spacer

EBI Dbfetch

ID   D49729; SV 1; linear; mRNA; STD; MUS; 1855 BP.
XX
AC   D49729;
XX
DT   10-NOV-1995 (Rel. 45, Created)
DT   27-DEC-2006 (Rel. 90, Last updated, Version 4)
XX
DE   Mus musculus mRNA for V1a arginine vasopression receptor, complete cds.
XX
KW   blood coagulation regulatory factor; calcium binding; thrombin binding;
KW   thrombomodulin binding; V1a arginine vasopressin receptor; zymogen.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1855
RA   Onodera Y.;
RT   ;
RL   Submitted (15-MAR-1995) to the INSDC.
RL   Yoshikuni Onodera, Daiichi Pharmaceutical Co., Ltd., Molecular Biology Res.
RL   Lab.; 1-16-13 Kitakasai, Edogawa-ku, Tokyo 134, Japan (Tel:03-3680-0151,
RL   Fax:03-5696-8336)
XX
RN   [2]
RP   1-1855
RA   Onodera Y., Maekawa K., Arai Y.;
RT   "Molecular cloning of a mouse V1a arginine vasopression receptor";
RL   Unpublished.
XX
DR   MD5; f40bd8eb3d0ae14e948e7ce00c4179a4.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1855
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="pcDNA I cDNA library"
FT                   /clone="clone 1,000,000"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             289..1560
FT                   /codon_start=1
FT                   /product="V1a arginine vasopressin receptor"
FT                   /db_xref="GOA:Q62463"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /protein_id="BAA08566.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
XX
SQ   Sequence 1855 BP; 402 A; 517 C; 510 G; 426 T; 0 other;
     ctgcagcccc gagctcggat ccactagtaa cggccgccag tgtgctggaa ttcggcacga        60
     ggctttggga gcagggagag tccgctccct tgcctcggac aagccggagc agggacacgc       120
     aagaacatcc catccaaaac cactctgagc gcgcgtggga ttgcgcacga aagagagcga       180
     ggtaaggaag gacggtgcgc agaacttagg acgcgggtct tcgggtcctc cgtggagaag       240
     aggaagcagc ccacgaggaa cagggttccc cggctctgtg ccgacagcat gagtttcccg       300
     cgaggctccc acgatctgcc cgcgggcaac tccagcccgt ggtggcctct gaccaccgag       360
     ggcgccaaca gcagccggga agcagctggg ctcggggaag gcggcagccc gccgggggac       420
     gtacgcaacg aggagctggc gaagctggag gttaccgtgc tggcggtgat tttcgtggtg       480
     gccgtgctgg gtaatagcag tgtgctgctg gcgctgcatc gcacgccacg caagacatcc       540
     cgcatgcatc tcttcatccg acacctcagc ctggcagacc tggcggtcgc cttcttccaa       600
     gtgttaccac agctgtgctg ggacatcacc taccgcttcc gcgggccgga ctggctgtgc       660
     cgggtggtga agcacttgca ggtgtttgcc atgttcgcat cttcctacat gctggtggtg       720
     atgacggctg accgctacat cgccgtgtgc cacccgctca agaccctgca gcagcccgcg       780
     cgccgctcgc gcctcatgat cgccgcctct tgggggctga gtttcgttct gagcatacca       840
     cagtacttta tcttctctgt gatcgaattt gaggtgaaca atggcaccaa agcccaagat       900
     tgctgggcta ccttcatccc gccctggggt acccgtgcct acgtgacctg gatgaccagc       960
     ggggtcttcg tggtacccgt gatcatcttg ggtacctgct atggcttcat ctgttaccac      1020
     atctggcgca atgtccgagg gaagacagca tcgcgacaga gcaaaggcgg caagggctct      1080
     ggggaagccg cgggtccctt ccacaagggg cttctggtca cgccttgtgt cagcagcgtg      1140
     aagagcattt cccgtgccaa gatccgcaca gtgaagatga cctttgtgat tgtaagcgcc      1200
     tacatcctct gctggacacc tttcttcatc gtccagatgt ggtcagtctg ggataccaat      1260
     ttcgtttgga ccgattccga aaacccttcc accacgatca cggcgttact ggcttccttg      1320
     aacagctgct gcaacccgtg gatctacatg ttttttagtg gtcatctcct acaagattgt      1380
     gtccagagct tcccatgctg ccaaagcata gcgcagaaat tcgccaagga tgactcggat      1440
     agcatgagcc ggagacagac atcttactct aacaaccgaa gcccaacaaa cagcactggg      1500
     acgtggaagg attcacctaa atcttcaaag tccatcagat ttatccctgt ctccacttga      1560
     gccgcatatc cacgcagcca gactcttgga cggggcttgt gtgtccagct agagagctta      1620
     agagtaaata tgtttatgtg acatagacat aaatcaactc agtgtataca ttgtttctac      1680
     aacttgtgtg tatacattgt ttctacaatt cagtgtatac attgtttcta gctgtgtttt      1740
     tcccattgct gtgaccaaaa cctgaattct tttgcatagc atattaatga aaatgtacca      1800
     catgggaaat gtataggcct ggttcgtaag catactgact ttatattttg ttggt           1855
//


spacer
spacer