Dbfetch

ID   CH471144; SV 1; linear; genomic DNA; CON; HUM; 5843728 BP.
XX
AC   CH471144; AADB02000000;
XX
PR   Project:PRJNA1431;
XX
DT   30-JUL-2005 (Rel. 84, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens 211000035837778 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5843728
RX   DOI; 10.1126/science.1058040.
RX   PUBMED; 11181995.
RA   Venter J.C., Adams M.D., Myers E.W., Li P.W., Mural R.J., Sutton G.G.,
RA   Smith H.O., Yandell M., Evans C.A., Holt R.A., Gocayne J.D., Amanatides P.,
RA   Ballew R.M., Huson D.H., Wortman J.R., Zhang Q., Kodira C.D., Zheng X.H.,
RA   Chen L., Skupski M., Subramanian G., Thomas P.D., Zhang J.,
RA   Gabor Miklos G.L., Nelson C., Broder S., Clark A.G., Nadeau J.,
RA   McKusick V.A., Zinder N., Levine A.J., Roberts R.J., Simon M., Slayman C.,
RA   Hunkapiller M., Bolanos R., Delcher A., Dew I., Fasulo D., Flanigan M.,
RA   Florea L., Halpern A., Hannenhalli S., Kravitz S., Levy S., Mobarry C.,
RA   Reinert K., Remington K., Abu-Threideh J., Beasley E., Biddick K.,
RA   Bonazzi V., Brandon R., Cargill M., Chandramouliswaran I., Charlab R.,
RA   Chaturvedi K., Deng Z., Di Francesco V., Dunn P., Eilbeck K.,
RA   Evangelista C., Gabrielian A.E., Gan W., Ge W., Gong F., Gu Z., Guan P.,
RA   Heiman T.J., Higgins M.E., Ji R.R., Ke Z., Ketchum K.A., Lai Z., Lei Y.,
RA   Li Z., Li J., Liang Y., Lin X., Lu F., Merkulov G.V., Milshina N.,
RA   Moore H.M., Naik A.K., Narayan V.A., Neelam B., Nusskern D., Rusch D.B.,
RA   Salzberg S., Shao W., Shue B., Sun J., Wang Z., Wang A., Wang X., Wang J.,
RA   Wei M., Wides R., Xiao C., Yan C., Yao A., Ye J., Zhan M., Zhang W.,
RA   Zhang H., Zhao Q., Zheng L., Zhong F., Zhong W., Zhu S., Zhao S.,
RA   Gilbert D., Baumhueter S., Spier G., Carter C., Cravchik A., Woodage T.,
RA   Ali F., An H., Awe A., Baldwin D., Baden H., Barnstead M., Barrow I.,
RA   Beeson K., Busam D., Carver A., Center A., Cheng M.L., Curry L.,
RA   Danaher S., Davenport L., Desilets R., Dietz S., Dodson K., Doup L.,
RA   Ferriera S., Garg N., Gluecksmann A., Hart B., Haynes J., Haynes C.,
RA   Heiner C., Hladun S., Hostin D., Houck J., Howland T., Ibegwam C.,
RA   Johnson J., Kalush F., Kline L., Koduru S., Love A., Mann F., May D.,
RA   McCawley S., McIntosh T., McMullen I., Moy M., Moy L., Murphy B.,
RA   Nelson K., Pfannkoch C., Pratts E., Puri V., Qureshi H., Reardon M.,
RA   Rodriguez R., Rogers Y.H., Romblad D., Ruhfel B., Scott R., Sitter C.,
RA   Smallwood M., Stewart E., Strong R., Suh E., Thomas R., Tint N.N., Tse S.,
RA   Vech C., Wang G., Wetter J., Williams S., Williams M., Windsor S.,
RA   Winn-Deen E., Wolfe K., Zaveri J., Zaveri K., Abril J.F., Guigo R.,
RA   Campbell M.J., Sjolander K.V., Karlak B., Kejariwal A., Mi H., Lazareva B.,
RA   Hatton T., Narechania A., Diemer K., Muruganujan A., Guo N., Sato S.,
RA   Bafna V., Istrail S., Lippert R., Schwartz R., Walenz B., Yooseph S.,
RA   Allen D., Basu A., Baxendale J., Blick L., Caminha M., Carnes-Stine J.,
RA   Caulk P., Chiang Y.H., Coyne M., Dahlke C., Mays A., Dombroski M.,
RA   Donnelly M., Ely D., Esparham S., Fosler C., Gire H., Glanowski S.,
RA   Glasser K., Glodek A., Gorokhov M., Graham K., Gropman B., Harris M.,
RA   Heil J., Henderson S., Hoover J., Jennings D., Jordan C., Jordan J.,
RA   Kasha J., Kagan L., Kraft C., Levitsky A., Lewis M., Liu X., Lopez J.,
RA   Ma D., Majoros W., McDaniel J., Murphy S., Newman M., Nguyen T., Nguyen N.,
RA   Nodell M., Pan S., Peck J., Peterson M., Rowe W., Sanders R., Scott J.,
RA   Simpson M., Smith T., Sprague A., Stockwell T., Turner R., Venter E.,
RA   Wang M., Wen M., Wu D., Wu M., Xia A., Zandieh A., Zhu X.;
RT   "The sequence of the human genome";
RL   Science, e1252229 291(5507):1304-1351(2001).
XX
RN   [2]
RP   1-5843728
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; b8b46b4457aad5885355b534bf7e761e.
DR   ENA; AADB02000000; SET.
DR   ENA; AADB00000000; SET.
DR   ENA-CON; CM000258.
DR   BioSample; SAMN02981219.
DR   Ensembl-Gn; ENSG00000075618; homo_sapiens.
DR   Ensembl-Gn; ENSG00000075624; homo_sapiens.
DR   Ensembl-Gn; ENSG00000105963; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106012; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106263; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106266; homo_sapiens.
DR   Ensembl-Gn; ENSG00000106268; homo_sapiens.
DR   Ensembl-Gn; ENSG00000122543; homo_sapiens.
DR   Ensembl-Gn; ENSG00000122687; homo_sapiens.
DR   Ensembl-Gn; ENSG00000136213; homo_sapiens.
DR   Ensembl-Gn; ENSG00000136295; homo_sapiens.
DR   Ensembl-Gn; ENSG00000136297; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146587; homo_sapiens.
DR   Ensembl-Gn; ENSG00000155034; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157778; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157927; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157954; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164638; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164850; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164855; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164877; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174945; homo_sapiens.
DR   Ensembl-Gn; ENSG00000177706; homo_sapiens.
DR   Ensembl-Gn; ENSG00000178381; homo_sapiens.
DR   Ensembl-Gn; ENSG00000182095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198517; homo_sapiens.
DR   Ensembl-Gn; ENSG00000272968; homo_sapiens.
DR   Ensembl-Tr; ENST00000222990; homo_sapiens.
DR   Ensembl-Tr; ENST00000242104; homo_sapiens.
DR   Ensembl-Tr; ENST00000242257; homo_sapiens.
DR   Ensembl-Tr; ENST00000252329; homo_sapiens.
DR   Ensembl-Tr; ENST00000258711; homo_sapiens.
DR   Ensembl-Tr; ENST00000258796; homo_sapiens.
DR   Ensembl-Tr; ENST00000265846; homo_sapiens.
