spacer

EBI Dbfetch

ID   D16338; SV 1; linear; mRNA; STD; MUS; 1312 BP.
XX
AC   D16338;
XX
DT   25-DEC-1993 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for prostaglandin E receptor EP1 subtype, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1312
RA   Sugimoto Y.;
RT   ;
RL   Submitted (01-JUN-1993) to the INSDC.
RL   Yukihiko Sugimoto, Kyoto University, Faculty of Pharmaceutical Sciences,
RL   Physiological Chemistry; Shimoadachi-cho, Yoshida, Sakyo-ku, Kyoto, Kyoto
RL   606, Japan (Tel:81-75-753-4537, Fax:81-75-753-4557)
XX
RN   [2]
RP   1-1312
RX   PUBMED; 7690750.
RA   Watabe A., Sugimoto Y., Honda A., Irie A., Namba T., Negishi M., Ito S.,
RA   Narumiya S., Ichikawa A.;
RT   "Cloning and expression of cDNA for a mouse EP1 subtype of prostaglandin E
RT   receptor";
RL   J Biol Chem 268(27):20175-20178(1993).
XX
DR   MD5; 8b7caa4860f5c8d3366b152abcbd1b95.
DR   Ensembl-Gn; ENSMUSG00000019464; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019608; mus_musculus.
DR   EuropePMC; PMC1727454; 10075955.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1312
FT                   /organism="Mus musculus"
FT                   /strain="ddY"
FT                   /mol_type="mRNA"
FT                   /clone_lib="ZAP II library"
FT                   /clone="MK643"
FT                   /db_xref="taxon:10090"
FT   CDS             72..1289
FT                   /codon_start=1
FT                   /product="prostaglandin E receptor EP1 subtype"
FT                   /db_xref="GOA:P35375"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000708"
FT                   /db_xref="InterPro:IPR001244"
FT                   /db_xref="InterPro:IPR008365"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97793"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35375"
FT                   /protein_id="BAA03842.1"
FT                   /translation="MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSM
FT                   TLGAVSNVLALALLAQVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAG
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVL
FT                   AAMALAVALLPLVHVGRYELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALV
FT                   CNTLSGLALLRARWRRRRSRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRS
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAV
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRH
FT                   SGFSHL"
XX
SQ   Sequence 1312 BP; 186 A; 427 C; 414 G; 285 T; 0 other;
     gcagcaggag ccaagttcca ggccatgggg accctgcatc ctgagcagca ctggccctct        60
     tggccactga tatgagcccc tgcgggctta acctgagcct agcggatgag gcagcaacgt       120
     gcgcaacacc caggctcccc aatacatctg tggtgctgcc aacaggcgat aatggcacat       180
     caccagcgct gcctatcttc tccatgacgc tgggtgctgt gtccaacgtg ctggcgctgg       240
     cgctgctggc ccaggttgca ggccgaatgc ggcggcgccg ctcggctgcc accttcctgt       300
     tgttcgtcgc cagcctgctt gccatcgacc tagcaggcca tgtgatcccg ggcgccctgg       360
     tgcttcgcct gtatactgcg gggcgtgcgc ctgctggagg ggcgtgtcat ttcctgggtg       420
     gctgcatggt cttcttcggc ctgtgcccac ttttgcttgg ctgtggcatg gccgtagagc       480
     gctgtgtggg tgtcacgcag ccactgatcc acgcggcgcg cgtatctgtg gcccgcgcac       540
     gcctggcact agccgtgctg gctgccatgg ctttggcagt ggcgctgctg ccactggtac       600
     acgtgggtcg ctacgagtta cagtaccctg gcacctggtg ttttattagc cttgggcctc       660
     gtggaggttg gcgccaggcg ttgcttgccg gcctcttcgc cggccttggc ctggccgcgc       720
     tccttgcggc attagtgtgc aatacgctca gcggcctggc gctcctccgt gcccgctgga       780
     gacggcgtcg ctctcgacga ttccgaaaga ccgcaggtcc cgatgatcgc cggcgctggg       840
     gatctcgtgg accccgcttg gcctccgcct cgtctgcctc atccatcact tcagccacag       900
     ccaccctccg cagctctcgg ggcggcggct ccgcgcgcag ggttcacgca cacgatgtgg       960
     aaatggtggg ccagctcgtg ggcatcatgg tggtgtcgtg catctgctgg agccccctgc      1020
     tggtgttggt ggtgttggcc atcgggggct ggaactctaa ctccctgcag cggccactct      1080
     ttctggctgt acgcctcgca tcgtggaacc agatcctgga cccatgggtg tacatcctgc      1140
     tgcgccaggc catgctgcgc caactgcttc gcctcctacc cctgagggtc agtgccaagg      1200
     gtggtccaac ggagctgggc ctaaccaaga gtgcctggga agccagttca ctgcgtagtt      1260
     cccggcacag tggtttcagt cacctctgaa tgtgcccaga agctaagtca aa              1312
//


spacer
spacer