spacer

EBI Dbfetch

ID   CR457058; SV 1; linear; mRNA; STD; HUM; 423 BP.
XX
AC   CR457058;
XX
DT   03-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834A087D for gene
DE   SNCA, synuclein, alpha (non A4 component of amyloid precursor); complete
DE   cds, incl. stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-423
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-423
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   ;
RL   Submitted (03-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; e32c926a1ed1f0a0fa9bbfa3dac03fd6.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
CC   RZPD; RZPDo834A087D, ORFNo 1675
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A087D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC (ATG).
CC   The last base of the last coding triplett has been changed to T,
CC   which might lead to an amino acid change at the C terminus of the
CC   polypeptide.
CC   The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att.
CC   Compared to the reference sequence NM_000345 we did not find any
CC   amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..423
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834A087D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS             1..423
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000267908.13"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="CAG33339.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
XX
SQ   Sequence 423 BP; 136 A; 71 C; 141 G; 75 T; 0 other;
     atggatgtat tcatgaaagg actttcaaag gccaaggagg gagttgtggc tgctgctgag        60
     aaaaccaaac agggtgtggc agaagcagca ggaaagacaa aagagggtgt tctctatgta       120
     ggctccaaaa ccaaggaggg agtggtgcat ggtgtggcaa cagtggctga gaagaccaaa       180
     gagcaagtga caaatgttgg aggagcagtg gtgacgggtg tgacagcagt agcccagaag       240
     acagtggagg gagcagggag cattgcagca gccactggct ttgtcaaaaa ggaccagttg       300
     ggcaagaatg aagaaggagc cccacaggaa ggaattctgg aagatatgcc tgtggatcct       360
     gacaatgagg cttatgaaat gccttctgag gaagggtatc aagactacga acctgaagct       420
     taa                                                                     423
//


spacer
spacer