spacer

EBI Dbfetch

ID   D10011; SV 1; linear; mRNA; STD; MUS; 3733 BP.
XX
AC   D10011; D01273;
XX
DT   10-MAR-1992 (Rel. 31, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for glutamate receptor channel subunit gamma 2, complete
DE   cds.
XX
KW   gamma 2 subunit; glutamate receptor channel; kainate receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3733
RA   Sakimura K.;
RT   ;
RL   Submitted (21-NOV-1991) to the INSDC.
RL   Kenji Sakimura, Niigata Univ. Brain Res.Inst., Dept. of Neuropharmacology;
RL   1-757 Asahimachidori, Niigata, Niigata 951, Japan
RL   (Tel:025-223-6161(ex.5174), Fax:025-225-6458)
XX
RN   [2]
RP   1-3733
RX   DOI; 10.1016/0896-6273(92)90293-M.
RX   PUBMED; 1310861.
RA   Sakimura K., Morita T., Kushiya E., Yamazaki M., Meguro H., Araki K.,
RA   Mishina M.;
RT   "Primary structure and expression of the gamma 2 subunit of the glutamate
RT   receptor channel selective for kainate";
RL   Neuron 8(2):267-274(1992).
XX
DR   MD5; dbc50dc7bcfa1d3875b74126c78f4c45.
DR   Ensembl-Gn; ENSMUSG00000003378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003468; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3733
FT                   /organism="Mus musculus"
FT                   /strain="ICR"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             310..3249
FT                   /codon_start=1
FT                   /gene="GluR gamma 2"
FT                   /product="glutamate receptor channel subunit gamma 2"
FT                   /db_xref="GOA:Q61626"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61626"
FT                   /protein_id="BAA00899.1"
FT                   /translation="MPAELLLLLIVAFANPSCQVLSSLRMAAILDDQTVCGRGERLALA
FT                   LAREQINGIIEVPAKARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASAS
FT                   TVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASL
FT                   ICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASI
FT                   SHLVLRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFV
FT                   RSLNMSWRENCEASTYPGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIW
FT                   PHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAM
FT                   NATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELL
FT                   RFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
FT                   TLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPH
FT                   PCLRARPHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSY
FT                   TANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQ
FT                   SKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMP
FT                   LGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFVVLI
FT                   CGLIIAVFVAVMEFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPS
FT                   RALLSLRAVREMRLSNGKLYSAGAGGDAGAHGGPQRLLDDPGPPGGPRPQAPTPCTHVR
FT                   VCQECRRIQALRASGAGAPPRGLGTPAEATSPPRPRPGPTGPRELTEHE"
XX
SQ   Sequence 3733 BP; 674 A; 1227 C; 1110 G; 722 T; 0 other;
     ccccttctct cctccatttt ctcctttccc cttcctcccc tcctggcccg ccctttgctt        60
     ttccacctgt ccttcctccc cgctgctggg gagacaccgt tttggattag ttgggggcca       120
     ccgccggcgg cgggggaggg ggcccagtgg actgccctct cccccggccc cagcctcacc       180
     agcacccagc atcggagcac ctcctggttg tcgttcctcg ggcctcgagg gagcccagcc       240
     ctccgtccca ccaggatccg tggcgagtgg gggccgcggc agctgcgtcc ccatgaggag       300
     gggaggaaga tgccggctga gctgctgctg ctgctgatag tcgccttcgc caatcccagc       360
     tgccaggtgc tgtcatcact gcgcatggct gcaatcctgg acgaccagac cgtgtgtggc       420
     cgtggtgagc gtctggccct ggccctggcc cgagagcaga tcaatgggat catcgaggtc       480
     ccagccaagg ccagagtgga agtagacatc tttgagctgc agcgggacag ccagtacgag       540
     accacggaca ccatgtgtca gatcctgccc aagggggttg tatctgtctt gggaccctcc       600
     tccagcccag cttctgcctc caccgtgagc catatctgtg gggagaagga gattccccac       660
     atcaaggtgg gtcctgagga gacgccccgc cttcagtacc ttcgcttcgc atctgtcagc       720
     ctgtacccca gtaatgaaga tgtcagcctg gcagtctccc gaatcctcaa gtcctttaac       780
