spacer

EBI Dbfetch

ID   CR456419; SV 1; linear; mRNA; STD; HUM; 1393 BP.
XX
AC   CR456419;
XX
DT   25-MAY-2004 (Rel. 79, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens CHKL full length open reading frame (ORF) cDNA clone (cDNA
DE   clone C22ORF:pGEM.CHKL.V2)
XX
KW   CDNA; chromosome 22; ORF.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1393
RX   DOI; 10.1186/gb-2004-5-10-r84.
RX   PUBMED; 15461802.
RA   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
RA   Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
RA   Beare D.M., Dunham I.;
RT   "A genome annotation-driven approach to cloning the human ORFeome";
RL   Genome Biol. 5(10):R84-R84(2004).
XX
RN   [2]
RP   1-1393
RA   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
RA   Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
RA   Beare D.M., Dunham I.;
RT   ;
RL   Submitted (23-MAR-2006) to the INSDC.
RL   Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries:
RL   c22g@sanger.ac.uk
XX
DR   MD5; 68eea304a3aaa67e4cd908b8b52824e5.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
CC   Sanger Institute name : pGEM.CHKL.V2
CC   Homo sapiens cDNA sequence. This sequence was generated as part of
CC   The Wellcome Trust Sanger Institute program to isolate cDNA clones
CC   representing the full length open reading frame of well annotated
CC   protein coding genes on human chromosome 22.  For more information
CC   see http://www.sanger.ac.uk/HGP/Chr22/ORFcloning
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1393
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /lab_host="Mach1"
FT                   /mol_type="mRNA"
FT                   /clone="pGEM.CHKL.V2"
FT                   /db_xref="taxon:9606"
FT   CDS             130..1317
FT                   /gene="CHKL"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000267353.13"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y259"
FT                   /protein_id="CAG30305.1"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
XX
SQ   Sequence 1393 BP; 304 A; 401 C; 422 G; 266 T; 0 other;
     gagagacccg agtatgaccc ggagaagccc aggccggccg gaagaggagc cgagcgcggc        60
     cggaaggaac cgagcccgtc cgaagggagc ggagcgcagc ctggcctggg gcccggtcga       120
     gcccgcgcca tggcggccga ggcgacagct gtggccggaa gcggggctgt tggcggctgc       180
     ctggccaaag acggcttgca gcagtctaag tgcccggaca ctaccccaaa acggcggcgc       240
     gcctcgtcgc tgtcgcgtga cgccgagcgc cgagcctacc aatggtgccg ggagtacttg       300
     ggcggggcct ggcgccgagt gcagcccgag gagctgaggg tttaccccgt gagcggaggc       360
     ctcagcaacc tgctcttccg ctgctcgctc ccggaccacc tgcccagcgt tggcgaggag       420
     ccccgggagg tgcttctgcg gctgtacgga gccatcttgc agggcgtgga ctccctggtg       480
     ctagaaagcg tgatgttcgc catacttgcg gagcggtcgc tggggcccca gctgtacgga       540
     gtcttcccag agggccggct ggaacagtac atcccaagtc ggccattgaa aactcaagag       600
     cttcgagagc cagtgttgtc agcagccatt gccacgaaga tggcgcaatt tcatggcatg       660
     gagatgcctt tcaccaagga gccccactgg ctgtttggga ccatggagcg gtacctaaaa       720
     cagatccagg acctgccccc aactggcctc cctgagatga acctgctgga gatgtacagc       780
     ctgaaggatg agatgggcaa cctcaggaag ttactagagt ctaccccatc gccagtcgtc       840
     ttctgccaca atgacatcca ggaagggaac atcttgctgc tctcagagcc agaaaatgct       900
     gacagcctca tgctggtgga cttcgagtac agcagttata actatagggg ctttgacatt       960
     gggaaccatt tttgtgagtg ggtttatgat tatactcacg aggaatggcc tttctacaaa      1020
     gcaaggccca cagactaccc cactcaagaa cagcagttgc attttattcg tcattacctg      1080
     gcagaggcaa agaaaggtga gaccctctcc caagaggagc agagaaaact ggaagaagat      1140
     ttgctggtag aagtcagtcg gtatgctctg gcatcccatt tcttctgggg tctgtggtcc      1200
     atcctccagg catccatgtc caccatagaa tttggttact tggactatgc ccagtctcgg      1260
     ttccagttct acttccagca gaaggggcag ctgaccagtg tccactcctc atcctgactc      1320
     caccctccca ctccttggat ttctcctgga gcctccaggg caggaccttg gagggaggaa      1380
     caacgagcag aag                                                         1393
//


spacer
spacer