spacer

EBI Dbfetch

ID   D21062; SV 1; linear; mRNA; STD; MUS; 2492 BP.
XX
AC   D21062;
XX
DT   20-FEB-1994 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus GPCR21 mRNA for G protein-coupled receptor, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2492
RA   Saeki Y.;
RT   ;
RL   Submitted (04-OCT-1993) to the INSDC.
RL   Yoshinaga Saeki, Osaka University Medical School, Department of Neurology;
RL   2-2 Yamadaoka, Suita, Osaka 565, Japan (E-mail:ssakoda, Tel:81-6-6879-3571,
RL   Fax:81-6-6879-3579)
XX
RN   [2]
RP   1-2492
RX   DOI; 10.1016/0014-5793(93)80828-I.
RX   PUBMED; 8262253.
RA   Saeki Y., Ueno S., Mizuno R., Nishimura T., Fujimura H., Nagai Y.,
RA   Yanagihara T.;
RT   "Molecular cloning of a novel putative G protein-coupled receptor (GPCR21)
RT   which is expressed predominantly in mouse central nervous system";
RL   FEBS Lett. 336(2):317-322(1993).
XX
DR   MD5; 860bc1ac1f1fc838ebbeb2533d432172.
DR   Ensembl-Gn; ENSMUSG00000049649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105911; mus_musculus.
DR   EuropePMC; PMC2649507; 19259266.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2492
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda gt10 (K. Kato's library)"
FT                   /tissue_type="brain"
FT                   /note="clones G[2, 3 and 21]"
FT                   /db_xref="taxon:10090"
FT   CDS             499..1491
FT                   /codon_start=1
FT                   /gene="GPCR21"
FT                   /product="G protein-coupled receptor"
FT                   /db_xref="GOA:P35413"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR000984"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:101908"
FT                   /protein_id="BAA04641.1"
FT                   /translation="MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDV
FT                   VLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIG
FT                   SPEMSLMLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVG
FT                   ALGLGLVPVLAWNCRDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCR
FT                   HAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYL
FT                   TLLPATYNSMINPVIYAFRNQDVQKVLWAICCCCSTSKIPFRSRSPSDV"
FT   polyA_site      2492
XX
SQ   Sequence 2492 BP; 496 A; 701 C; 656 G; 639 T; 0 other;
     gcaagaagct gcaccggctt tgcctggggg cggagcttga ggctggcagt gcccgtgaat        60
     cgtgaggggt ctgggagctt caggaaccaa gtcatcgtgt ctggtgggag ggagctgact       120
     gctcttcttc ttgacgtgtt tccctcccct attcatgagc ctattgaggg cacaccttga       180
     atcctgtgct tcccctattc acttatggta agctttgatt tacttctttg accacgtgtg       240
     gccaagaggt cttcaggact tagaggaatg gaggggaggg tgaagggaca cagaaaaggg       300
     accaccgaga aaaagggacc cctgtttaga ggcctggagg catcagagga caaaaaccac       360
     aggacatgaa ttgggggtgt ggggtgtgca ggacatccgt accctacctg ttatcctgac       420
     aggtttcttt tctcgaaggg cctcctgtca ggatacgggc ctgccagcat ctcataggac       480
     ctttcttcta caggtaccat gatgtgggga gcaggaagct ctatggcctg gttctcagct       540
     ggctcaggca gtgtgaacgt gagcagcgtg gacccagtag aggaacccac aggcccagct       600
     acactgctgc cctctcccag ggcctgggat gtggtgctgt gcatctcagg caccctggtg       660
     tcctgcgaga acgcgctggt ggtggccatc attgtgggca ctcctgcctt ccgcgccccc       720
     atgttcctgc tggtgggtag cttggccgta gcagacctgc tggcaggcct gggcctggtc       780
     ctgcactttg cggctgactt ctgcattggc tcaccagaga tgagcttgat gctggtcggc       840
     gtgctagcaa tggccttcac tgccagcatc ggcagcctgc tggccattac cgttgaccgc       900
     tacctttccc tgtacaatgc tctcacttac tactcagaga caacggtaac tcggacttat       960
     gtgatgctgg ccttggtgtg ggtgggtgcc ctgggcctgg ggctggttcc cgtgctggcc      1020
     tggaactgcc gggatggcct gaccacgtgt ggtgtggtct atccactctc caagaaccat      1080
     ctggtggttc tggccatcgc cttcttcatg gtgtttggca tcatgttgca gctctatgcc      1140
     cagatctgcc gcatcgtctg ccgccatgcc cagcagatcg ccctccaacg acacctgctg      1200
     cctgcctctc actacgtggc cacccgcaag ggcatcgcca cattggctgt ggtgcttggc      1260
     gcctttgctg cctgttggtt gcccttcact gtctactgcc tcctgggaga tgccgactct      1320
     ccccgtctct acacctatct taccctgctc ccagccacct acaactccat gatcaaccct      1380
     gtcatctacg cctttcgcaa ccaagatgtg cagaaggtgc tgtgggccat ctgctgctgc      1440
     tgttccactt ccaagattcc attccggtcc cggtccccta gtgatgtcta gtttcatcct      1500
     ggtgaacctg tggctttgac tactatagaa ctccagagtg ttaggtccac cagggcttaa      1560
     ttccaatccc cagctccacg cccttaagac ccagctggtt ctggagttct aggacgttgg      1620
     gtgttttagg atcttattca agattcctgc gggggcccac cccagctgac cgcgtggctc      1680
     tagaatgttc cagatggtca gggtcccact cggaaatgtc tcacagccca agtggtttgc      1740
     agttccagaa ggctgggaat tttacagtac cattccaagt ccttgatctt ccttcccaga      1800
     aacttgacct tgatcatgtc gcttttgaat ttcgaagctc cagagtcaga ggttaatcac      1860
     ttagttccct agatgagaga aagatttatc tctatatatg tggacataca gagaaggttt      1920
     atttatttat ttattattta tttatttata aatttgctta tgggtggtaa gggggaaaaa      1980
     aagagaccta cacctagaaa tctagctcat accagggtat cctcagcctc catgacccca      2040
     tttctgacct cagtttccga agggggcggg atggaaaaag agaaaccacg tattttgtta      2100
     tttttgctta ttttttatca gagaaatcat agaaaccaga gcctcctccc caggcccgca      2160
     ctgctcgggt ttgcagggag aacacaccag cctctggttt tttatttttt taagaagcca      2220
     tcacctgagc aaccgagaat tcctctgcgc tgaggcccgg cttccctctg gtggccattt      2280
     gggggaattg caacccggca aggcagtcgg gattgtaaaa tgcaccccca tctctcactc      2340
     cagcctggct ttcagcgcca cagccatggc ctgggggcca ggccttaccc tgaggtgccc      2400
     gagaggaggc gggacaagag ccagtacccc cacccctctg ccaatcgggt tatggccccc      2460
     agtgcattcc tgttcagtcc ccaaccctac tc                                    2492
//


spacer
spacer