Dbfetch

ID   CT010251; SV 1; linear; mRNA; STD; MUS; 951 BP.
XX
AC   CT010251;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836D1051D for gene
DE   Lgals8, Lectin, galactose binding, soluble 8; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-951
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-951
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; a96747799716a8cfc3a42d058d99088f.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020231; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020187; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020162; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020170; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019974; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CBAJ_G0019941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020058; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020043; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020079; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020645; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019275; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019572; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036309; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0036232; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0036203; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036235; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035999; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CBAJ_T0035910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0036055; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0036036; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036043; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036755; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035610; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035447; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836D1051D, ORFNo 30232
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836D1051D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_018886 (GI:31543121)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..951
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836D1051D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..951
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR030638"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="CAJ18459.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
XX
SQ   Sequence 951 BP; 278 A; 208 C; 234 G; 231 T; 0 other;
     atgttgtcct taaataacct acaaaatatc atctataacc cgataatccc ctatgttggc        60
     accattactg agcaattgaa gcctggctct ctgattgtaa tccgtgggca tgtccctaaa       120
     gattcagaaa gattccaggt tgactttcag ctgggcaaca gcctgaagcc aagagcagac       180
     gtggccttcc actttaaccc tcggttcaaa aggtctagct gcattgtttg taacacactg       240
     acacaggaga agtggggctg ggaggagatc acctacgaca tgcccttcag aaaagaaaag       300
     tcctttgaga tcgtgttcat ggtgctcaag aacaaattcc aggtggctgt gaacggaagg       360
     catgttctgc tgtacgccca caggatcagc ccggagcaga tcgacacagt gggcatctac       420
     ggcaaagtga acatccactc catcgggttc agattcagct cggatttaca gagtatggaa       480
     acatctgctc tgggactgac acagataaac agagagaata tacaaaagcc aggcaagctc       540
     cagctgagcc tgccatttga agcaaggttg aatgcctcca tgggtcctgg acgaaccgtt       600
     gtcattaaag gggaagtgaa caccaatgcc cgaagcttta atgttgacct agtggcagga       660
     aaaacaaggg atatcgctct gcacttgaac ccacgcctca atgtgaaagc atttgtaaga       720
     aattcctttc ttcaggatgc ctggggagaa gaggagagaa atattacctg cttcccattt       780
     agttctggga tgtactttga gatgataatc tactgtgatg tccgggaatt caaggttgct       840
     ataaatggtg tgcacagcct ggagtacaaa cacagattta aagacctaag cagtattgat       900
     acactatcag tcgatggtga tatccgtttg ctggatgtaa ggagctggta g                951
//