Dbfetch

ID   D28526; SV 1; linear; mRNA; STD; MUS; 1659 BP.
XX
AC   D28526;
XX
DT   26-FEB-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus mRNA for TGF-beta type I receptor, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1659
RA   Tomoda T.;
RT   ;
RL   Submitted (26-JAN-1994) to the INSDC.
RL   Contact:Toshifumi Tomoda Institute of Medical Science, The University of
RL   Tokyo, Molecular and Developmental Biology; 4-6-1 Shirokanedai, Minato-ku,
RL   Tokyo 108, Japan
XX
RN   [2]
RP   1-1659
RX   DOI; 10.1006/bbrc.1994.1150.
RX   PUBMED; 8117261.
RA   Tomoda T., Kudoh T., Noma T., Nakazawa A., Muramatsu M., Arai K.;
RT   "Molecular cloning of a mouse counterpart for human TGF-beta type I
RT   receptor";
RL   Biochem. Biophys. Res. Commun. 198(3):1054-1062(1994).
XX
DR   MD5; 95c3722e4caa052e9ae5ceabaad7afb2.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027484; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065699; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0065245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065163; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064504; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1659
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1512
FT                   /codon_start=1
FT                   /product="TGF-beta type I receptor"
FT                   /db_xref="GOA:Q64729"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64729"
FT                   /protein_id="BAA05878.1"
FT                   /translation="MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCE
FT                   TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNK
FT                   IELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEED
FT                   PSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRG
FT                   KWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSD
FT                   YHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL
FT                   VKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRA
FT                   DIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRW
FT                   QSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM"
FT   sig_peptide     1..60
FT   mat_peptide     61..1509
FT                   /product="TGF-beta type I receptor"
XX
SQ   Sequence 1659 BP; 467 A; 350 C; 401 G; 441 T; 0 other;
     atggaggcgg cggccgctgc tccacgtcgt ccgcagctcc tcatcgtgtt ggtggcggcg        60
     gcgacgctgc tcccgggggc gaaggcatta cagtgtttct gccacctctg tacaaaggat       120
     aattttacct gtgagacaga tggtctttgc tttgtctcag tcactgagac cacagacaaa       180
     gttatacaca atagtatgtg tatagctgaa attgacctaa ttcctcgaga caggccattt       240
     gtatgtgcac catcttcaaa aacaggggca gttactacaa catattgctg caatcaggac       300
     cactgcaata aaatagaact cccaactaca ggaccttttt cagaaaagca gtcagctggc       360
     cttggtcctg tggagctggc agctgtcatt gctggtccag tctgcttcgt ctgcattgca       420
     cttatgctga tggtctatat ctgccataac cgcactgtca ttcaccaccg tgtgccaaat       480
     gaagaggatc catcactaga tcgccctttc atttcagagg gcaccacctt aaaagattta       540
     atttatgata tgacaacatc agggtctgga tcaggtttac cactgcttgt tcaaagaaca       600
     attgccagga ccattgtgtt acaagaaagc attggcaaag gtcggtttgg agaagtttgg       660
     cgaggcaaat ggcggggaga agaagttgct gtgaagatat tctcttctag agaagagcgt       720
     tcatggttcc gagaggcaga gatttatcag actgtaatgt tacgccatga aaatatcctg       780
     ggatttatag cagcagacaa caaagacaat gggacatgga cgcagctgtg gttggtgtca       840
     gattatcatg agcatggatc ccttttcgat tacttgaata gatacactgt tactgtggaa       900
     ggaatgatca agcttgctct gtccacagca agtggtcttg cccatcttca catggagatt       960
     gttggtaccc aaggaaaacc agctattgcc catagagatt tgaaatcaaa gaatatcttg      1020
     gtgaagaaaa atggaacctg ttgtattgca gacttgggac ttgctgtgag acatgattct      1080
     gccacagata caattgatat tgctccaaac cacagagtag gcactaaaag gtacatggcc      1140
     cctgaagttc tagatgattc cataaatatg aaacattttg aatccttcaa acgcgctgac      1200
     atctatgcaa tgggcttagt gttctgggaa attgctcgac gctgttctat tggtggaatc      1260
     catgaagact atcagttgcc ttattatgat cttgtacctt ctgatccatc ggttgaagaa      1320
     atgagaaaag tagtttgcga acagaagtta aggccaaata ttccaaacag atggcagagc      1380
     tgtgaggcct tgagagtgat ggctaaaatt atgagagaat gctggtatgc caatggagca      1440
     gcaaggctga cagctttgcg aattaaaaaa acattgtcac aactcagcca acaggaaggc      1500
     atcaaaatgt aactgaaaca ccgtgggaac tctgctctct tcatatctgc tcctgggtgt      1560
     ttaggaggct ggttgttcta cctcactgag agaacagagg gctctgcttc ctcttgcagc      1620
     agtggaatat ggtcaactga aagcttccca gggtttctc                             1659
//