     tacccctcag ctagcctcat ctgcgccaag gctgagtgcc tgctgcggct agaagaactg       840
     gtgcgaggct tcctcatctc caaggagaca ctgtccgtga ggatgcttga tgacagccgg       900
     gaccccacgc cgctactcaa ggagatccga gatgacaaag tgtccaccat catcattgat       960
     gccaatgcgt ccatctccca ccttgtcctc cgtaaggctt cggagctggg aatgacctca      1020
     gcgttttaca agtacatcct caccaccatg gactttccca tcctgcatct ggatggtatc      1080
     gtggaggact cctccaacat cctgggcttt tccatgttca acacctccca ccccttctac      1140
     ccagagtttg tgcgcagcct caacatgtcc tggagggaga actgtgaagc cagcacctat      1200
     cctggccctg cgctgtccgc agccctgatg tttgacgctg tgcacgtggt ggtaagcgct      1260
     gtccgagaac tgaaccgaag ccaggagatt ggcgtcaagc cactggcctg cacttcggcc      1320
     aacatttggc cccatgggac cagccttatg aactaccttc gaatggtaga gtatgacggg      1380
     ctgaccgggc gggttgagtt caacagcaaa gggcagagga ccaactacac actacgcatc      1440
     ctggagaagt cccgccaggg ccaccgtgag ataggggtgt ggtactctaa ccggaccctg      1500
     gccatgaatg ccaccaccct ggacatcaac ctgtcacaga ctctagccaa caagactctg      1560
     gtggtcacaa ctatcctgga gaacccgtat gttatgcgcc ggcccaactt ccaggccttg      1620
     tcagggaatg agcgcttcga gggcttctgc gtggacatgc tcagggagct ggccgagctg      1680
     ctgcgcttcc gataccgcct gcggttggta gaggacggac tctacggggc acctgagccc      1740
     aacggttcct ggacaggcat ggttggagaa ctcatcaacc ggaaggcaga cctggctgtg      1800
     gcagccttca ccatcaccgc cgagagggag aaggtcatcg acttctccaa gcccttcatg      1860
     accctgggga tcagcatcct ctacagggtg cacatgggcc gcaagcctgg ctacttctcc      1920
     ttcctggacc ccttctcccc tgccgtgtgg ctcttcatgc ttcttgccta cctggctgtc      1980
     agctgtgtct tgttcctggc tgccaggctg agcccttatg agtggtacaa cccacacccg      2040
     tgtctccggg cgcgtcccca tatcctggag aaccagtaca cgctgggcaa cagcctctgg      2100
     ttccccgtgg gtggcttcat gcagcagggc tcggaggtca tgccgcgggc actgtccaca      2160
     cgctgtgtca gcggagtctg gtgggccttc accttgatca tcatctcctc ctacacggcc      2220
     aacctggctg ccttcctcac ggtgcagcgc atggaggtgc cggtggagtc ggctgacgac      2280
     ctggcggatc agaccaacat tgagtacggc actatccacg ctggctccac catgaccttc      2340
     ttccagaact cgcggtacca gacgtaccag cggatgtgga actacatgca atcgaagcag      2400
     cccagcgtgt ttgtcaagag cacagaggag ggaatcgccc gcgtcctcaa ctcccgctat      2460
     gccttcctgc tggagtccac catgaacgag taccacaggc gcctcaattg caacctcacc      2520
     cagatcgggg gcctcctcga caccaagggc tacggcatcg gcatgccgct gggctcccct      2580
     ttccgggatg agatcacact ggccatcctg cagctccagg agaacaacag gctggagatc      2640
     ctgaagcgca agtggtggga gggcggccgg tgccccaagg aggaggacca cagggccaaa      2700
     ggtttgggca tggagaacat tggcggcatt tttgtcgtgc tgatctgtgg cctcatcatt      2760
     gctgtcttcg tggcggtcat ggagttcatc tggtccacgc ggaggtcagc ggagtccgag      2820
     gaggtgtcgg tgtgccagga gatgctgcag gagctacgcc acgccgtgtc ttgccgaaag      2880
     acctcgcgtt cccgccggcg ccggcgccct ggtggcccga gccgggccct gctgtcgctg      2940
     cgcgcagtcc gcgagatgcg actcagcaac ggcaagctct actcggccgg cgcgggcggg      3000
     gacgcgggcg cgcacggggg tccgcagcgc ctcctggacg accccggacc tcctggggga      3060
     ccccggcccc aggctcccac gccctgcacg cacgtgcgcg tctgccagga gtgcaggcgc      3120
     atccaggcgc tgcgagcttc gggggccggg gcgcccccac gtggcctggg caccccagcc      3180
     gaagccacca gcccgcctcg gccgcggcca ggccccaccg gaccccgcga gctgaccgag      3240
     cacgaatgac cgtggacggg gccgggcgtg cgccgactga ctgcagggac gcgatgcgcc      3300
     ccagacggac aggacgccgc gattttgcct tcaattcctg gtgaagtccg agcccggctc      3360
     cggagcaggc ctgcgcctcc tagtggactt gagcaagggt gtcgcggacg ccgcattcta      3420
     tccgcaccgt ggcggaggag cgcagagacc gaggactcta agggccgcgg actgtggggg      3480
     ctgctcccgg agttggaaag cggtccgcgg gaggacccca acctgggact gcccagatgc      3540
     cccaagactt gacacggctc tccacacttc tggaggtggg gagggctctg gacatgtggg      3600
     tgtaccctgt gcccctctct tctctttctc tcttttttgg ggggagaaac ctcagaaatt      3660
     tctatgagac gcccccaggg agagggtctc ttgggcccct atacctcccc ctgccacatc      3720
     ccagtcctgt tgg                                                         3733
//


spacer
spacer