DR   Ensembl-Tr; ENST00000288607; homo_sapiens.
DR   Ensembl-Tr; ENST00000288828; homo_sapiens.
DR   Ensembl-Tr; ENST00000297195; homo_sapiens.
DR   Ensembl-Tr; ENST00000297469; homo_sapiens.
DR   Ensembl-Tr; ENST00000297477; homo_sapiens.
DR   Ensembl-Tr; ENST00000297508; homo_sapiens.
DR   Ensembl-Tr; ENST00000312371; homo_sapiens.
DR   Ensembl-Tr; ENST00000313766; homo_sapiens.
DR   Ensembl-Tr; ENST00000316495; homo_sapiens.
DR   Ensembl-Tr; ENST00000325979; homo_sapiens.
DR   Ensembl-Tr; ENST00000331789; homo_sapiens.
DR   Ensembl-Tr; ENST00000339737; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
DR   Ensembl-Tr; ENST00000343242; homo_sapiens.
DR   Ensembl-Tr; ENST00000343985; homo_sapiens.
DR   Ensembl-Tr; ENST00000353796; homo_sapiens.
DR   Ensembl-Tr; ENST00000356714; homo_sapiens.
DR   Ensembl-Tr; ENST00000360876; homo_sapiens.
DR   Ensembl-Tr; ENST00000382361; homo_sapiens.
DR   Ensembl-Tr; ENST00000382368; homo_sapiens.
DR   Ensembl-Tr; ENST00000382384; homo_sapiens.
DR   Ensembl-Tr; ENST00000396872; homo_sapiens.
DR   Ensembl-Tr; ENST00000396912; homo_sapiens.
DR   Ensembl-Tr; ENST00000396946; homo_sapiens.
DR   Ensembl-Tr; ENST00000397011; homo_sapiens.
DR   Ensembl-Tr; ENST00000397046; homo_sapiens.
DR   Ensembl-Tr; ENST00000397048; homo_sapiens.
DR   Ensembl-Tr; ENST00000397049; homo_sapiens.
DR   Ensembl-Tr; ENST00000397083; homo_sapiens.
DR   Ensembl-Tr; ENST00000397088; homo_sapiens.
DR   Ensembl-Tr; ENST00000397092; homo_sapiens.
DR   Ensembl-Tr; ENST00000397095; homo_sapiens.
DR   Ensembl-Tr; ENST00000399434; homo_sapiens.
DR   Ensembl-Tr; ENST00000399583; homo_sapiens.
DR   Ensembl-Tr; ENST00000401401; homo_sapiens.
DR   Ensembl-Tr; ENST00000401525; homo_sapiens.
DR   Ensembl-Tr; ENST00000401670; homo_sapiens.
DR   Ensembl-Tr; ENST00000403150; homo_sapiens.
DR   Ensembl-Tr; ENST00000403167; homo_sapiens.
DR   Ensembl-Tr; ENST00000404674; homo_sapiens.
DR   Ensembl-Tr; ENST00000404704; homo_sapiens.
DR   Ensembl-Tr; ENST00000404774; homo_sapiens.
DR   Ensembl-Tr; ENST00000406174; homo_sapiens.
DR   Ensembl-Tr; ENST00000406453; homo_sapiens.
DR   Ensembl-Tr; ENST00000406755; homo_sapiens.
DR   Ensembl-Tr; ENST00000407184; homo_sapiens.
DR   Ensembl-Tr; ENST00000407643; homo_sapiens.
DR   Ensembl-Tr; ENST00000413446; homo_sapiens.
DR   Ensembl-Tr; ENST00000416608; homo_sapiens.
DR   Ensembl-Tr; ENST00000425660; homo_sapiens.
DR   Ensembl-Tr; ENST00000440306; homo_sapiens.
DR   Ensembl-Tr; ENST00000449296; homo_sapiens.
DR   Ensembl-Tr; ENST00000476665; homo_sapiens.
DR   Ensembl-Tr; ENST00000484262; homo_sapiens.
DR   Ensembl-Tr; ENST00000539900; homo_sapiens.
DR   Ensembl-Tr; ENST00000611167; homo_sapiens.
DR   Ensembl-Tr; ENST00000612910; homo_sapiens.
DR   Ensembl-Tr; ENST00000618655; homo_sapiens.
DR   Ensembl-Tr; ENST00000623361; homo_sapiens.
DR   PubMed; 11181995.
DR   PubMed; 14769938.
XX
CC   This is the November 2001 combined whole genome shotgun assembly
CC   applied to the 27 million reads of Celera's whole genome shotgun
CC   data and 16 million  reads of shredded GenBank data from other
CC   human genome projects (Nature 2001. 409:860-921). It relied on
CC   Celera's paired reads and BAC end reads from TIGR for long range
CC   order and orientation. Its scaffolds were mapped to chromosomes
CC   using STS maps. For more detailed information about whole genome
CC   sequencing and Celera's assembly process, please refer to Venter,
CC   J.C. et al. Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was created in
CC   April 2002 from the whole-genome mapping of transcript and protein
CC   sequences on the Celera human genome assembly
CC   (http://www.ncbi.nlm.nih.gov/genome/guide/human/release_notes.html)
CC   by Celera Chromosome Team, Content Systems and Informatics
CC   Research. The data sets used by this annotation process were
CC   collected in 2001 and include RefSeq (NM_) sequences, manually
CC   annotated transcripts from previous Celera assemblies, GenBank mRNA
CC   and dbEST sequences, Celera internal EST and full-insert sequences
CC   of cDNA clones (unpublished), mammalian SwissProt sequences, NRAA
CC   sequences, and International Protein Index (IPI) sequences (all
CC   human unless noted otherwise).  The CDS of each transcript was
CC   computationally defined by either the longest ATG-to-Stop or the
CC   longest open reading frame. All CDSs corresponding to the longest
CC   open reading frames with no starting ATG were flagged as partial.
