Dbfetch

ID   D25540; SV 1; linear; mRNA; STD; MUS; 2860 BP.
XX
AC   D25540;
XX
DT   06-MAY-1994 (Rel. 39, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus mRNA for TGF-beta type I receptor, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2860
RA   Suzuki A.;
RT   ;
RL   Submitted (26-NOV-1993) to the INSDC.
RL   Contact:Atsushi Suzuki Faculty of Pharmaceutical Sciences, Hokkaido
RL   University, Department of Biofunctional Chemistry; Sapporo, Hokkaido 060,
RL   Japan
XX
RN   [2]
RA   Suzuki A., Shioda N., Maeda T., Tada M., Ueno N.;
RT   "A mouse TGF-beta type I receptor that requires type II receptor for ligand
RT   binding";
RL   Cell. Mol. Biol. Res. 198:1063-1069(1994).
XX
DR   MD5; f698f6c678731ec253528031b8958245.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027484; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065699; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0065245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065163; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064504; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2860
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   5'UTR           <1..5
FT   CDS             6..1505
FT                   /codon_start=1
FT                   /product="TGF-beta type I receptor"
FT                   /note="serine/threonine kinase receptor"
FT                   /note="transforming growth factor-beta type I receptor"
FT                   /db_xref="GOA:Q64729"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64729"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA05023.1"
FT                   /translation="MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCE
FT                   TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNK
FT                   IELPTTEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLD
FT                   RPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRG
FT                   EEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEH
FT                   GSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKN
FT                   GTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYA
FT                   MGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCE
FT                   ALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM"
FT   sig_peptide     6..62
FT   mat_peptide     63..1502
FT                   /product="TGF-beta type I receptor"
FT   3'UTR           1506..2860
XX
SQ   Sequence 2860 BP; 769 A; 562 C; 670 G; 859 T; 0 other;
     ggaccatgga ggcggcggcc gctgctccac gtcgtccgca gctcctcatc gtgttggtgg        60
     cggcggcgac gctgctcccg ggggcgaagg cattacagtg tttctgccac ctctgtacaa       120
     aggataattt tacctgtgag acagatggtc tttgctttgt ctcagtcact gagaccacag       180
     acaaagttat acacaatagt atgtgtatag ctgaaattga cctaattcct cgagacaggc       240
     catttgtatg tgcaccatct tcaaaaacag gggcagttac tacaacatat tgctgcaatc       300
     aggaccactg caataaaata gaactcccaa ctacagaaaa gcagtcagct ggccttggtc       360
     ctgtggagct ggcagctgtc attgctggtc cagtctgctt cgtctgcatt gcacttatgc       420
     tgatggtcta tatctgccat aaccgcactg tcattcacca ccgtgtgcca aatgaagagg       480
     atccatcact agatcgccct ttcatttcag agggcaccac cttaaaagat ttaatttatg       540
     atatgacaac atcagggtct ggatcaggtt taccactgct tgttcaaaga acaattgcca       600
     ggaccattgt gttacaagaa agcattggca aaggtcggtt tggagaagtt tggcgaggca       660
     aatggcgggg agaagaagtt gctgtgaaga tattctcttc tagagaagag cgttcatggt       720
     tccgagaggc agagatttat cagactgtaa tgttacgcca tgaaaatatc ctgggattta       780
     tagcagcaga caacaaagac aatgggacat ggacgcagct gtggttggtg tcagattatc       840
     atgagcatgg atcccttttc gattacttga atagatacac tgttactgtg gaaggaatga       900
     tcaagcttgc tctgtccaca gcaagtggtc ttgcccatct tcacatggag attgttggta       960
     cccaaggaaa accagctatt gcccatagag atttgaaatc aaagaatatc ttggtgaaga      1020
     aaaatggaac ctgttgtatt gcagacttgg gacttgctgt gagacatgat tctgccacag      1080
     atacaattga tattgctcca aaccacagag taggcactaa aaggtacatg gcccctgaag      1140
     ttctagatga ttccataaat atgaaacatt ttgaatcctt caaacgcgct gacatctatg      1200
     caatgggctt agtgttctgg gaaattgctc gacgctgttc tattggtgga atccatgaag      1260
     actatcagtt gccttattat gatcttgtac cttctgatcc atcggttgaa gaaatgagaa      1320
     aagtagtttg cgaacagaag ttaaggccaa atattccaaa cagatggcag agctgtgagg      1380
     ccttgagagt gatggctaaa attatgagag aatgctggta tgccaatgga gcagcaaggc      1440
     tgacagcttt gcgaattaaa aaaacattgt cacaactcag ccaacaggaa ggcatcaaaa      1500
     tgtaactgaa acaccgtggg aactctgctc tcttcatatc tgctcctggg tgtttaggag      1560
     gctggttgtt ctacctcact gagagaacag agggctctgc ttcctcttgc agcagtggaa      1620
     tatggtcaac tgaaagcttc ccagggtttc tctgggccca gaggcagccg tggggtcctt      1680
     tctgtgcact atggatactt cttccagaca gttacagaat gttgtgtagt ctacttttgt      1740
     ttttattaac aaagcttgtt tttaaagaca actgccagcc cttagggagc tgctgtgctg      1800
     ttgaccttct gtaagggtga aggagctggg gtgtggcact aaatgaagca cttctgattt      1860
     tcactcctag tagtacattc tcagaggact ctgaaccact agtgtttcct tggttcactt      1920
     tgaatgtact gttctataat ttttcaagat cttaaactaa cactttaaac tctatagtct      1980
     aaaaaatatg acctcgtgga ggcgtggggg cacagttgct ccgttgtatt tgtgcacagc      2040
     tccttcacac tctgaacaca acacaccttc acagtagggt tgtgctacac cagtaagtgc      2100
     tacttttgca tctgtctaag tggaaacgaa cagaactact taaaggcggt gttaagtcct      2160
     gtatcatttt cattcaaaaa gtttattttt ctgagtaacc taaacctttt ctgggtttgt      2220
     ttttgttttt tgagggtttt tgtgatagat gtcattcagt cttcatgcct ttctcctacc      2280
     cagatgtgct tgaaccactg aggcaaggct gtagcattga taagcagtga ctgccatgcg      2340
     ggaacacccc acaggagcac tggagctctg cagttgagac gtttagcctg agtttatttt      2400
     aagaagtgaa gtggcactcc aaacatgtac agtgctttat ggatgtaatc attatggtat      2460
     acagactcct tttgaaaggg gaggcttgtc tattgccgaa gaaaagttgt atgctgttct      2520
     gtaagccatt tctttttctt tatttgatca aagcagtgtt ttgttttgtt ttgatttttc      2580
     ttttttggaa aggaattgca tttaaaattc aaatgtggtt aatgttaaat aataggcctt      2640
     tttctaggaa ggcagatata gttaatatga atgtacaagt gtaggtgact ttcacatgtt      2700
     atgtagctgt aagtatttgt ggattctatc ttgggaaggg tagagttagt ggagttttga      2760
     ggtctcacta ccctttgagg aaggcagctt ttaattcagt ctttttatct catatgtgca      2820
     gatcttgcaa ctgcttgatt tacatggtag caatgaattc                            2860
//