spacer

EBI Dbfetch

ID   D31839; SV 1; linear; mRNA; STD; HUM; 1096 BP.
XX
AC   D31839;
XX
DT   09-FEB-1995 (Rel. 42, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens alternatively spliced mRNA for NACP (precursor of non-A beta
DE   component of Alzheimer's disease amyloid), complete cds.
XX
KW   AD amyloid; alternative splicing; NACP; NACP112;
KW   precursor of non-A beta component of Alzheimer's disease amyloid.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1096
RA   Ueda K.;
RT   ;
RL   Submitted (15-JUN-1994) to the INSDC.
RL   Kenji Ueda, Tokyo Institute of Psychiatry, Department of Molecular Biology;
RL   2-1-8 Kamikitazawa, Setagaya-Ku, Tokyo 156, Japan (Tel:03-3304-5701,
RL   Fax:03-3329-8035)
XX
RN   [2]
RP   1-307,356-1096
RA   Ueda K.;
RT   "Human alternatively spliced mRNA for NACP (precursor of non-A beta
RT   component of Alzheimer's disease amyloid), complete cds.";
RL   Unpublished.
XX
RN   [3]
RP   308-355
RX   DOI; 10.1006/bbrc.1994.2816.
RX   PUBMED; 7802671.
RA   Ueda K., Saitoh T., Mori H.;
RT   "Tissue-dependent alternative splicing of mRNA for NACP, the precursor of
RT   non-A beta component of Alzheimer's disease amyloid";
RL   Biochem. Biophys. Res. Commun. 205(2):1366-1372(1994).
XX
DR   MD5; a00c7cb8699e879f804f73d4508ac32a.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1096
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS             14..352
FT                   /codon_start=1
FT                   /product="NACP112"
FT                   /note="alternative splicing: see also L08850"
FT                   /note="precursor of non-A beta component of Alzheimer's
FT                   disease amyloid"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000101358.13"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="BAA06625.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEG
FT                   YQDYEPEA"
XX
SQ   Sequence 1096 BP; 354 A; 180 C; 240 G; 322 T; 0 other;
     gaattcatta gccatggatg tattcatgaa aggactttca aaggccaagg agggagttgt        60
     ggctgctgct gagaaaacca aacagggtgt ggcagaagca gcaggaaaga caaaagaggg       120
     tgttctctat gtaggctcca aaaccaagga gggagtggtg catggtgtgg caacagtggc       180
     tgagaagacc aaagagcaag tgacaaatgt tggaggagca gtggtgacgg gtgtgacagc       240
     agtagcccag aagacagtgg agggagcagg gagcattgca gcagccactg gctttgtcaa       300
     aaaggaccag ttgggcaagg aagggtatca agactacgaa cctgaagcct aagaaatatc       360
     tttgctccca gtttcttgag atctgctgac agatgttcca tcctgtacaa gtgctcagtt       420
     ccaatgtgcc cagtcatgac atttctcaaa gtttttacag tgtatctcga agtcttccat       480
     cagcagtgat tgaagtatct gtacctgccc ccactcagca tttcggtgct tccctttcac       540
     tgaagtgaat acatggtagc agggtctttg tgtgctgtgg attttgtggc ttcaatctac       600
     gatgttaaaa caaattaaaa acacctaagt gactaccact tatttctaaa tcctcactat       660
     ttttttgttg ctgttgttca gaagttgtta gtgatttgct atcatatatt ataagatttt       720
     taggtgtctt ttaatgatac tgtctaagaa taatgacgta ttgtgaaatt tgttaatata       780
     tataatactt aaaaatatgt gagcatgaaa ctatgcacct ataaatacta aatatgaaat       840
     tttaccattt tgcgatgtgt tttattcact tgtgtttgta tataaatggt gagaattaaa       900
     ataaaacgtt atctcattgc aaaaatattt tatttttatc ccatctcact ttaataataa       960
     aaatcatgct tataagcaac atgaattaag aactgacaca aaggacaaaa atataaagtt      1020
     attaatagcc atttgaagaa ggaggaattt tagaagaggt agagaaaatg gaacattaac      1080
     cctacactcg gaattc                                                      1096
//


spacer
spacer