spacer

EBI Dbfetch

ID   CT010402; SV 1; linear; mRNA; STD; MUS; 774 BP.
XX
AC   CT010402;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836H0353D for gene
DE   Sirt3, Sirtuin 3 (silent mating type information regulation 2, homolog) 3
DE   (S. cerevisiae); complete cds, incl. stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-774
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-774
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; cc4e9f0e013578d6ca60e92031109876.
DR   Ensembl-Gn; ENSMUSG00000025486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106048; mus_musculus.
XX
CC   RZPD; RZPDo836H0353D, ORFNo 30445
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836H0353D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence AK075861 (GI:26344725)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..774
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836H0353D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..774
FT                   /codon_start=1
FT                   /gene="Sirt3"
FT                   /db_xref="GOA:Q4FJK3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJK3"
FT                   /protein_id="CAJ18608.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
XX
SQ   Sequence 774 BP; 162 A; 209 C; 221 G; 182 T; 0 other;
     atggtggggg ccggcatcag cacacccagt ggcatcccgg acttcagatc cccagggagc        60
     ggcctctaca gcaaccttca gcagtatgac atcccgtacc ctgaagccat ctttgaactt       120
     ggctttttct ttcacaaccc caagcccttt ttcatgttgg ccaaggagct gtaccctggg       180
     cactacaggc ccaatgtcac tcactacttc ctgaggctcc tccacgacaa ggagctgctt       240
     ctgcggctct atacacagaa catcgacggg cttgagagag catctgggat ccctgcctca       300
     aagctggttg aagcccacgg gacctttgta acagctacat gcacggtctg tcgaaggtcc       360
     ttcccagggg aagacatatg ggctgatgtg atggcggaca gggtgccccg ctgccctgtc       420
     tgtactggcg ttgtgaaacc cgacattgtg ttctttgggg agcagctgcc tgcaaggttc       480
     ctactccata tggctgactt cgctttggca gatctgctac tcattcttgg gacctccctg       540
     gaggtggagc cttttgccag cttgtctgaa gcagtacaga aatcagtgcc ccgactgctc       600
     atcaatcgag acttggtggg gccgttcgtt ctgagtcctc gaaggaaaga tgtggtccag       660
     ctaggggatg tagttcatgg tgtggaaagg ctggtggacc tcctggggtg gacacaagaa       720
     ctgctggatc ttatgcagcg ggaacgtggc aagctggatg gacaggacag atag             774
//


spacer
spacer