Dbfetch

ID   CR407684; SV 1; linear; mRNA; STD; HUM; 1038 BP.
XX
AC   CR407684;
XX
DT   10-MAY-2004 (Rel. 79, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834D053D for gene
DE   ANXA1, annexin A1 complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1038
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1038
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; a84674ad149a6eee7d1cf5863ed76390.
DR   Ensembl-Gn; ENSG00000135046; homo_sapiens.
DR   Ensembl-Tr; ENST00000257497; homo_sapiens.
DR   Ensembl-Tr; ENST00000376911; homo_sapiens.
XX
CC   RZPD; RZPDo834D053D, ORFNo 620
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D053D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Ina Rolfs
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 101
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   contact RZPD (customer.service@rzpd.de) for further information.
CC   
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon (ATG):
CC   att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG)
CC   After the last codon additional sequence has been added:
CC   CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT).
CC   Compared to the reference sequence BC001275 we did not find any
CC   amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1038
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834D053D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>1038
FT                   /codon_start=1
FT                   /gene="ANXA1"
FT                   /db_xref="GOA:Q5TZZ9"
FT                   /db_xref="H-InvDB:HIT000267181.13"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002388"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5TZZ9"
FT                   /protein_id="CAG28612.1"
FT                   /translation="MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPS
FT                   SDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHL
FT                   EEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRD
FT                   LAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFN
FT                   TILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEK
FT                   LHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILV
FT                   ALCGGN"
XX
SQ   Sequence 1038 BP; 329 A; 216 C; 248 G; 245 T; 0 other;
     atggcaatgg tatcagaatt cctcaagcag gcctggttta ttgaaaatga agagcaggaa        60
     tatgttcaaa ctgtgaagtc atccaaaggt ggtcccggat cagcggtgag cccctatcct       120
     accttcaatc catcctcgga tgtcgctgcc ttgcataagg ccataatggt taaaggtgtg       180
     gatgaagcaa ccatcattga cattctaact aagcgaaaca atgcacagcg tcaacagatc       240
     aaagcagcat atctccagga aacaggaaag cccctggatg aaacactgaa gaaagccctt       300
     acaggtcacc ttgaggaggt tgttttagct ctgctaaaaa ctccagcgca atttgatgct       360
     gatgaacttc gtgctgccat gaagggcctt ggaactgatg aagatactct aattgagatt       420
     ttggcatcaa gaactaacaa agaaatcaga gacattaaca gggtctacag agaggaactg       480
     aagagagatc tggccaaaga cataacctca gacacatctg gagattttcg gaacgctttg       540
     ctttctcttg ctaagggtga ccgatctgag gactttggtg tgaatgaaga cttggctgat       600
     tcagatgcca gggccttgta tgaagcagga gaaaggagaa aggggacaga cgtaaacgtg       660
     ttcaatacca tccttaccac cagaagctat ccacaacttc gcagagtgtt tcagaaatac       720
     accaagtaca gtaagcatga catgaacaaa gttctggacc tggagttgaa aggtgacatt       780
     gagaaatgcc tcacagctat cgtgaagtgc gccacaagca aaccagcttt ctttgcagag       840
     aagcttcatc aagccatgaa aggtgttgga actcgccata aggcattgat caggattatg       900
     gtttcccgtt ctgaaattga catgaatgat atcaaagcat tctatcagaa gatgtatggt       960
     atctcccttt gccaagccat cctggatgaa accaaaggag attatgagaa aatcctggtg      1020
     gctctttgtg gaggaaac                                                    1038
//