcatccgt ccccgctccc tggagaatgt gctagagatc      2040
     aataagcgga tcacagagga gcaagcccgg aaagccttcg acagggccac gaagctggag      2100
     caggagttca cggagtgctt ctcagccatc gtagagggcg acagctttga agagatctat      2160
     cacaaagtga aacgtgtcat cgaagacctc tcaggcccct acatctgggt cccagcccga      2220
     gagagactct gattcctgcc ctggcttggc ctggactcac cctgcctcca ccacctgggc      2280
     ccttggtctg gactgaatag cccaataacc ctacccctag ccccccaact aattacct        2338
//


spacer
spacer