spacer

EBI Dbfetch

ID   D14042; SV 1; linear; mRNA; STD; MUS; 4224 BP.
XX
AC   D14042;
XX
DT   20-JAN-1993 (Rel. 34, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus tlk mRNA for tyrosine kinase, complete cds.
XX
KW   tyrosine kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4224
RA   Ogata M.;
RT   ;
RL   Submitted (12-JAN-1993) to the INSDC.
RL   Masato Ogata, Osaka Univ. Medical School, Division of Oncogenesis, Dept. of
RL   Oncology, Biomedical Res.Center; 2-2 Yamadaoka, Suita, Osaka 565, Japan
RL   (Tel:06-875-7476, Fax:06-875-7477)
XX
RN   [2]
RP   1-4224
RA   Ogata M., Sawada M., Fujiwara H., Hamaoka T.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 63bbfe915a4b94b2b0ae3fe5f3c9a550.
DR   Ensembl-Gn; ENSMUSG00000020395; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109237; mus_musculus.
DR   EuropePMC; PMC538991; 15618193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4224
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="mouse thymus cDNA"
FT                   /clone="TKT6-8"
FT                   /cell_type="thymocyte"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             46..1905
FT                   /codon_start=1
FT                   /gene="tlk"
FT                   /product="tyrosine kinase"
FT                   /note="putative"
FT                   /db_xref="GOA:Q03526"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001562"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:96621"
FT                   /db_xref="PDB:1AWJ"
FT                   /db_xref="PDB:1LUI"
FT                   /db_xref="PDB:1LUK"
FT                   /db_xref="PDB:1LUM"
FT                   /db_xref="PDB:1LUN"
FT                   /db_xref="PDB:2ETZ"
FT                   /db_xref="PDB:2EU0"
FT                   /db_xref="PDB:2K79"
FT                   /db_xref="PDB:2K7A"
FT                   /db_xref="PDB:2RN8"
FT                   /db_xref="PDB:2RNA"
FT                   /db_xref="PDB:3S9K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03526"
FT                   /protein_id="BAA03129.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   GKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDCESRQRWVL
FT                   TLKEETRNNNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPED
FT                   NRRSFQEPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAP
FT                   SSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKA
FT                   IISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSW
FT                   RQKAPVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSE
FT                   EDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETL
FT                   LGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGT
FT                   KFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRL
FT                   YKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL"
XX
SQ   Sequence 4224 BP; 1112 A; 1049 C; 1032 G; 1031 T; 0 other;
     actgcggggt gatgcccaag gcgcatcact tttcagaact ggaccatgaa caacttcatc        60
     ctcctggaag aacagctgat caagaagtcc caacagaaga gaaggacttc tccctcgaat       120
     tttaaagttc gtttctttgt cttaacgaaa gccagcctgg cctactttga ggaccgccac       180
     gggaagaagc gcacgttgaa gggctccatt gaactctcca gaatcaagtg tgtggagatt       240
     gtcaagagtg acattagcat cccgtgccac tataaatacc cttttcaggt cgtgcatgac       300
     aactatctcc tgtatgtgtt tgctccagac tgtgagagtc ggcagcgctg ggtgctgacc       360
     cttaaagaag aaacgaggaa taacaacagc ctggtatcca agtatcaccc taatttctgg       420
     atggatgggc ggtggaggtg ctgctcccag ctggagaagc ctgctgtagg ctgtgctccc       480
     tacgacccat ccaagaatgc ttcaaagaag cctcttcctc ctactcctga agacaacagg       540
     cggtcatttc aggaacctga agaaaccctg gtcattgcct tgtacgacta ccaaaccaac       600
     gaccctcagg agctcgcact gcggtgtgat gaagagtact acctgctgga cagctccgag       660
     atccactggt ggagggttca agacaaaaat gggcatgaag gatatgcacc aagcagttac       720
     ctggtagaaa aatctccaaa taaccttgaa acctatgagt ggtacaataa aagcatcagc       780
     cgcgacaaag ctgaaaaact tcttttggac acaggtaaag aaggagcttt catggtccga       840
     gattccagga cacccgggac atacacagtc tctgttttca ccaaggccat cataagtgag       900
     aacccctgta taaaacatta tcacatcaaa gaaacaaatg acagccccaa gcgctactac       960
     gtggctgaga agtatgtgtt tgactccatc cctctcctca tccagtatca ccagtacaat      1020