CC   In addition, some of the genes were manually curated between 2002
CC   and 2005. Coverage analysis of splice junction donor/acceptor pairs
CC   and single-exon transcripts was done by Applied Biosystems in
CC   August 2006, based on Dec 2005 versions of human cDNA (RefSeq,
CC   Genbank mRNA and dbEST, Celera internal EST and full insert
CC   sequences) and human SwissProt sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5843728
FT                   /organism="Homo sapiens"
FT                   /chromosome="7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   assembly_gap    94444..94560
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            complement(<110386..>122734)
FT                   /locus_tag="hCG_1993372"
FT                   /note="gene_id=hCG1993372.0"
FT   mRNA            complement(join(<110386..110597,110726..110830,
FT                   121787..121919,122657..>122734))
FT                   /locus_tag="hCG_1993372"
FT                   /product="hCG1993372, transcript variant hCT2272402"
FT                   /note="gene_id=hCG1993372.0 transcript_id=hCT2272402.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<110386..110597,110726..110830,
FT                   121787..121919,122657..122734))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993372"
FT                   /product="hCG1993372, isoform CRA_a"
FT                   /note="gene_id=hCG1993372.0 transcript_id=hCT2272402.0
FT                   protein_id=hCP1787666.0 isoform=CRA_a"
FT                   /protein_id="EAW87146.1"
FT                   /translation="MDANEQGLSSPKRVHGGGSGTPNSGRIPQTHLVERTRLRCSEAQG
FT                   MCAPHGCDLGHRPQSARSLRGVIGPAPPGQHLASPCTNTWPLLPWPAALPVSGLWFTEC
FT                   ARPASPSAKGTGCPRLLKHALSRPLSGRHPALLPSPLHSPSPAWSLPSGRSGPTATISG
FT                   DRPGRLGPVRGPR"
FT   gene            <112450..>112752
FT                   /locus_tag="hCG_1992625"
FT                   /note="gene_id=hCG1992625.0"
FT   mRNA            <112450..>112752
FT                   /locus_tag="hCG_1992625"
FT                   /product="hCG1992625"
FT                   /note="gene_id=hCG1992625.0 transcript_id=hCT2271335.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             112450..>112752
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992625"
FT                   /product="hCG1992625"
FT                   /note="gene_id=hCG1992625.0 transcript_id=hCT2271335.0
FT                   protein_id=hCP1787751.0"
FT                   /protein_id="EAW87148.1"
FT                   /translation="MRHLLEPFGVTLSGPSATVSTPGSWVLSSPSQDIFRPGLSELLLL
FT                   LIIETGSQSIAKTGVQWCDPGLLSLPGSGDPPSSASCVAGTTGRHHHAWLNFLYFL"
FT   mRNA            complement(join(<121531..121634,121787..122163,
FT                   122657..>122691))
FT                   /locus_tag="hCG_1993372"
FT                   /product="hCG1993372, transcript variant hCT2272403"
FT                   /note="gene_id=hCG1993372.0 transcript_id=hCT2272403.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<121531..121634,121787..122163,
FT                   122657..122691))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993372"
FT                   /product="hCG1993372, isoform CRA_b"
FT                   /note="gene_id=hCG1993372.0 transcript_id=hCT2272403.0
FT                   protein_id=hCP1787665.0 isoform=CRA_b"
FT                   /protein_id="EAW87147.1"
FT                   /translation="MGVAAAPLTLAGCPPPAPAGTEAPEELVESGVNGSAFAPALPVQA
FT                   SGSWKEPGPCSSMNVAPGPVPPGLEGLEGGALKSPCSQKRRLCFPCAQIPQTHLVERTR
FT                   LRCSEAQGMCAPHGCDLGHRPQSARSLRGVIGPGPSALRADETRLMAATLLLRAEERPA
FT                   SEATQRGDF"
FT   assembly_gap    127263..131023
FT                   /estimated_length=3761
FT                   /gap_type="unknown"
FT   assembly_gap    153070..153189
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            153612..216019
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /note="gene_id=hCG1992628.1"
FT   mRNA            join(153612..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203477,207269..207690,
FT                   208421..208507,211123..211303,211928..212037,
FT                   212279..212360,213920..213979,215005..216019)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2349096"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349096.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 30-SEP-2003"
FT   mRNA            join(153612..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203477,211123..211303,
FT                   211928..212037,212279..212360,213920..213979,
FT                   215005..216019)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2271338"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271338.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 30-SEP-2003"
FT   mRNA            join(153612..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203671)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2349097"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349097.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 30-SEP-2003"
FT   mRNA            join(153612..154447,170326..170404,201462..201554,
FT                   203362..203463)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2349095"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349095.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 30-SEP-2003"
FT   CDS             join(153843..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203477,211123..211303,
FT                   211928..212037,212279..212360,213920..213979,
FT                   215005..215254)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271338.1
FT                   protein_id=hCP1787756.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8IXL6"
FT                   /db_xref="HGNC:HGNC:22140"
FT                   /db_xref="InterPro:IPR009581"
FT                   /db_xref="InterPro:IPR024869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IXL6"
FT                   /protein_id="EAW87149.1"
FT                   /translation="MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPG
FT                   CSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSS
FT                   HSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLAR
FT                   LFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDS
FT                   YPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQ
FT                   ALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEI
FT                   RDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAK
FT                   RKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMD
FT                   RHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKE
FT                   EYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDT
FT                   EHRAASAR"
FT   CDS             join(153843..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203477,207269..207414)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349096.0
FT                   protein_id=hCP1914345.0 isoform=CRA_d"
FT                   /protein_id="EAW87152.1"
FT                   /translation="MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPG
FT                   CSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSS
FT                   HSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLAR
FT                   LFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDS
FT                   YPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQ
FT                   ALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEI
FT                   RDVTRDKKLWRTFFISPGCQVISEALPEPRAHQRAEPTVDTPSASRPRMPGHLGGPARA
FT                   EGTSEG"
FT   CDS             join(153843..154447,156197..156375,170326..170404,
FT                   201462..201554,203362..203590)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349097.0
FT                   protein_id=hCP1914346.0 isoform=CRA_c"
FT                   /protein_id="EAW87151.1"
FT                   /translation="MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPG
FT                   CSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSS
FT                   HSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLAR
FT                   LFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDS
FT                   YPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQ
FT                   ALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEI
FT                   RDVTRDKKLWRTFFISPGSLARGPAFISPGSLARGPAFISPGSLARGAHIHLAR"
FT   CDS             join(153843..154447,170326..170404,201462..201491)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_h"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2349095.0
FT                   protein_id=hCP1914347.0 isoform=CRA_h"
FT                   /protein_id="EAW87156.1"
FT                   /translation="MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPG
FT                   CSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSS
FT                   HSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLAR
FT                   LFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDCHEVGGHAAEAHHDLPELRAS
FT                   AVQTHETNEGAGDTP"
FT   mRNA            join(154363..154447,156197..156375,201462..201554,
FT                   203362..203477,211123..211303,211928..>211951)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2356903"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2356903.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 14-JUL-2004"
FT   mRNA            join(155744..155796,156197..156375,170326..170404,
FT                   201462..201554,203362..203477,211123..211303,
FT                   211928..212037,212279..212360,213920..213979,
FT                   215005..216019)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2356902"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2356902.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 14-JUL-2004"
FT   mRNA            join(<156202..156375,157773..158811)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2271339"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271339.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 30-SEP-2003"
