spacer

EBI Dbfetch

ID   D49730; SV 1; linear; mRNA; STD; MUS; 2684 BP.
XX
AC   D49730;
XX
DT   10-NOV-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus mRNA for V1a agrinine vasopression receptor, complete cds.
XX
KW   blood coagulation regulatory factor; calcium binding; thrombin binding;
KW   thrombomodulin binding; V1a arginine vasopressin receptor; zymogen.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2684
RA   Onodera Y.;
RT   ;
RL   Submitted (15-MAR-1995) to the INSDC.
RL   Yoshikuni Onodera, Daiichi Pharmaceutical Co., Ltd., Molecular Biology Res.
RL   Lab.; 1-16-13 Kitakasai, Edogawa-ku, Tokyo 134, Japan (Tel:03-3680-0151,
RL   Fax:03-5696-8336)
XX
RN   [2]
RP   1-2684
RA   Onodera Y., Maekawa K., Arai Y.;
RT   "Molecular cloning of a mouse V1a arginine vasopression receptor";
RL   Unpublished.
XX
DR   MD5; b82a7750f791417c6ae24e6f382ac7d4.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2684
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="pcDNA I cDNA library"
FT                   /clone="clone 1,000,000"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             313..1584
FT                   /codon_start=1
FT                   /product="V1a arginine vasopressin receptor"
FT                   /db_xref="GOA:Q62463"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62463"
FT                   /protein_id="BAA08567.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSRRGDV
FT                   RNEELAKLEFTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
FT   polyA_site      2684
XX
SQ   Sequence 2684 BP; 656 A; 641 C; 715 G; 672 T; 0 other;
     ggcacgagac ttggaggggt tgggtgtagg ggacagtctc cagccactaa gatgagaagg        60
     agcgcatcct gaggcagcct aagactgctt tgggagcagg gagagtccgc tcccttgcct       120
     cggacaagcc ggagcaggga cacgcaagaa catcccatcc aaaaccactc tgagcgcgcg       180
     tgggattgcg caggaagaga gcgaggtaag gaaggacggt gcgcagaact taggacgcgg       240
     gtcttcgggt cctccgtgga gaagaggaag cagcccacga ggaacagggt tccccggctc       300
     tgtgccgaca gcatgagttt cccgcgaggc tcccacgatc tgcccgcggg caactccagc       360
     ccgtggtggc ctctgaccac cgagggcgcc aacagcagcc gggaagcagc tgggctcggg       420
     gaaggcggca gccgccgggg ggacgtacgc aacgaggagc tggcgaagct ggagtttacc       480
     gtgctggcgg tgattttcgt ggtggccgtg ctgggtaata gcagtgtgct gctggcgctg       540
     catcgcacgc cacgcaagac atcccgcatg catctcttca tccgacacct cagcctggca       600
     gacctggcgg tcgccttctt ccaagtgtta ccacagctgt gctgggacat cacctaccgc       660
     ttccgcgggc cggactggct gtgccgggtg gtgaagcact tgcaggtgtt tgccatgttc       720
     gcatcttcct acatgctggt ggtgatgacg gctgaccgct acatcgccgt gtgccacccg       780
     ctcaagaccc tgcagcagcc cgcgcgccgc tcgcgcctca tgatcgccgc ctcttggggg       840
     ctgagtttcg ttctgagcat accacagtac tttatcttct ctgtgatcga atttgaggtg       900
     aacaatggca ccaaagccca agattgctgg gctaccttca tcccgccctg gggtacccgt       960
     gcctacgtga cctggatgac cagcggggtc ttcgtggtac ccgtgatcat cttgggtacc      1020
     tgctatggct tcatctgtta ccacatctgg cgcaatgtcc gagggaagac agcatcgcga      1080
     cagagcaaag gcggcaaggg ctctggggaa gccgcgggtc ccttccacaa ggggcttctg      1140
     gtcacgcctt gtgtcagcag cgtgaagagc atttcccgtg ccaagatccg cacagtgaag      1200
     atgacctttg tgattgtaag cgcctacatc ctctgctgga cacctttctt catcgtccag      1260
     atgtggtcag tctgggatac caatttcgtt tggaccgatt ccgaaaaccc ttccaccacg      1320
     atcacggcgt tactggcttc cttgaacagc tgctgcaacc cgtggatcta catgtttttt      1380
     agtggtcatc tcctacaaga ttgtgtccag agcttcccat gctgccaaag catagcgcag      1440
     aaattcgcca aggatgactc ggatagcatg agccggagac agacatctta ttctaacaac      1500
     cgaagcccaa caaacagcac tgggacgtgg aaggattcac ctaaatcttc aaagtccatc      1560
     agatttatcc ctgtctccac ttgagccgca tatccacgca gccagactct tggacggggc      1620
     ttgtgtgtcc agctagagag cttaagagta aatatgttta tgtgacatag acataaatca      1680
     actcagtgta tacattgttt ctacaacttg gtgtatacat tgtttctaca attcagtgta      1740
     tacattgttt ctagctgtgt ttttcccatt gctgtgacca aaacctgaat tcttttgcat      1800
     agcatattaa tgaaaatgta ccacatggga aatgtatagg cctggttcgt aagcatactg      1860
     actttatatt ttgtggttga ttttttttta ttgtattttt atgtctaatg tgaggcttgg      1920
     attggtttaa gtcatgtgat aagcactgtt gtttctacac aaagtgaaac tggtccgtga      1980
     ttgaaaaccc agtgttgctg tcaatctgtg tgtgcataaa aatgtacaga caagaggtag      2040
     agaggagttg ggttgagggt gggaaggaag gtagcttggt acctggctgc ccttccttca      2100
     gagtcctgac actctattag cactgaaaat catgctcacc aacagacaga aggtttgaga      2160
     atgttttagg acaataattt gtatgggggg gggggtgcca cactttatag aggcataaga      2220
     gaaaagattt ctacagacat tctttgggat attttaaaca tccatggacc agcaccataa      2280
     ggtagtctgt gctacaccag atgttaacac ttagtaccta gtcggtgaat ccagattcag      2340
     agattctaag tctcctagat aactccagac ataagatact caaaacatgt tgatttaaat      2400
     cagtttattt atttcttcac atttcccatc cacacagcag ggccagaaca cagagggtga      2460
     agacatgtgg agaaacggga gacagacaga aagagagggg ggtctgagcc ttgtgtctgt      2520
     tccttcatga atgtatgatt ttcagaaaga tacttaaaaa tatttaaagc cttggtttct      2580
     tggctgtaca atgggcttgg taacactcac ctcacagggt tgttgtgaag attaaataat      2640
     gttaaatgtg tgaagagtta tttttaaaaa aaatgtaaag tgct                       2684
//


spacer
spacer