Dbfetch

ID   D12712; SV 1; linear; mRNA; STD; MUS; 3160 BP.
XX
AC   D12712;
XX
DT   23-APR-1993 (Rel. 35, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus mRNA for gelatinase, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3160
RA   Tanaka H.;
RT   ;
RL   Submitted (24-JUL-1992) to the INSDC.
RL   Hidekazu Tanaka, Shionogi Research Laboratories; 5-12-4, Sagisu,
RL   Fukushima-ku, Osaka, Osaka 553, Japan
RL   (E-mail:htanaka@fl.lab.shionogi.co.jp, Tel:81-6-6458-5861(ex.928),
RL   Fax:81-6-6458-0987)
XX
RN   [2]
RP   1-3160
RX   DOI; 10.1006/bbrc.1993.1110.
RX   PUBMED; 8382489.
RA   Tanaka H., Hojo K., Yoshida H., Yoshioka T., Sugita K.;
RT   "Molecular cloning and expression of the mouse 105-kDa gelatinase cDNA";
RL   Biochem. Biophys. Res. Commun. 190(3):732-740(1993).
XX
DR   MD5; 3adbe99d737ab433951c65b213796fb3.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
DR   EuropePMC; PMC115071; 11483772.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3160
FT                   /organism="Mus musculus"
FT                   /strain="DS"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11"
FT                   /cell_line="SN-H"
FT                   /cell_type="squamous cell carcinoma"
FT                   /tissue_type="dorsal skin"
FT                   /db_xref="taxon:10090"
FT   CDS             28..2220
FT                   /codon_start=1
FT                   /product="gelatinase"
FT                   /note="105-kDa"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="BAA02208.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP"
FT   regulatory      2419..2424
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      3134..3139
FT                   /regulatory_class="polyA_signal_sequence"
FT   regulatory      3142..3147
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3160 BP; 682 A; 938 C; 812 G; 728 T; 0 other;
     ctaagccaga agctgcggtc ctccaccatg agtccctggc agcccctgct cctggctctc        60
     ctggctttcg gctgcagctc tgctgcccct taccagcgcc agccgacttt tgtggtcttc       120
     cccaaagacc tgaaaacctc caacctcacg gacacccagc tggcagaggc atacttgtac       180
     cgctatggtt acacccgggc cgcccagatg atgggagaga agcagtctct acggccggct       240
     ttgctgatgc ttcagaagca gctctccctg ccccagactg gtgagctgga cagccagaca       300
     ctaaaggcca ttcgaacacc acgctgtggt gtcccagacg tgggtcgatt ccaaaccttc       360
     aaaggcctca agtgggacca tcataacatc acatactgga tccaaaacta ctctgaagac       420
     ttgccgcgag acatgatcga tgacgccttc gcgcgcgcct tcgcggtgtg gggcgaggtg       480
     gcacccctca ccttcacccg cgtgtacgga cccgaagcgg acattgtcat ccagtttggt       540
     gtcgcggagc acggagacgg gtatcccttc gacggcaagg acggccttct ggcacacgcc       600
     tttccccctg gcgccggcgt tcagggagat gcccatttcg acgacgacga gttgtggtcg       660
     ctgggcaaag gcgtcgtgat ccccacttac tatggaaact caaatggtgc cccatgtcac       720
     tttcccttca ccttcgaggg acgctcctat tcggcctgca ccacagacgg ccgcaacgac       780
     ggcacgcctt ggtgtagcac aacagctgac tacgataagg acggcaaatt tggtttctgc       840
     cctagtgaga gactctacac ggagcacggc aacggagaag gcaaaccctg tgtgttcccg       900
