Dbfetch

ID   D00472; SV 1; linear; mRNA; STD; MUS; 1134 BP.
XX
AC   D00472;
XX
DT   27-MAR-1991 (Rel. 27, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for cofilin, complete cds.
XX
KW   cofilin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1134
RX   DOI; 10.1093/nar/18.10.3053.
RX   PUBMED; 2349104.
RA   Moriyama K., Matsumoto S., Nishida E., Sakai H., Yahara I.;
RT   "Nucleotide sequence of mouse cofilin cDNA";
RL   Nucleic Acids Res. 18(10):3053-3053(1990).
XX
DR   MD5; 65e6682c3ea4bed1af44d9af39e21baf.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024678; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024651; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024678; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024446; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025125; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024418; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024545; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0024631; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025173; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023664; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023980; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000209469; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050596; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050525; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050269; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051022; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050204; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050301; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0050425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049996; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049563; mus_musculus_wsbeij.
DR   EuropePMC; PMC330843; 2349104.
XX
CC   Submitted in computer readable form by K. Moriyama on 12-Sep-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1134
FT                   /organism="Mus musculus"
FT                   /strain="Swiss-Webster"
FT                   /mol_type="mRNA"
FT                   /clone="CF109"
FT                   /tissue_type="brain"
FT                   /note="24 bp upstream of BamHI site."
FT                   /db_xref="taxon:10090"
FT   CDS             95..595
FT                   /codon_start=1
FT                   /product="cofilin"
FT                   /db_xref="GOA:P18760"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18760"
FT                   /protein_id="BAA00364.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
XX
SQ   Sequence 1134 BP; 271 A; 324 C; 282 G; 257 T; 0 other;
     gccgggagag gccgcgttca gtcggatccc ggcagcagct gcggcggctc aggtcttcag        60
     ttgctctttc tgtctccctt tcgtttccgg aaacatggcc tctggtgtgg ctgtctctga       120
     tggtgtcatc aaggtgttca atgacatgaa ggttcgcaag tcttcaacac cagaagaagt       180
     gaagaaacgc aagaaggcgg tgctcttttg cctgagtgag gacaagaaga acatcatcct       240
     ggaggagggc aaggagatcc tggtaggaga tgtggggcag actgtggacg acccctacac       300
     cacttttgtc aagatgctgc cagacaagga ctgccgctat gcactctatg atgcaaccta       360
     tgagaccaag gagagcaaga aggaggacct ggtgttcatc ttctgggccc ccgagaatgc       420
     acccctcaag agcaaaatga tctatgccag ctccaaggat gccatcaaga agaagctgac       480
     aggaatcaag catgaattac aagctaactg ctacgaggag gtcaaggacc gctgcaccct       540
     ggcagagaaa ctaggtggca gcgccgtcat ttccctggag ggcaagcctt tgtgagccac       600
     ctccagcccc ctgcctggag catcttaaca gccccagacc tgctcttggg tgttgcaggc       660
     tgcccctttc ctgccagacc ggaggggctg gggggatccc agcaggggga gggctatccc       720
     ttcaccccag ttgccaaaca tccctcccac cccctggacc gtccttctcc ctccatccct       780
     gacggttctg gccttcccaa actgcttttg atcttctgat tcctcttggg ttgacgcaga       840
     ccaagtcccg tcctaggcac ccagtttggg gggagcctgt attttttttt ttaacgacac       900
     ccctactccg tatccctccc catcccatgc tgccaacttc taaccacaat agtgactctg       960
     tgcttgtctg tttagttctg tgtgtaaatg aaatgtggaa atgaccctcc ctgccccagc      1020
     tggctgccct cccctttcct ttgatcttga ccactcatgg aagcaggacc agtaagggac      1080
     cttcaattta aaacaaaaca aaacaaaaaa acaataaaaa ggctaattaa caac            1134
//