FT   CDS             join(156202..156375,157773..157994)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_f"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271339.0
FT                   protein_id=hCP1787759.0 isoform=CRA_f"
FT                   /protein_id="EAW87154.1"
FT                   /translation="MRVLKVQNSSPPGRRPWTPIPTGSSSTLVSTGTSCTPDTTRPSRP
FT                   CCTTSAPRGSPAWQILLAPPACQTPFLGGGELRMSSASTRSAASVDLTAPGRDTHAQCP
FT                   ILRRNEHFRAVHASQAVWRGGGSTGRG"
FT   assembly_gap    166432..168468
FT                   /estimated_length=2037
FT                   /gap_type="unknown"
FT   CDS             join(170328..170404,201462..201554,203362..203477,
FT                   211123..211303,211928..212037,212279..212360,
FT                   213920..213979,215005..215254)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_i"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2356902.0
FT                   protein_id=hCP1922144.0 isoform=CRA_i"
FT                   /protein_id="EAW87157.1"
FT                   /translation="MKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFFYFSDYER
FT                   HNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGE
FT                   CSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDY
FT                   CEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFG
FT                   KYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHL
FT                   EALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR"
FT   assembly_gap    178488..178555
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    187556..188102
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    189295..189437
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    195408..195427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    197723..198926
FT                   /estimated_length=1204
FT                   /gap_type="unknown"
FT   assembly_gap    199957..199976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(200942..201554,203362..203477,211123..211303,
FT                   211928..212037,212279..212360,213920..213979,
FT                   215005..216019)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2271340"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271340.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 30-SEP-2003"
FT   CDS             join(203402..203477,211123..211303,211928..212037,
FT                   212279..212360,213920..213979,215005..215254)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_g"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271340.1
FT                   protein_id=hCP1787760.0 isoform=CRA_g"
FT                   /protein_id="EAW87155.1"
FT                   /translation="MVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHAL
FT                   CGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYD
FT                   SSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILV
FT                   PLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVL
FT                   KAVRDCVERNGLHSVVDDDLDTEHRAASAR"
FT   CDS             join(203402..203477,211123..211303,211928..>211951)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2356903.0
FT                   protein_id=hCP1922145.0 isoform=CRA_e"
FT                   /protein_id="EAW87153.1"
FT                   /translation="MVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHAL
FT                   CGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDY"
FT   assembly_gap    209139..209444
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   mRNA            join(211469..212037,212279..212727)
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   transcript variant hCT2271341"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271341.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 30-SEP-2003"
FT   CDS             join(212007..212037,212279..212364)
FT                   /codon_start=1
FT                   /gene="FAM20C"
FT                   /locus_tag="hCG_1992628"
FT                   /product="family with sequence similarity 20, member C,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1992628.1 transcript_id=hCT2271341.1
FT                   protein_id=hCP1787757.1 isoform=CRA_b"
FT                   /protein_id="EAW87150.1"
FT                   /translation="MDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRG"
FT   assembly_gap    235459..235710
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    246575..246594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    248061..248080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    262912..263251
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    265506..265525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    279883..279968
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    282458..282521
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    283394..283526
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    287024..287043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(292475..>295633)
FT                   /locus_tag="hCG_2038545"
FT                   /note="gene_id=hCG2038545.0"
FT   mRNA            complement(join(292475..293439,294920..>295633))
FT                   /locus_tag="hCG_2038545"
FT                   /product="hCG2038545"
FT                   /note="gene_id=hCG2038545.0 transcript_id=hCT2342971.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 07-APR-2003"
FT   CDS             complement(join(293375..293439,294920..>295202))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038545"
FT                   /product="hCG2038545"
FT                   /note="gene_id=hCG2038545.0 transcript_id=hCT2342971.0
FT                   protein_id=hCP1908183.0"
FT                   /protein_id="EAW87158.1"
FT                   /translation="LRTSSWNPLGCPVGRKSNDKCPYQKRRTERSGPQRHGDRDPSGMA
FT                   RRQGVARTAASTGGGRGLEPTLPRGPQGDPPCRPPQFRRPSVALSPAVHGCISLLNPPN
FT                   EPGALSCSGGN"
FT   assembly_gap    298331..298446
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    299507..300962
FT                   /estimated_length=1456
FT                   /gap_type="unknown"
FT   assembly_gap    306373..308207
FT                   /estimated_length=1835
FT                   /gap_type="unknown"
FT   assembly_gap    313368..313509
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    324581..324600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    326010..326093
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    329202..329395
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            <331518..334966
FT                   /locus_tag="hCG_2038375"
FT                   /note="gene_id=hCG2038375.0"
FT   mRNA            join(<331518..331636,332511..332607,332936..334966)
FT                   /locus_tag="hCG_2038375"
FT                   /product="hCG2038375"
FT                   /note="gene_id=hCG2038375.0 transcript_id=hCT2342801.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 07-APR-2003"
FT   assembly_gap    332741..332798
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   CDS             <333059..333496
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038375"
FT                   /product="hCG2038375"
FT                   /note="gene_id=hCG2038375.0 transcript_id=hCT2342801.0
FT                   protein_id=hCP1908186.0"
FT                   /protein_id="EAW87159.1"
FT                   /translation="TAFTQEAGDGQDSLRQGTQKEGAAGCALGGSHSPARSSGELGVGA
FT                   GSPEAAGDPCLQLRVSLPFVLPPISLKLPQFPSLLALMNLLVGPGLWPAELVHEVWRCG
FT                   MALPPAGTPRACMHAVQTDEPSTALTQTIQRGVGDAHRWGH"
FT   assembly_gap    352204..352459
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    359983..360094
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    362373..362935
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    365476..366407
FT                   /estimated_length=932
FT                   /gap_type="unknown"
FT   assembly_gap    377307..377702
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    384004..384141
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    385628..385877
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    394325..397562
FT                   /estimated_length=3238
FT                   /gap_type="unknown"
FT   assembly_gap    417472..418877
FT                   /estimated_length=1406
FT                   /gap_type="unknown"
FT   assembly_gap    421527..424098
FT                   /estimated_length=2572
FT                   /gap_type="unknown"
FT   assembly_gap    428334..428353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    429991..430625
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    432673..433314
FT                   /estimated_length=642
FT                   /gap_type="unknown"
FT   assembly_gap    434668..435356
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    443133..443191
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    445639..445658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(448232..470261)
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /note="gene_id=hCG1818527.1"
FT   mRNA            complement(join(448232..449545,451422..451478,
FT                   452095..452221,461477..461509,461864..462030,
FT                   463341..463445,468382..468478,469923..470261))
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   transcript variant hCT1963886"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT1963886.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(448232..449545,452095..452225,
FT                   461854..462030,463341..463445,468382..468478,
FT                   469923..470261))
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   transcript variant hCT2272390"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT2272390.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(448232..449545,451422..451478,
FT                   452095..452225,461854..462030,463341..463445,
FT                   468382..468478,469923..470261))
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   transcript variant hCT2272389"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT2272389.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(451423..451478,452095..452221,
FT                   461477..461509,461864..462030,463341..463445,