     ttcatctttg agggccgctc ctactctgcc tgcaccacta aaggccgctc ggatggttac       960
     cgctggtgcg ccaccacagc caactatgac caggataaac tgtatggctt ctgccctacc      1020
     cgagtggacg cgaccgtagt tgggggcaac tcggcaggag agctgtgcgt cttccccttc      1080
     gtcttcctgg gcaagcagta ctcttcctgt accagcgacg gccgcaggga tgggcgcctc      1140
     tggtgtgcga ccacatcgaa cttcgacact gacaagaagt ggggtttctg tccagaccaa      1200
     gggtacagcc tgttcctggt ggcagcgcac gagttcggcc atgcactggg cttagatcat      1260
     tccagcgtgc cggaagcgct catgtacccg ctgtatagct acctcgaggg cttccctctg      1320
     aataaagacg acatagacgg catccagtat ctgtatggtc gtggctctaa gcctgaccca      1380
     aggcctccag ccaccaccac aacagaacca cagccgacag cacctcccac tatgtgtccc      1440
     actatacctc ccacggccta tcccacagtg ggccccacgg ttggccctac aggcgccccc      1500
     tcacctggcc ccacaagcag cccgtcacct ggccctacag gcgccccctc acctggccct      1560
     acagcgcccc ctactgcggg ctcttctgag gcctctacag agtctttgag tccggcagac      1620
     aatccttgca atgtggatgt ttttgatgct attgctgaga tccagggcgc tctgcatttc      1680
     ttcaaggacg gttggtactg gaagttcctg aatcatagag gaagcccatt acagggcccc      1740
     ttccttactg cccgcacgtg gccagccctg cctgcaacgc tggactccgc ctttgaggat      1800
     ccgcagacca agagggtttt cttcttctct ggacgtcaaa tgtgggtgta cacaggcaag      1860
     accgtgctgg gccccaggag tctggataag ttgggtctag gcccagaggt aacccacgtc      1920
     agcgggcttc tcccgcgtcg tcccgggaag gctctgctgt tcagcaaggg gcgtgtctgg      1980
     agattcgact tgaagtctca gaaggtggat ccccagagcg tcattcgcgt ggataaggag      2040
     ttctctggtg tgccctggaa ctcacacgac atcttccagt accaagacaa agcctatttc      2100
     tgccatggca aattcttctg gcgtgtgagt ttccaaaatg aggtgaacaa ggtggaccat      2160
     gaggtgaacc aggtggacga cgtgggctac gtgacctacg acctcctgca gtgcccttga      2220
     actagggctc cttctttgct tcaaccgtgc agtgcaagtc tctagagacc accaccacca      2280
     ccaccacaca caaaccccat ccgagggaaa ggtgctagct ggccaggtac agactggtga      2340
     tctcttctag agactgggaa ggagtggagg caggcagggc tctctctgcc caccgtcctt      2400
     tcttgttgga ctgtttctaa taaacacgga tccccaacct tttccagcta ctttagtcaa      2460
     tcagcttatc tgtagttgca gatgcatccg agcaagaaga caactttgta gggtggattc      2520
     tgacctttta tttttgtgtg gcgtctgaga attgaatcag ctggcttttg tgacaggcac      2580
     ttcaccggct aaaccacctc tcccgactcc agccctttta tttattatgt atgaggttat      2640
     gttcacatgc atgtatttaa cccacagaat gcttactgtg tgtcgggcgc ggctccaacc      2700
     gctgcataaa tattaaggta ttcagttgcc cctactggaa ggtattatgt aactatttct      2760
     ctcttacatt ggagaacacc accgagctat ccactcatca aacatttatt gagagcatcc      2820
     ctagggagcc aggctctcta ctgggcgtta gggacagaaa tgttggttct tccttcaagg      2880
     attgctcaga gattctccgt gtcctgtaaa tctgctgaaa ccagacccca gactcctctc      2940
     tctcccgaga gtccaactca ctcactgtgg ttgctggcag ctgcagcatg cgtatacagc      3000
     atgtgtgcta gagaggtaga gggggtctgt gcgttatggt tcaggtcaga ctgtgtcctc      3060
     ccaggtgaga tgacccctca gctggaactg atccaggaag gataaccaag tgtcttcctg      3120
     gcagtctttt ttaaataaat gaataaatga atatttactt                            3160
//