Dbfetch

ID   CT010312; SV 1; linear; mRNA; STD; MUS; 1932 BP.
XX
AC   CT010312;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836C0652D for gene
DE   Slc27a4, Solute carrier family 27 (fatty acid transporter), member 4;
DE   complete cds, incl. stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1932
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1932
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; 8bf4a18fc06bcfb45d0cd16c5c86f5a1.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836C0652D, ORFNo 30311
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836C0652D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_011989 (GI:45597452)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1932
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836C0652D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1932
FT                   /codon_start=1
FT                   /gene="Slc27a4"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="CAJ18520.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
XX
SQ   Sequence 1932 BP; 399 A; 542 C; 554 G; 437 T; 0 other;
     atgctacttg gagcatctct ggtgggggcg ctactgttct ccaagctagt gctgaagctg        60
     ccctggaccc aggtgggatt ctccctgttg ctcctgtact tggggtctgg tggctggcgt       120
     ttcatccggg tcttcatcaa gacggtcagg agagatatct ttggtggcat ggtgctcctg       180
     aaggtgaaga ccaaggtgcg acggtacctt caggagcgga agacggtgcc cctgctgttt       240
     gcttcaatgg tacagcgcca cccggacaag acagccctga ttttcgaggg cacagacact       300
     cactggacct tccgccagct ggatgagtac tccagtagtg tggccaactt cctgcaggcc       360
     cggggcctgg cctcaggcaa tgtagttgcc ctctttatgg aaaaccgcaa tgagtttgtg       420
     ggtctgtggc taggcatggc caagctgggc gtggaggcgg ctctcatcaa caccaacctt       480
     aggcgggatg ccctgcgcca ctgtcttgac acctcaaagg cacgagctct catctttggc       540
     agtgagatgg cctcagctat ctgtgagatc catgctagcc tggagcccac actcagcctc       600
     ttctgctctg gatcctggga gcccagcaca gtgcccgtca gcacagagca tctggaccct       660
     cttctggaag atgccccgaa gcacctgccc agtcacccag acaagggttt tacagataag       720
     ctcttctaca tctacacatc gggcaccacg gggctaccca aagctgccat tgtggtgcac       780
     agcaggtatt atcgtatggc ttccctggtg tactatggat tccgcatgcg gcctgatgac       840
     attgtctatg actgcctccc cctctaccac tcagcaggaa acatcgtggg gattggccag       900
     tgcttactcc acggcatgac tgtggtgatc cggaagaagt tctcagcctc ccggttctgg       960
     gatgattgta tcaagtacaa ctgcacaatt gtacagtaca ttggcgagct ctgccgctac      1020
     ctcctgaacc agccaccccg tgaggctgag tctcggcaca aggtgcgcat ggcactgggc      1080
     aacggtctcc ggcagtccat ctggaccgac ttctccagcc gtttccacat cccccaggtg      1140
     gctgagttct atggggccac tgaatgcaac tgtagcctgg gcaactttga cagccgggtg      1200
     ggggcctgtg gcttcaatag ccgcatcctg tcctttgtgt accctatccg tttggtacgt      1260
     gtcaatgagg ataccatgga actgatccgg ggacccgatg gagtctgcat tccctgtcaa      1320
     ccaggtcagc caggccagct ggtgggtcgc atcatccagc aggaccctct gcgccgtttc      1380
     gacgggtacc tcaaccaggg tgccaacaac aagaagattg ctaatgatgt cttcaagaag      1440
     ggggaccaag cctacctcac tggtgacgtc ctggtgatgg atgagctggg ttacctgtac      1500
     ttccgagatc gcactgggga cacgttccgc tggaaagggg agaatgtatc taccactgag      1560
     gtggagggca cactcagccg cctgcttcat atggcagatg tggcagttta tggtgttgag      1620
     gtgccaggaa ctgaaggccg agcaggaatg gctgccgttg caagtcccat cagcaactgt      1680
     gacctggaga gctttgcaca gaccttgaaa aaggagctgc ctctgtatgc ccgccccatc      1740
     ttcctgcgct tcttgcctga gctgcacaag acagggacct tcaagttcca gaagacagag      1800
     ttgcggaagg agggctttga cccatctgtt gtgaaagacc cgctgttcta tctggatgct      1860
     cggaagggct gctacgttgc actggaccag gaggcctata cccgcatcca ggcaggcgag      1920
     gagaagctgt ag                                                          1932
//