FT                   468382..468478,469923..469985))
FT                   /codon_start=1
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT1963886.1
FT                   protein_id=hCP1778659.1 isoform=CRA_b"
FT                   /protein_id="EAW87161.1"
FT                   /translation="MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQ
FT                   RLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYE
FT                   IPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRGPSRVHHRSVKVAKVEYVR
FT                   KKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT"
FT   CDS             complement(join(452182..452225,461854..462030,
FT                   463341..463445,468382..468478,469923..469985))
FT                   /codon_start=1
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT2272389.0
FT                   protein_id=hCP1787707.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R7Z9"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR006782"
FT                   /db_xref="InterPro:IPR023581"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R7Z9"
FT                   /protein_id="EAW87160.1"
FT                   /translation="MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQ
FT                   RLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYE
FT                   IPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRRWPRWNTSGRSQN"
FT   CDS             complement(join(452182..452225,461854..462030,
FT                   463341..463445,468382..468478,469923..469985))
FT                   /codon_start=1
FT                   /gene="PDGFA"
FT                   /locus_tag="hCG_1818527"
FT                   /product="platelet-derived growth factor alpha polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1818527.1 transcript_id=hCT2272390.0
FT                   protein_id=hCP1787708.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R7Z9"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR006782"
FT                   /db_xref="InterPro:IPR023581"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R7Z9"
FT                   /protein_id="EAW87162.1"
FT                   /translation="MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQ
FT                   RLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYE
FT                   IPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRRWPRWNTSGRSQN"
FT   assembly_gap    454375..454663
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    461554..461852
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    470262..471356
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   assembly_gap    491049..491146
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    492697..492861
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            complement(500767..677554)
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /note="gene_id=hCG1993358.0"
FT   mRNA            complement(join(500767..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661312,677479..677554))
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, transcript variant hCT2272384"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272384.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(500767..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557400,558595..558638,627000..627091,
FT                   630327..630497,661114..661312,677479..677554))
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, transcript variant hCT2272385"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272385.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(500767..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661312,662875..662981))
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, transcript variant hCT2272386"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272386.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(500767..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661312,662670..662830))
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, transcript variant hCT2272383"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272383.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(502015..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661290))
FT                   /codon_start=1
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, isoform CRA_b"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272383.0
FT                   protein_id=hCP1787696.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R802"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R802"
FT                   /protein_id="EAW87164.1"
FT                   /translation="MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPER
FT                   PMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEV
FT                   YTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAVSS
FT                   FVTGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKL
FT                   WGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKI
FT                   VVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVA
FT                   RGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV"
FT   CDS             complement(join(502015..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661290))
FT                   /codon_start=1
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, isoform CRA_b"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272384.0
FT                   protein_id=hCP1787695.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R802"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R802"
FT                   /protein_id="EAW87165.1"
FT                   /translation="MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPER
FT                   PMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEV
FT                   YTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAVSS
FT                   FVTGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKL
FT                   WGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKI
FT                   VVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVA
FT                   RGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV"
FT   CDS             complement(join(502015..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557418,558598..558638,627000..627091,
FT                   630327..630497,661114..661290))
FT                   /codon_start=1
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, isoform CRA_b"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272386.0
FT                   protein_id=hCP1787697.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R802"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R802"
FT                   /protein_id="EAW87166.1"
FT                   /translation="MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPER
FT                   PMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEV
FT                   YTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAVSS
FT                   FVTGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKL
FT                   WGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKI
FT                   VVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVA
FT                   RGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV"
FT   CDS             complement(join(502015..502187,502974..503055,
FT                   531186..531307,536764..536824,547540..547698,
FT                   557354..557400,558595..558638,627000..627091,
FT                   630327..630497,661114..661290))
FT                   /codon_start=1
FT                   /gene="PRKAR1B"
FT                   /locus_tag="hCG_1993358"
FT                   /product="protein kinase, cAMP-dependent, regulatory, type
FT                   I, beta, isoform CRA_a"
FT                   /note="gene_id=hCG1993358.0 transcript_id=hCT2272385.0
FT                   protein_id=hCP1787699.0 isoform=CRA_a"
FT                   /protein_id="EAW87163.1"
FT                   /translation="MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPER
FT                   PMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEV
FT                   YTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGGN
FT                   EGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDR
FT                   DSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGE
FT                   PGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLK
FT                   CVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV"
FT   assembly_gap    503062..505638
FT                   /estimated_length=2577
FT                   /gap_type="unknown"
FT   assembly_gap    511993..512059
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            515600..519259
FT                   /locus_tag="hCG_2036715"
FT                   /note="gene_id=hCG2036715.0"
FT   mRNA            join(515600..515652,518743..519259)
FT                   /locus_tag="hCG_2036715"
FT                   /product="hCG2036715"
FT                   /note="gene_id=hCG2036715.0 transcript_id=hCT2340871.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 27-FEB-2003"
FT   CDS             518896..519234
FT                   /codon_start=1
FT                   /locus_tag="hCG_2036715"
FT                   /product="hCG2036715"
FT                   /note="gene_id=hCG2036715.0 transcript_id=hCT2340871.0
FT                   protein_id=hCP1907455.0"
FT                   /protein_id="EAW87167.1"
FT                   /translation="MSPADLSGNLGHQGGAQMLVLLLSNMSLGSKGEQVTWVQPQPAAT
FT                   SLESLMKQCIQGRIHCCLSPLQRPGPTPHQLLGHCPSSQGESRAQRGYKYTPDSQEFPS
FT                   PTEELSKR"
FT   assembly_gap    519490..519509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    525966..526786
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    532704..533274
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    535907..535986
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    541225..541244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    558492..558593
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    560569..562670
FT                   /estimated_length=2102
FT                   /gap_type="unknown"
