spacer

EBI Dbfetch

ID   CT010248; SV 1; linear; mRNA; STD; MUS; 1083 BP.
XX
AC   CT010248;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   21-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836D0751D for gene
DE   Ccrl2, Chemokine (C-C motif) receptor-like 2; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1083
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1083
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; ea7b252196c64b7a208d0d8f00aa547e.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
CC   RZPD; RZPDo836D0751D, ORFNo 30200
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836D0751D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence AB009384 (GI:3090450)
CC   we found AA exchange(s) at position (first base of changed triplet):
CC   1075(ile->lys)
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1083
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836D0751D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1083
FT                   /codon_start=1
FT                   /gene="Ccrl2"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="CAJ18456.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDKI"
XX
SQ   Sequence 1083 BP; 237 A; 294 C; 275 G; 277 T; 0 other;
     atggataact acacagtggc cccggacgat gaatatgatg tcctaatctt agacgactac        60
     ctggacaaca gtgggccgga ccaagttccg gcccccgagt tcctctcccc ccagcaggtg       120
     ctgcagttct gctgcgcggt gtttgcggtg ggtctcttgg acaacgtgct ggcggtgttt       180
     atcttggtga aatacaaagg actcaagaat ctggggaaca tctacttcct aaacctggca       240
     ctttcaaacc tgtgtttcct gcttcccctg ccgttctggg cccatactgc agcacacggg       300
     gaaagccctg gcaacgggac ctgtaaagtt cttgtcggac tccactcctc gggcttatac       360
     agcgaggtgt tttccaacat cctcctcctt gtgcaaggat acagggtgtt ttcccaaggg       420
     cgactggcct ccatcttcac gacagtgtct tgtggtattg ttgcgtgcat cctggcatgg       480
     gccatggcta ctgcgctctc tttgcccgag tctgtgtttt atgagcctcg gatggaaaga       540
     cagaaacaca agtgtgcctt tggcaaacct cacttcttgc caatcgaagc gccgctctgg       600
     aagtacgttc tgacgtcaaa aatgatcatc ttggtacttg cttttcctct gctggttttt       660
     ataatctgct gcaggcaact gaggagaagg cagagcttca gggagagaca gtacgacctc       720
     cacaagccgg ctcttgtcat aacgggcgtg ttccttttga tgtgggcgcc ttacaacact       780
     gtgcttttcc tgtctgcttt ccaggaacac ttgtccctgc aggatgagaa gagcagctac       840
     cacctggacg caagtgttca ggtcacacag ctggtagcga ccacccactg ctgcgtcaac       900
     ccgctgctct atttgcttct tgaccggaag gcctttatga gataccttcg cagcctgttc       960
     ccacggtgca atgatatccc ctatcaaagt agtggaggct atcagcaagc gcctccaagg      1020
     gaaggtcatg gcaggcccat tgaactgtac agcaatttgc atcaaaggca ggataaaata      1080
     tag                                                                    1083
//


spacer
spacer