spacer

EBI Dbfetch

ID   D14077; SV 1; linear; mRNA; STD; MUS; 1663 BP.
XX
AC   D14077;
XX
DT   22-JAN-1993 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus MSGP-2 mRNA for sulfated glycoprotein-2, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1663
RA   You K.-H.;
RT   ;
RL   Submitted (18-JAN-1993) to the INSDC.
RL   Kwan-Hee You, College of Natural Sciences Chungnam National University,
RL   Department of Biology; Daejon 305-764, Korea (Tel:82-42-821-5498,
RL   Fax:82-42-822-9690)
XX
RN   [2]
RP   1-1663
RA   Lee K., Ji Y., Lim H.M., Lee S., You K.;
RT   "Molecular cloning and sequencing of sulfated glycoprotein-2 cDNA from
RT   testis of mouse: implications of two different mRNAs of SGP-2";
RL   Cell. Mol. Biol. Res. 194:1175-1180(1993).
XX
DR   MD5; fe373c4ab478d7659a7e9959c682f1e8.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1663
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="Sertoli's cell"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             92..1438
FT                   /codon_start=1
FT                   /gene="MSGP-2"
FT                   /product="sulfated glycoprotein-2"
FT                   /note="secretory protein"
FT                   /db_xref="GOA:Q06890"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06890"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA03162.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQY
FT                   KELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
FT   sig_peptide     92..154
FT   polyA_signal    1644..1650
XX
SQ   Sequence 1663 BP; 413 A; 480 C; 436 G; 334 T; 0 other;
     gagctcattg tcagagacct cccgcgtcac caggaggagc gcactggagc caagccgcag        60
     accggactcc agattccaag gaggccacgc catgaagatt ctcctgctgt gcgtggcact       120
     gctgctgatc tgggacaatg gcatggtcct gggagagcag gaggtctctg acaatgagct       180
     ccaagaactg tccactcaag ggagtaggta tattaataag gagattcaga acgccgtcca       240
     gggagtgaag cacataaaaa ctctcataga aaaaaccaac gcagagcgca agtccttgct       300
     caacagttta gaggaagcca agaagaagaa agaggatgct ctggaggaca ctagggattc       360
     tgaaatgaag ctgaaggcat tcccggaagt gtgtaacgag accatgatgg ccctctggga       420
     ggagtgcaag ccctgcctga agcatacctg catgaagttc tatgcacgtg tctgcaggag       480
     cggctcaggg ctggtcggcc agcagctaga ggagtttcta aaccagagct cacccttcta       540
     cttctggatg aacggcgacc gcatcgactc cctgctggag agtgaccggc agcagagcca       600
     agtcctggat gccatgcagg acagctttgc tcgggcatct ggcatcatag acacgctctt       660
     tcaggaccgg ttcttcgccc gtgagcttca tgacccccac tacttctccc ccatcggctt       720
     cccacacaag aggcctcatt tcttatatcc caagtcccgc ttggtccgca gcctcatgtc       780
     tccctcccac tatgggcctc cgagcttcca caacatgttc cagcctttct ttgagatgat       840
     ccaccaggct caacaggcca tggatgtcca gctccacagc ccagccttcc agttcccaga       900
     cgtggatttc ttaagagaag gtgaagatga ccgcactgtg tgcaaggaga tccgccgcaa       960
     ctccacagga tgcctgaaga tgaagggcca gtgtgaaaag tgccaggaga tcttgtctgt      1020
     ggactgttca accaacaatc ctgcccaggc taacctgcgc caggagctga acgactcgct      1080
     ccaggtggcc gagaggctga cagagcagta caaggagctg ctgcagtcct tccagtcgaa      1140
     gatgctcaac acctcatccc tgctggagca gctgaacgac cagttcaact gggtgtccca      1200
     gctggctaac ctcacacagg gcgaagacaa gtactacctt cgggtctcca ccgtgaccac      1260
     ccattcctct gactcagagg tcccctcccg tgtcactgag gtggtggtga agctgtttga      1320
     ctctgacccc atcacagtgg tgttaccaga agaagtctct aaggataacc ctaagtttat      1380
     ggacacagtg gcggagaagg cgctacagga ataccgcagg aaaagccgtg cggaatgaga      1440
     tagaagcatc accttcctat atgtaggagt gtctgggagg gaatctccca gctccccgag      1500
     gtggctgcag acccctagag aactccacat gtctccaggc gagtaggcct cacccaagca      1560
     gcctgccctt cctctggatt ctgtacacta atgcctgcac ttgctgctct cgggaagaac      1620
     tgattccccc acgcaactaa tccaataaaa gccgccttgc gat                        1663
//


spacer
spacer