FT   assembly_gap    605837..605856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    609476..609824
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    622197..622216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    639477..639497
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    647687..647706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    656776..656856
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    661913..662201
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            676497..>740327
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /note="gene_id=hCG1747711.2"
FT   mRNA            join(676497..676943,679554..679739,690644..690768,
FT                   691172..691290,705456..705688,707651..707863,
FT                   712591..712734,714670..714838,721339..721486,
FT                   724932..725082,725888..726044,730832..731023,
FT                   736294..737250)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT1786067"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT1786067.2;
FT                   splice donor-acceptor pairs covered / total pairs = 11/12;
FT                   created on 26-AUG-2002"
FT   CDS             join(676518..676943,679554..679739,690644..690768,
FT                   691172..691290,705456..705688,707651..707863,
FT                   712591..712734,714670..714838,721339..721486,
FT                   724932..725082,725888..726044,730832..731023,
FT                   736294..736430)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_e"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT1786067.2
FT                   protein_id=hCP1706003.2 isoform=CRA_e"
FT                   /protein_id="EAW87173.1"
FT                   /translation="MAALGVAEAVAAPHPAEGAETAEAVELSRALSRLLPGLEADSKPG
FT                   RRRALEALRRALEEPGPAADPTAFQGPWARLLLPRLLRCLSDPAEGCRALAVHLLDLGL
FT                   RRAARPRDALPRLLPALAARLAGPVPARRPPEACEELRDHFHMQSESLIGPLMQTISHQ
FT                   HWKVRVAAIEATGAVIHFGNGKSVDDVLSHFAQRLFDDVPQVRRAVASVVGGWLLCLRD
FT                   RYSFFHKLIPLLLSSLNDEVPEVRQLAASLWEDVGLQWQKENEEDLKDKLDFAPPTPPH
FT                   YPPHERRPVLGCRELVFRNLSKILPALCHDITDWVVGTRVKSAQLLPVLLLHAEDHATQ
FT                   HLEVVLRTLFQACTDEEAAVVQSCTRSAELVGTFVSPEVFLKLILSTLKKTPSASGLLV
FT                   LASAMRGCPREALQPHLAAIATELAQAHICQASENDLYLERLLLCVQALVSVCHEDCGV
FT                   ASLQLLDVLLTIVALAGATGLRDKAQETMDSLAMVEGVSSCQDLYRKHIGPLLERVTAS
FT                   HLDWTAHSPELLQFSVIVAQSGPALGEALPHVVPTLRACLQPSQDPQMRLKLFSILSTA
FT                   LLRATDTINSQGQFPSYLETVTKDILAPNLQWHAGRTAAAIRTAAVSCLWALTSSEVLS
FT                   AEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIKIYPELLK
FT                   RLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI
FT                   LEVLKEGSGLFPDLLVRETEAVIHKHRSATYCEQLLQHVQAVPATQ"
FT   mRNA            join(676520..676562,705474..705688,707651..707863,
FT                   712591..712734,714670..714838,721339..721486,
FT                   724932..725082,725888..726044,730832..731023,
FT                   740230..>740327)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT2271236"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271236.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/9;
FT                   created on 26-AUG-2002"
FT   mRNA            join(676520..676562,705474..705688,707651..707863,
FT                   712591..712734,714670..714838,721339..721486,
FT                   724932..725082,725888..726044,730832..731023,
FT                   736294..736670,736771..736851)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT2271238"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271238.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/10;
FT                   created on 26-AUG-2002"
FT   assembly_gap    676944..677441
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   mRNA            join(<678468..678631,679329..679453,679555..679739,
FT                   679833..>679904)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT2271239"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271239.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(678468..678631,679329..679453,679555..679739,
FT                   679833..>679904)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_b"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271239.0
FT                   protein_id=hCP1787790.0 isoform=CRA_b"
FT                   /protein_id="EAW87169.1"
FT                   /translation="MAIENSWHLMYFFFILNHFPTQSVHQPHELPPWTVGSTGQHCAHL
FT                   CPSPKRSLLGCHQGGTLVPEPLPVPGGTELSLAAWIVYCSCSKDLAWERKGDHFHMQSE
FT                   SLIGPLMQTISHQHWKVRVAAIEATGAVIHFGNGKSVDDVLSHFAQRLFDDVPQSAVCT
FT                   KCPFIIPSHRTFLFTSWKN"
FT   mRNA            join(682331..682481,690644..690768,691172..691290,
FT                   705456..705688,707651..707863,712591..712734,
FT                   714670..714838,721339..721486,724932..725082,
FT                   725888..726044,730832..731023,736294..736808)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT2356925"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2356925.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 14-JUL-2004"
FT   assembly_gap    702834..702853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(707771..707863,712591..712734,714670..714838,
FT                   721339..721486,724932..725082,725888..726044,
FT                   730832..731023,740230..>740327)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_a"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271236.0
FT                   protein_id=hCP1787792.0 isoform=CRA_a"
FT                   /protein_id="EAW87168.1"
FT                   /translation="MRGCPREALQPHLAAIATELAQAHICQASENDLYLERLLLCVQAL
FT                   VSVCHEDCGVASLQLLDVLLTIVALAGATGLRDKAQETMDSLAMVEGVSSCQDLYRKHI
FT                   GPLLERVTASHLDWTAHSPELLQFSVIVAQSGPALGEALPHVVPTLRACLQPSQDPQMR
FT                   LKLFSILSTALLRATDTINSQGQFPSYLETVTKDILAPNLQWHAGRTAAAIRTAAVSCL
FT                   WALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEK
FT                   LIKIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLD
FT                   DPERAIQDAILDVPGSPSPSAMIGSFLRPPHPWRTVSQLNLFSS"
FT   CDS             join(707771..707863,712591..712734,714670..714838,
FT                   721339..721486,724932..725082,725888..726044,
FT                   730832..731023,736294..736430)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_c"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2356925.0
FT                   protein_id=hCP1922127.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R803"
FT                   /protein_id="EAW87170.1"
FT                   /translation="MRGCPREALQPHLAAIATELAQAHICQASENDLYLERLLLCVQAL
FT                   VSVCHEDCGVASLQLLDVLLTIVALAGATGLRDKAQETMDSLAMVEGVSSCQDLYRKHI
FT                   GPLLERVTASHLDWTAHSPELLQFSVIVAQSGPALGEALPHVVPTLRACLQPSQDPQMR
FT                   LKLFSILSTALLRATDTINSQGQFPSYLETVTKDILAPNLQWHAGRTAAAIRTAAVSCL
FT                   WALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEK
FT                   LIKIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLD
FT                   DPERAIQDAILEVLKEGSGLFPDLLVRETEAVIHKHRSATYCEQLLQHVQAVPATQ"
FT   CDS             join(707771..707863,712591..712734,714670..714838,
FT                   721339..721486,724932..725082,725888..726044,
FT                   730832..731023,736294..736430)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_c"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271238.0
FT                   protein_id=hCP1787791.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R803"
FT                   /protein_id="EAW87171.1"
FT                   /translation="MRGCPREALQPHLAAIATELAQAHICQASENDLYLERLLLCVQAL
FT                   VSVCHEDCGVASLQLLDVLLTIVALAGATGLRDKAQETMDSLAMVEGVSSCQDLYRKHI
FT                   GPLLERVTASHLDWTAHSPELLQFSVIVAQSGPALGEALPHVVPTLRACLQPSQDPQMR
FT                   LKLFSILSTALLRATDTINSQGQFPSYLETVTKDILAPNLQWHAGRTAAAIRTAAVSCL
FT                   WALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEK
FT                   LIKIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLD
FT                   DPERAIQDAILEVLKEGSGLFPDLLVRETEAVIHKHRSATYCEQLLQHVQAVPATQ"
FT   assembly_gap    713395..713466
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   mRNA            join(718681..718980,721339..721486,724932..725082,
FT                   725888..726044,730832..731023,736294..737250)
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, transcript variant
FT                   hCT2271237"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271237.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             join(721416..721486,724932..725082,725888..726044,
FT                   730832..731023,736294..736430)
FT                   /codon_start=1
FT                   /gene="FLJ20397"
FT                   /locus_tag="hCG_1747711"
FT                   /product="hypothetical protein FLJ20397, isoform CRA_d"
FT                   /note="gene_id=hCG1747711.2 transcript_id=hCT2271237.0
FT                   protein_id=hCP1787788.0 isoform=CRA_d"
FT                   /protein_id="EAW87172.1"
FT                   /translation="MRLKLFSILSTALLRATDTINSQGQFPSYLETVTKDILAPNLQWH
FT                   AGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRI
FT                   INTFLKTSGGMTDPEKLIKIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYY
FT                   QSSVQYLYRELLVHLDDPERAIQDAILEVLKEGSGLFPDLLVRETEAVIHKHRSATYCE
FT                   QLLQHVQAVPATQ"
FT   assembly_gap    760407..760426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            766684..826340
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /note="gene_id=hCG1812059.2"
FT   mRNA            join(766684..766730,783706..783802,790051..790239,
FT                   793195..793379,794455..794481,794590..795066)
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), transcript variant
FT                   hCT2271243"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271243.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 11-FEB-2004"
FT   assembly_gap    767180..768244
FT                   /estimated_length=1065
FT                   /gap_type="unknown"