     ggaggaggtt tggtcactcg actccgctat ccagtttgct cctggagaca aaaagcccct      1080
     gtcacagcag ggctaagata tgggaagtgg gtgatccaac cctcagagct aacgttcgtg      1140
     caggagattg gcagcgggca gtttgggctg gtgcatctcg gctactggct caacaaggac      1200
     aaggtggcca tcaagaccat tcaggaaggg gcgatgtcag aagaagactt tatcgaggag      1260
     gcggaagtca tgatgaaact ctctcacccc aaactggtgc agctctatgg ggtgtgcctg      1320
     gagcaagccc ccatctgcct ggtgtttgag ttcatggagc acggctgcct gtcggattac      1380
     cttcgaagtc agcggggtct ctttgctgcg gagaccctgc tgggcatgtg cctggatgtg      1440
     tgtgagggca tggcctacct ggaaaaagct tgtgtcatcc acagagacct ggcagccaga      1500
     aactgtttgg tgggagaaaa ccaggtcatc aaggtgtccg actttgggat gacaagattt      1560
     gtccttgatg atcaatatac cagctccacg ggcaccaaat tcccagtgaa gtgggcatcc      1620
     ccagaggtgt tctcctttag tcgctatagc agcaagtcag atgtgtggtc gtttggtgta      1680
     ctgatgtggg aagtcttcag tgaaggcaaa atcccatacg aaaaccgaag caattccgag      1740
     gtcgtggaag atatcagcac tggctttcgg ttatacaagc cccgcctggc ctcctgtcat      1800
     gtctaccaga tcatgaatca ttgctggaaa gagaaaccag aagaccggcc acccttctcc      1860
     cagctgttaa gccagctggc tgaaatcgca gaagctgggc tttagcaggg actcattgac      1920
     cagacacagc cataaatcct gagtgaagga acaatgtcct ttttccagag cattaaaagc      1980
     tgccaccagt ccagaaaccc ccacaggtgc ctggaccatg gtgccagcac ctatgcagcc      2040
     acaactgcag catcatagaa aagggtggag ggccggccac tgagccaaca gctgaaccac      2100
     aactggagca gtatctgcgt gtccacccca tcccagcctc ttgtcgtatg ctgtactcaa      2160
     agctccattg tccactctcg ggagcatccc ctccccctct tagcaatcag gagaggcaga      2220
     cgtaggccac actcttcttt attattactt ttaagaataa ttcaagtaac ctttaatttg      2280
     gcccaacgag acattgtgcc cattttatgg atggaagagc gggaaagcat cattcttttt      2340
     ctaagaaatg caagaggtga ttaaaccagg gtgttctact acttcaaggc tgtcagccac      2400
     agcttcctgc ctcacatgag gcggagcgga tgcttgtgcc agaggccgga tgccataagg      2460
     tttcagagca cactgccacc tctctttgat ggggcacaga gagctccacc gggtggatag      2520
     ggcagggtga cacattcaga ccccacggca ggaccacagg atgtctgagg tcggtcagga      2580
     atgagagggc ctctgatggt ggaagtaaag agctgcaaaa gaagcctttg ggttgtccct      2640
     gacccagcgg ccctgtttca cggtgagtca tgtgtgtgac tggatctcct gttctgtgca      2700
     ggatgctgaa gcagttacta cagaacggtc atcattccag cctctcagga gcggcatcca      2760
     ctcagcactg tcatgatcct tgtgactttg agactttggg ttctttcaag cctttacggg      2820
     ttcagcagtc ttaaggttgc catgtaaggc tctcaagagc ccagcaaagg aagaaggcgt      2880
     ttgctcttgc ccaaactatc aggaaggaaa gaggcaagca ctgggcggtg cttccaaaat      2940
     gcacaggatg tctcctactg attggcactc gcacaggtga catgtgtata tcctgcacac      3000
     aggtcatccc tggcgaatca cagttcatac caacccaacc acgaggtatt attcatgtct      3060
     tacagaaagt ggacttggtc ttttaaaagc tggatagctg ccccagtgac agaactggga      3120
     aggacggaga ttgagatgac acccgaatat aactccagtg tagcctctta gctcttctca      3180
     atgctgcctc ctactgaggt tgggccgctg agcgcataac acaggaaagt ctgggttaat      3240
     gggcacccca ccccacagcc aagttgctcc tactcagagc actggggggc ccagtgggac      3300
     cctccaaatt gaaataggct gttctctttc ttcaccctca cctggatctg agttcacaac      3360
     cctggagcca ctcaaaatta accctttcat tctcccaacc taccagagtc acattgcctg      3420
     aggccattta tactagagct tcaaaggtgc tttcaactag tctcctgcag actgtttcct      3480
     gtaattatcc cttcaaccta gagctggctc tcttgtgaga aggaggattc cctggtgcca      3540
     ggcacactgg attttcctgc ggtgttcaga caaagcccct agaaaaatga tcagagtcac      3600
     agatccctct tcctaagtca cgtggcattt aggctggctt gaggctcaaa tgcatcactt      3660
     ccaactgtaa tcactgtgtc cagataaaac tctgtcattc agaaaatgaa cttcctcaac      3720
     tggtccacaa tcatctctgt ttattctctt ttgggaaacc ttaattaaga gacgatttct      3780
     gggacatcca atctggaaga taaacactgg aaccgagaga agtctgtggt gtggtttagg      3840
     agactggccc ccatacggtg gtattggctc tcttaacctc acatgcacga aggctttgat      3900
     ggacgcgtgt gcactgctta ctccagtgtc ctgcttggga agatgggatt ctcttctgct      3960
     ggtttctgtc ttacattttt tttgtaaatg gtgccctgtg ttcacagaaa ggttttggtt      4020
     tgaaatgtat tttgtaggcc ttgcaattca taatgtttgg aactatgtat ttatgcctag      4080
     atcaggagag tatttattgc ttgtcttcat gataaaaaat actgcaggta tgtcttaccc      4140
     tctgtggggg ccacaagtca atcattgctt atggaaaaaa atatatatat aaagctacat      4200
     gttttacaag taaaaaaaaa aaaa                                             4224
//


spacer
spacer