Dbfetch

ID   CT010173; SV 1; linear; mRNA; STD; MUS; 972 BP.
XX
AC   CT010173;
XX
DT   21-JUL-2005 (Rel. 84, Created)
DT   21-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Mus musculus full open reading frame cDNA clone RZPDo836B0650D for gene
DE   Arg1, Arginase 1, liver; complete cds, incl. stopcodon.
XX
KW   Full ORF clone, Expression Shuttle System, Gateway(R), complete cds.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-972
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   "Cloning of mouse full open reading frames in Gateway(R) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-972
RA   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J.,
RA   Wiemann S., Schick M., Korn B.;
RT   ;
RL   Submitted (20-JUL-2005) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 515, D-69120 Heidelberg, Germany
XX
DR   MD5; 808b35fae2bbae115c37049e0d233489.
DR   Ensembl-Gn; ENSMUSG00000019987; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017096; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017073; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017036; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016856; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017494; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016435; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016935; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017012; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016960; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017530; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016217; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016498; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020161; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0024831; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024799; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024762; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024770; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025279; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024118; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024512; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024629; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024623; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025315; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0023836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024131; mus_musculus_wsbeij.
XX
CC   RZPD; RZPDo836B0650D, ORFNo 30052
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836B0650D
CC   Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
CC   RZPDLIB No. 836
CC   http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=836
CC   http://www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   http://www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is part of a collection of mouse full ORF clones
CC   jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence U51805 (GI:1293092)
CC   we found AA exchange(s) at position (first base of changed triplet):
CC   916(thr->ala)
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
FT                   /clone="RZPDo836B0650D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:10090"
FT   CDS             1..972
FT                   /codon_start=1
FT                   /gene="Arg1"
FT                   /db_xref="GOA:Q61176"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="MGI:MGI:88070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61176"
FT                   /protein_id="CAJ18381.1"
FT                   /translation="MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEY
FT                   DVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLA
FT                   VGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFS
FT                   WVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGR
FT                   KKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPT
FT                   LGKTAEEVKSTVNTAVALTLACFGAQREGNHKPGTDYLKPPK"
XX
SQ   Sequence 972 BP; 267 A; 226 C; 274 G; 205 T; 0 other;
     atgagctcca agccaaagtc cttagagatt atcggagcgc ctttctcaaa aggacagcct        60
     cgaggagggg tagagaaagg ccctgcagca ctgaggaaag ctggtctgct ggaaaaactt       120
     aaagaaacag agtatgacgt gagagaccac ggggacctgg cctttgttga tgtccctaat       180
     gacagctcct ttcaaattgt gaagaaccca cggtctgtgg ggaaagccaa tgaagagctg       240
     gctggtgtgg tggcagaggt ccagaagaat ggaagagtca gtgtggtgct gggtggagac       300
     cacagtctgg cagttggaag catctctggc cacgccaggg tccaccctga cctatgtgtc       360
     atttgggtgg atgctcacac tgacatcaac actcccctga caaccagctc tgggaatctg       420
     catgggcaac ctgtgtcctt tctcctgaag gaactgaaag gaaagttccc agatgtacca       480
     ggattctcct gggtgactcc ctgcatatct gccaaagaca tcgtgtacat tggcttgcga       540
     gacgtagacc ctggggaaca ctatataata aaaactctgg gaattaagta tttctccatg       600
     actgaagtag acaagctggg gattggcaag gtgatggaag agaccttcag ctacctgctg       660
     ggaaggaaga aaaggccgat tcacctgagc tttgatgtcg acgggctgga cccagcattc       720
     accccggcga ccggcacccc ggttctggga ggcctatctt acagagaagg tctctacatc       780
     acagaagaaa tttacaagac agggctcctt tcaggactag atatcatgga agtgaaccca       840
     actcttggga agacagcaga ggaggtgaag agtactgtga acacggcagt ggctttaacc       900
     ttggcttgct tcggagctca acgggagggt aaccataagc cagggactga ctaccttaaa       960
     ccacctaagt ag                                                           972
//