spacer

EBI Dbfetch

ID   CT010349; SV 1; linear; mRNA; STD; MUS; 3138 BP.
XX
AC   CT010349;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836H0652D for gene
DE   Pik3cd, Phosphatidylinositol 3-kinase catalytic delta polypeptide; complete
DE   cds, incl. stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3138
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-3138
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; bdbf048bcf73ba32f84b63aad2d83c76.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038859; mus_musculus.
XX
CC   RZPD; RZPDo836H0652D, ORFNo 30323
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836H0652D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence BC035203 (GI:23270986)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3138
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836H0652D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3138
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /db_xref="GOA:Q8CI98"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CI98"
FT                   /protein_id="CAJ18557.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEEQLQLREILER
FT                   RGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
FT                   LSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLG
FT                   RALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKA
FT                   LNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCSVEQCTFM
FT                   DSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMT
FT                   PYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDR
FT                   AIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRER
FT                   VPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPE
FT                   LSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
XX
SQ   Sequence 3138 BP; 692 A; 917 C; 904 G; 625 T; 0 other;
     atgccccctg gggtggactg ccccatggag ttctggacca aagaggagag ccagagcgtg        60
     gttgttgact tcttgctgcc cacaggggtc tacttgaact tccccgtgtc ccgcaatgcc       120
     aacctcagca ccatcaagca ggtgctgtgg caccgtgcac agtatgagcc actcttccac       180
     atgctcagtg accccgaggc ctatgtgttc acctgtgtga accagacggc ggagcagcag       240
     gagttggagg atgagcagcg gaggctgtgc gacatccagc ccttcctgcc cgtgctgcgc       300
     ctggtggccc gagaggggga ccgtgtgaag aagctcatta actctcagat cagcctcctc       360
     attggcaaag gtctccatga gtttgattcc ctgcgggacc cggaagtaaa cgacttccgc       420
     actaagatgc gccagttttg tgaagaggct gctgctcacc gccagcagct gggctgggtg       480
     gaatggctgc agtacagctt ccccctgcag ctggagccct cagcaagggg ttggcgggcc       540
     ggcttattgc gtgtcagcaa ccgagccctg ctggtcaacg tgaagttcga gggcagtgag       600
     gagagcttca ccttccaggt atccaccaag gacatgcccc tggcactgat ggcctgtgcc       660
     ctccgaaaaa aggccacagt gttccggcag cctctggtgg agcagcctga ggaatatgcc       720
     ctgcaggtga acgggaggca cgaatacctc tacggcaact acccgctctg ccactttcag       780
     tacatctgca gctgcctaca cagcgggctg acccctcatc tgaccatggt ccactcctcc       840
     tccatccttg ctatgcggga tgagcagagc aatcctgccc cccaagtaca gaaaccacgt       900
     gccaaacctc ccccgatccc tgccaagaag ccctcctctg tgtccctgtg gtccctggaa       960
     cagccattct ccattgagct gatcgagggc cgaaaagtga atgctgacga gcggatgaag      1020
     ctggttgttc aggccgggct cttccatggc aatgagatgc tgtgcaagac tgtgtcaagc      1080
     tcggaggtga atgtatgctc agagcccgtg tggaagcagc gactggagtt cgatatcagc      1140
     gtctgtgacc tcccgcgcat ggctcgactc tgttttgctc tctatgccgt cgtggagaag      1200
     gctaagaagg cacgctccac aaagaagaag tctaagaagg cggactgccc catcgcttgg      1260
     gccaacctca tgctattcga ctacaaagat cagctcaaga cgggggagcg ctgcctctac      1320
     atgtggccct ctgtcccaga tgagaaggga gagctgctga atcctgcggg tacagtgcgc      1380
     gggaacccca acacggagag tgccgctgcc ctggtcatct acctgcctga ggtggccccc      1440
     caccctgtgt acttccccgc tctggagaag atcctggagc tggggcgtca cggggagcgt      1500
     gggcgcatca cggaggagga gcagctgcag ctgcgggaga tcctggaacg gcggggatcc      1560
     ggggaactgt acgaacatga gaaggacctg gtgtggaaga tgcgccacga agtccaggag      1620
     catttcccag aggcgctggc ccgcctgctg ctggtcacca agtggaataa acatgaggat      1680
     gtggcccaga tgctctattt gctgtgctcc tggcccgagc tgcctgtgct gagcgccctg      1740
     gaacttctgg actttagctt tcccgactgc tacgtgggct ccttcgccat caagtccctt      1800
     cggaagctga cggacgatga gctcttccag taccttctgc agctggtgca agtgctcaaa      1860
     tatgagtcct acctggactg cgagctgacc aaattcttgc tgggccgagc cctggctaac      1920
     cgcaagatcg gacacttcct gttctggcac ctccgctctg agatgcacgt accatcagtg      1980
     gctctgcggt ttggtctcat catggaagcc tactgcagag gcagcaccca ccacatgaag      2040
     gtgctgatga agcaggggga agcactgagc aagcttaagg cactgaatga ctttgtgaag      2100
     gtgagttccc agaagaccac caagccccaa accaaggaga tgatgcatat gtgcatgcgc      2160
     caggagacct acatggaggc cctgtcccac ctgcagtctc cactcgaccc cagcaccctg      2220
     ctggaggaag tctgcagtgt ggagcagtgc accttcatgg actccaaaat gaagcccctg      2280
     tggatcatgt acagcagcga ggaggcgggc agtgctggca acgtgggcat catctttaag      2340
     aacggggatg acctccgcca ggacatgctg actctgcaga tgatccagct catggacgtc      2400
     ctatggaagc aggagggcct ggacctgagg atgacgccct acggctgcct ccccaccggg      2460
     gaccgcacag gtctcatcga ggtggtcctc cactcggaca ccatcgccaa catccagctg      2520
     aacaaaagca acatggcggc cacagctgcc ttcaacaagg acgccctgct caactggctc      2580
     aagtccaaga accctgggga ggccctggat cgggccattg aggaattcac cctctcctgt      2640
     gctggctact gtgtggccac atatgtcttg ggcatcggtg accggcacag cgacaacatc      2700
     atgatcagag agagtgggca gctcttccac attgattttg gccactttct ggggaacttc      2760
     aagaccaagt ttggaatcaa ccgagagcgc gtccccttca ttctcaccta cgactttgtc      2820
     cacgtgatcc agcaggggaa gactaacaac agtgagaagt ttgaaaggtt ccgaggctac      2880
     tgtgaacgag cctacaccat cctgcggcgc cacgggctgc ttttcctcca tctcttcgcc      2940
     ctgatgcggg ccgcaggtct gcctgagctt agttgctcca aagatatcca gtatctcaag      3000
     gactctctgg cactggggaa gacggaggaa gaggcgctaa agcacttccg ggtgaagttc      3060
     aacgaagctc tccgagaaag ctggaaaacc aaagtcaact ggctggcgca caatgtgtcc      3120
     aaggataacc gacagtag                                                    3138
//


spacer
spacer