spacer

EBI Dbfetch

ID   D31667; SV 2; linear; genomic DNA; STD; MUS; 1651 BP.
XX
AC   D31667; D31666;
XX
DT   09-FEB-1995 (Rel. 42, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 10)
XX
DE   Mus musculus MORGC gene for opioid receptor homologue MOR-C, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1651
RA   Takeshima H.;
RT   ;
RL   Submitted (28-MAY-1994) to the INSDC.
RL   Hiroshi Takeshima, Tokyo Institute of Psychiatry, Department of
RL   Neurochemistry; 2-1-8 Kamikitazawa, Setagaya-ku, Tokyo 156, Japan
RL   (Tel:81-3-3304-5701(ex.312), Fax:81-3-3329-8035)
XX
RN   [2]
RX   DOI; 10.1006/bbrc.1994.2814.
RX   PUBMED; 7802669.
RA   Nishi M., Takeshima H., Mori M., Nakagawara K., Takeuchi T.;
RT   "Structure and chromosomal mapping of genes for the mouse kappa-opioid
RT   receptor and an opioid receptor homologue (MOR-C)";
RL   Biochem. Biophys. Res. Commun. 205(2):1353-1357(1994).
XX
DR   MD5; 58c7141e15e745db7633de1ac2190c29.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1651
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="H2-4"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="phage lambda fixII"
FT                   /db_xref="taxon:10090"
FT   CDS             join(187..410,587..942,1024..1547)
FT                   /codon_start=1
FT                   /gene="MORGC"
FT                   /product="opioid receptor homologue MOR-C"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="BAA06509.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   exon            187..410
FT                   /gene="MORGC"
FT                   /product="opioid receptor homologue MOR-C"
FT                   /number=1
FT                   /note="first protein coding sequence (P1)"
FT   gap             469..568
FT                   /estimated_length=unknown
FT   exon            587..942
FT                   /gene="MORGC"
FT                   /number=2
FT                   /note="second protein coding sequence (P2)"
FT   exon            1024..1547
FT                   /gene="MORGC"
FT                   /number=3
FT                   /note="third protein coding sequence (P3)"
XX
SQ   Sequence 1651 BP; 276 A; 434 C; 407 G; 434 T; 100 other;
     tgtgcccatg tgtatgcctt tgtctgtgtc catgtgtctg tgtgtggatg cccatcgagg        60
     tgttcatgtg cctgttagtg tagttgtgct gttctaaggc ctcagtggac tgtgtccagc       120
     actgtggtca cttctttctg tgtcctgttc caggaactgt actgagtggc tttgcagggt       180
     gacagcatgg agtccctctt tcctgcccca ttctgggagg tcttgtatgg cagccacttt       240
     caagggaacc tgtctctcct aaatgagacc gtaccccatc acctgctcct caatgctagc       300
     cacagtgcct tcctgcccct tggactcaag gtcaccatcg tggggctcta cttggctgtg       360
     tgcatcgggg ggctcctggg gaactgcctc gtcatgtatg tcatcctcag gtaggcgggt       420
     cccatcaatc tgtgaagggg gaacctgagg caggaggctg ttctggatnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnntc tccttgtcct ctacaggcac accaagatga       600
     agactgctac caacatttac atatttaatc tggcactggc tgataccctg gtcttgctga       660
     cactgccctt ccagggcaca gacatccttc tgggcttctg gccatttggg aatgcactgt       720
     gcaagacggt cattgctatc gactactaca acatgtttac cagcactttc actttgactg       780
     ccatgagtgt agaccgttat gtagctatct gccaccctat ccgtgccctt gatgttcgga       840
     catccagtaa agcccaggcc gttaatgtgg ccatatgggc cctggcttcg gtggttggtg       900
     ttcctgttgc catcatgggc tcagcacaag tggaggatga aggtcagtgg gcagtcctcc       960
     tccctgacca atcagttccc catggttctt gccggcccct ctgacctcat ttctctcctg      1020
     cagagatcga gtgcctggtg gagatccccg cccctcagga ctattggggc cctgtatttg      1080
     ccatctgcat cttccttttt tccttcatca tcccggttct gatcatctct gtctgctaca      1140
     gcctcatgat tcgacgactt cgtggtgtcc ggctgctttc aggctcccga gagaaggacc      1200
     ggaacctgcg acgcatcaca cggctggtac tggtagttgt ggctgtgttt gtgggctgct      1260
     ggacacctgt gcaggtcttt gtcctggttc aaggactggg tgttcagcca ggtagtgaga      1320
     ctgcagtagc cattctgcgc ttctgcacag ccctgggcta tgtcaacagt tgtctcaatc      1380
     ccattctcta tgctttcttg gatgagaact tcaaggcctg ctttagaaag ttctgctgtg      1440
     cttctgccct gcaccgggag atgcaggttt ctgatcgtgt gcgcagcatt gccaaggatg      1500
     taggccttgg ttgcaagacc tctgagacag taccacggcc ggcatgacta ggcgtggacc      1560
     tgcccatggt gcctgtcagt ccacagagcc catctacacc caacacggag ctcacacagg      1620
     tcactgctct ctaggttgac cctgaactga g                                     1651
//


spacer
spacer