FT   mRNA            join(768455..768675,783221..783302,783706..783802,
FT                   790051..790239,793195..793379,794455..794481,
FT                   794590..794769,799704..799901,800806..800889,
FT                   801209..801319,802670..802768,803239..803332,
FT                   803898..803956,804099..804241,804698..804907,
FT                   806209..806295,807647..807690,809117..809246,
FT                   811416..811670,812668..812752,817300..817415,
FT                   820769..820936,823890..823982,824635..826340)
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), transcript variant
FT                   hCT1955830"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT1955830.2;
FT                   splice donor-acceptor pairs covered / total pairs = 23/23;
FT                   created on 11-FEB-2004"
FT   mRNA            join(768455..768675,783221..783302,783706..783802,
FT                   790051..790239,793195..793379,794455..794481,
FT                   794590..794769,799704..799901,800806..800889,
FT                   801209..801319,802670..802768,803239..803332,
FT                   803898..803956,804102..804241,804698..804907,
FT                   806209..806295,807647..807690,809117..809246,
FT                   811416..811670,812668..812752,817300..817415,
FT                   820769..820936,823890..823982,824635..826340)
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), transcript variant
FT                   hCT2271242"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271242.1;
FT                   splice donor-acceptor pairs covered / total pairs = 23/23;
FT                   created on 11-FEB-2004"
FT   mRNA            join(768455..768675,783221..783302,783706..783802,
FT                   790051..790239,793195..793379,794455..794481,
FT                   794590..794769,799704..799901,800806..802053)
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), transcript variant
FT                   hCT2271244"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271244.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 11-FEB-2004"
FT   mRNA            join(768455..768675,783221..783302,783706..783802,
FT                   790051..790239,793195..793379,794455..794481,
FT                   794590..794769,799704..799901,800806..800889,
FT                   801209..802053)
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), transcript variant
FT                   hCT2271241"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271241.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 11-FEB-2004"
FT   CDS             join(783726..783802,790051..790239,793195..793379,
FT                   794455..794481,794590..794769,799704..799901,
FT                   800806..800889,801209..801319,802670..802768,
FT                   803239..803332,803898..803956,804099..804241,
FT                   804698..804907,806209..806295,807647..807690,
FT                   809117..809246,811416..811670,812668..812752,
FT                   817300..817415,820769..820936,823890..823982,
FT                   824635..824751)
FT                   /codon_start=1
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), isoform CRA_d"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT1955830.2
FT                   protein_id=hCP1763161.2 isoform=CRA_d"
FT                   /protein_id="EAW87177.1"
FT                   /translation="MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPV
FT                   FDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSI
FT                   NHVSRQVTSSGVSYGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNK
FT                   AAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCGA
FT                   SFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKS
FT                   HESKAHASYYGRMNVREVLREDGHLSVNGEALCDDCKGKRHLDAHTAAHSQSPRLPGRA
FT                   GTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWY
FT                   QFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLAGLSLRGQGNFFSFLPVLNWASMH
FT                   RTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLREL
FT                   TTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKL
FT                   REKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDA
FT                   VQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVT
FT                   HHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGG
FT                   GSILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVR
FT                   LSMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGES
FT                   LQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK"
FT   CDS             join(783726..783802,790051..790239,793195..793379,
FT                   794455..794481,794590..794769,799704..799901,
FT                   800806..800889,801209..801319,802670..802768,
FT                   803239..803332,803898..803956,804102..804241,
FT                   804698..804907,806209..806295,807647..807690,
FT                   809117..809246,811416..811670,812668..812752,
FT                   817300..817415,820769..820936,823890..823982,
FT                   824635..824751)
FT                   /codon_start=1
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), isoform CRA_e"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271242.1
FT                   protein_id=hCP1787776.1 isoform=CRA_e"
FT                   /protein_id="EAW87178.1"
FT                   /translation="MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPV
FT                   FDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSI
FT                   NHVSRQVTSSGVSYGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNK
FT                   AAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCGA
FT                   SFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKS
FT                   HESKAHASYYGRMNVREVLREDGHLSVNGEALCDDCKGKRHLDAHTAAHSQSPRLPGRA
FT                   GTLWHIWACAGYFLLQILRRIGAVGQAVSRTAWSALWLAVVAPGKAASGVFWWLGIGWY
FT                   QFVTLISWLNVFLLTRCLRNICKFLVLLIPLFLLLGLSLRGQGNFFSFLPVLNWASMHR
FT                   TQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELT
FT                   TLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLR
FT                   EKSEAIQKELEQTKQKTISAVGEQLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAV
FT                   QERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTH
FT                   HVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNSALKLYSQDKTGMVDFALESGGG
FT                   SILSTRCSETYETKTALMSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRL
FT                   SMMIHPAAFTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESL
FT                   QMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPVK"
FT   CDS             join(783726..783802,790051..790239,793195..793379,
FT                   794455..794481,794590..794769,799704..799901,
FT                   800806..800889,801209..801423)
FT                   /codon_start=1
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), isoform CRA_a"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271241.1
FT                   protein_id=hCP1787775.1 isoform=CRA_a"
FT                   /protein_id="EAW87174.1"
FT                   /translation="MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPV
FT                   FDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSI
FT                   NHVSRQVTSSGVSYGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNK
FT                   AAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCGA
FT                   SFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKS
FT                   HESKAHASYYGRMNVREVLREDGHLSVNGEALCDDCKGKRHLDAHTAAHSQSPRLPGRA
FT                   GTLWHIWACAGCLSPRLRLISPCHHAICVLCGLCLEFKCFKVLL"
FT   CDS             join(783726..783802,790051..790239,793195..793379,
FT                   794455..794481,794590..794769,799704..799901,
FT                   800806..800975)
FT                   /codon_start=1
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), isoform CRA_c"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271244.1
FT                   protein_id=hCP1787773.1 isoform=CRA_c"
FT                   /protein_id="EAW87176.1"
FT                   /translation="MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPV
FT                   FDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSI
FT                   NHVSRQVTSSGVSYGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNK
FT                   AAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCGA
FT                   SFYVNRILWLARYTASSFSSFLVQLFQVVLMKLSYESENYKLKTHESKDCESESYKSKS
FT                   HESKAHASYYGRMNVREVLREDGHLSVNGEALCKYGFVFLWASVVELVPHAVMLGTSSR
FT                   E"
FT   CDS             join(783726..783802,790051..790239,793195..793379,
FT                   794455..794481,794590..794885)
FT                   /codon_start=1
FT                   /gene="UNC84A"
FT                   /locus_tag="hCG_1812059"
FT                   /product="unc-84 homolog A (C. elegans), isoform CRA_b"
FT                   /note="gene_id=hCG1812059.2 transcript_id=hCT2271243.1
FT                   protein_id=hCP1787777.1 isoform=CRA_b"
FT                   /protein_id="EAW87175.1"
FT                   /translation="MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPV
FT                   FDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSI
FT                   NHVSRQVTSSGVSYGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNK
FT                   AAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKCKS
FT                   QSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP"
FT   assembly_gap    827812..827831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            827832..847067
FT                   /gene="C7orf20"
FT                   /locus_tag="hCG_1747708"
FT                   /note="gene_id=hCG1747708.2"
FT   mRNA            join(827832..827860,837112..837190,837625..837706,
FT                   838426..838575,841585..841723,842935..843075,
FT                   844373..844448,844532..844604,845967..847067)
FT                   /gene="C7orf20"
FT                   /locus_tag="hCG_1747708"
