Dbfetch

ID   CT010393; SV 1; linear; mRNA; STD; MUS; 1512 BP.
XX
AC   CT010393;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836F0653D for gene
DE   Tgfbr1, Transforming growth factor, beta receptor I; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1512
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1512
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; e4b4bef435ca0c536eba0d7045aa04a6.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028226; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027967; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028687; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028083; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027484; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0065644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065699; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0065588; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0065628; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065298; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0065617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0065245; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065163; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064504; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836F0653D, ORFNo 30489
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836F0653D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_009370 (GI:40254607)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1512
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836F0653D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1512
FT                   /codon_start=1
FT                   /gene="Tgfbr1"
FT                   /db_xref="GOA:Q4FJL1"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000472"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJL1"
FT                   /protein_id="CAJ18600.1"
FT                   /translation="MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCE
FT                   TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNK
FT                   IELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEED
FT                   PSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRG
FT                   KWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSD
FT                   YHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL
FT                   VKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRA
FT                   DIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRW
FT                   QSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM"
XX
SQ   Sequence 1512 BP; 437 A; 313 C; 364 G; 398 T; 0 other;
     atggaggcgg cggccgctgc tccacgtcgt ccgcagctcc tcatcgtgtt ggtggcggcg        60
     gcgacgctgc tcccgggggc gaaggcatta cagtgtttct gccacctctg tacaaaggat       120
     aattttacct gtgagacaga tggtctttgc tttgtctcag tcactgagac cacagacaaa       180
     gttatacaca atagtatgtg tatagctgaa attgacctaa ttcctcgaga caggccattt       240
     gtatgtgcac catcttcaaa aacaggggca gttactacaa catattgctg caatcaggac       300
     cactgcaata aaatagaact cccaactaca ggaccttttt cagaaaagca gtcagctggc       360
     cttggtcctg tggagctggc agctgtcatt gctggtccag tctgcttcgt ctgcattgca       420
     cttatgctga tggtctatat ctgccataac cgcactgtca ttcaccaccg tgtgccaaat       480
     gaagaggatc catcactaga tcgccctttc atttcagagg gcaccacctt aaaagattta       540
     atttatgata tgacaacatc agggtctgga tcaggtttac cactgcttgt tcaaagaaca       600
     attgccagga ccattgtgtt acaagaaagc attggcaaag gtcggtttgg agaagtttgg       660
     cgaggcaaat ggcggggaga agaagttgct gtgaagatat tctcttctag agaagagcgt       720
     tcatggttcc gagaggcaga gatttatcag actgtaatgt tacgccatga aaatatcctg       780
     ggatttatag cagcagacaa caaagacaat gggacatgga cgcagctgtg gttggtgtca       840
     gattatcatg agcatggatc ccttttcgat tacttgaata gatacactgt tactgtggaa       900
     ggaatgatca agcttgctct gtccacagca agtggtcttg cccatcttca catggagatt       960
     gttggtaccc aaggaaaacc agctattgcc catagagatt tgaaatcaaa gaatatcttg      1020
     gtgaagaaaa atggaacctg ttgtattgca gacttgggac ttgctgtgag acatgattct      1080
     gccacagata caattgatat tgctccaaac cacagagtag gcactaaaag gtacatggcc      1140
     cctgaagttc tagatgattc cataaatatg aaacattttg aatccttcaa acgcgctgac      1200
     atctatgcaa tgggcttagt gttctgggaa attgctcgac gctgttctat tggtggaatc      1260
     catgaagact atcagttgcc ttattatgat cttgtacctt ctgatccatc ggttgaagaa      1320
     atgagaaaag tagtttgcga acagaagtta aggccaaata ttccaaacag atggcagagc      1380
     tgtgaggcct tgagagtgat ggctaaaatt atgagagaat gctggtatgc caatggagca      1440
     gcaaggctga cagctttgcg aattaaaaaa acattgtcac aactcagcca acaggaaggc      1500
     atcaaaatgt ag                                                          1512
//