FT                   /product="chromosome 7 open reading frame 20, transcript
FT                   variant hCT1786064"
FT                   /note="gene_id=hCG1747708.2 transcript_id=hCT1786064.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(827832..827860,837112..837190,837625..837706,
FT                   838426..838575,841585..841723,842935..843075,
FT                   844373..844448,844532..844604,845967..846236,
FT                   846914..847066)
FT                   /gene="C7orf20"
FT                   /locus_tag="hCG_1747708"
FT                   /product="chromosome 7 open reading frame 20, transcript
FT                   variant hCT1955831"
FT                   /note="gene_id=hCG1747708.2 transcript_id=hCT1955831.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             join(827838..827860,837112..837190,837625..837706,
FT                   838426..838575,841585..841723,842935..843075,
FT                   844373..844448,844532..844604,845967..846055)
FT                   /codon_start=1
FT                   /gene="C7orf20"
FT                   /locus_tag="hCG_1747708"
FT                   /product="chromosome 7 open reading frame 20, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1747708.2 transcript_id=hCT1955831.1
FT                   protein_id=hCP1763163.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R847"
FT                   /protein_id="EAW87179.1"
FT                   /translation="MYRTLFFRYMSQSKHTEARELMYSGALLFFSHGQQNSAADLSMLV
FT                   LESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKLGHPRLHQL
FT                   LALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLK
FT                   NKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSL
FT                   RRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIE
FT                   LD"
FT   CDS             join(827838..827860,837112..837190,837625..837706,
FT                   838426..838575,841585..841723,842935..843075,
FT                   844373..844448,844532..844604,845967..846055)
FT                   /codon_start=1
FT                   /gene="C7orf20"
FT                   /locus_tag="hCG_1747708"
FT                   /product="chromosome 7 open reading frame 20, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1747708.2 transcript_id=hCT1786064.1
FT                   protein_id=hCP1706005.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R847"
FT                   /protein_id="EAW87180.1"
FT                   /translation="MYRTLFFRYMSQSKHTEARELMYSGALLFFSHGQQNSAADLSMLV
FT                   LESLEKAEVEVADELLENLAKVFSLMDPNSPERVTFVSRALKWSSGGSGKLGHPRLHQL
FT                   LALTLWKEQNYCESRYHFLHSADGEGCANMLVEYSTSRGFRSEVDMFVAQAVLQFLCLK
FT                   NKSSASVVFTTYTQKHPSIEDGPPFVEPLLNFIWFLLLAVDGGKLTVFTVLCEQYQPSL
FT                   RRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIE
FT                   LD"
FT   gene            complement(<833387..>834919)
FT                   /locus_tag="hCG_1993351"
FT                   /note="gene_id=hCG1993351.0"
FT   mRNA            complement(join(<833387..833500,833625..833791,
FT                   834345..834418,834819..>834919))
FT                   /locus_tag="hCG_1993351"
FT                   /product="hCG1993351"
FT                   /note="gene_id=hCG1993351.0 transcript_id=hCT2272376.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<833387..833500,833625..833791,
FT                   834345..834418,834819..834919))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993351"
FT                   /product="hCG1993351"
FT                   /note="gene_id=hCG1993351.0 transcript_id=hCT2272376.0
FT                   protein_id=hCP1787709.0"
FT                   /protein_id="EAW87181.1"
FT                   /translation="MPVTGKPSKAALNVDGFSSCTGEFWKLRRILVSRRKLACAFSCQG
FT                   HVKDEEEILKTHTGRSLEKAGDDHNPRHPRGKVGRPQPAPSPGQGRPPTTRAIPGARSA
FT                   AHNPRHPWSKRNHTNQELLPDFCGAHIQGHQPAGFPIPSLSFTFNCCG"
FT   gene            complement(848533..904541)
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /note="gene_id=hCG1747709.2"
FT   mRNA            complement(join(848533..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878243,886974..887104,904171..904541))
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, transcript variant
FT                   hCT1786065"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT1786065.2;
FT                   splice donor-acceptor pairs covered / total pairs = 9/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(848533..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878243,886974..887104,904175..904524))
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, transcript variant
FT                   hCT2272373"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT2272373.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(848533..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878243,886974..887104,904171..904269,
FT                   904379..904438))
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, transcript variant
FT                   hCT1955832"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT1955832.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/11;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(849554..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878243,886974..887104,904171..904269,
FT                   904379..904397))
FT                   /codon_start=1
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, isoform CRA_a"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT1955832.1
FT                   protein_id=hCP1763160.1 isoform=CRA_a"
FT                   /protein_id="EAW87182.1"
FT                   /translation="MRNRRAGASRPWPRSGAGRSWSCCSGRGTRAARTAAPRVDPDWAS
FT                   YTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSF
FT                   YYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKF
FT                   VLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFI
FT                   YHEDGKEIVDWFNALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEG
FT                   FRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIV
FT                   TPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVEAHFKHKP"
FT   CDS             complement(join(849554..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878243,886974..887104,904175..904256))
FT                   /codon_start=1
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, isoform CRA_b"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT2272373.0
FT                   protein_id=hCP1787701.0 isoform=CRA_b"
FT                   /db_xref="GOA:O75689"
FT                   /db_xref="HGNC:HGNC:16486"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="PDB:3FEH"
FT                   /db_xref="PDB:3FM8"
FT                   /db_xref="PDB:3LJU"
FT                   /db_xref="PDB:3MDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75689"
FT                   /protein_id="EAW87183.1"
FT                   /translation="MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCS
FT                   GIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLL
FT                   REQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYF
FT                   NRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWF
FT                   NALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRR
FT                   LMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACET
FT                   ESDQREWVAAFQKAVDRPMLPQEYAVEAHFKHKP"
FT   CDS             complement(join(849554..849582,849666..849894,
FT                   850052..850123,850735..850797,851166..851249,
FT                   854915..855061,855849..855961,871565..871647,
FT                   878152..878240))
FT                   /codon_start=1
FT                   /gene="CENTA1"
FT                   /locus_tag="hCG_1747709"
FT                   /product="centaurin, alpha 1, isoform CRA_c"
FT                   /note="gene_id=hCG1747709.2 transcript_id=hCT1786065.2
FT                   protein_id=hCP1706008.2 isoform=CRA_c"
FT                   /db_xref="GOA:O75689"
FT                   /db_xref="HGNC:HGNC:16486"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="PDB:3FEH"
FT                   /db_xref="PDB:3FM8"
FT                   /db_xref="PDB:3LJU"
FT                   /db_xref="PDB:3MDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75689"
FT                   /protein_id="EAW87184.1"
FT                   /translation="MASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQE
FT                   FIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMK
FT                   IEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQV
FT                   AFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFAR
FT                   GEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQK
FT                   AVDRPMLPQEYAVEAHFKHKP"
FT   gene            complement(917423..925311)
FT                   /gene="LOC90639"
FT                   /locus_tag="hCG_1647941"
FT                   /note="gene_id=hCG1647941.3"
FT   mRNA            complement(join(917423..919233,922958..923069,
FT                   925205..925311))
FT                   /gene="LOC90639"
FT                   /locus_tag="hCG_1647941"
FT                   /product="hypothetical protein LOC90639"
FT                   /note="gene_id=hCG1647941.3 transcript_id=hCT1648068.3;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(917826..918302)
FT                   /codon_start=1
FT                   /gene="LOC90639"
FT                   /locus_tag="hCG_1647941"
FT                   /product="hypothetical protein LOC90639"
FT                   /note="gene_id=hCG1647941.3 transcript_id=hCT1648068.3
FT                   protein_id=hCP1620824.3"
FT                   /protein_id="EAW87185.1"
FT                   /translation="MERRCLHIWGLSQTCLLPRHCRKGAGSCLVSGGWWQETGWGGPGH
FT                   VLSGDPGSGCLQALAGGATNLADLRLWETGCPRPSACGWLRLLSPSPVLCSKGPLFLSC
FT                   SGGPFVVKHVPPLLTELSTYCGWARPTLCPCTHGFYHLIRLQLSLSRVCSLSGL"
FT   gene            932975..939398
FT                   /gene="CYP2W1"
FT                   /locus_tag="hCG_1747710"
FT                   /note="gene_id=hCG1747710.1"
FT   mRNA            join(932975..933161,934189..934351,934727..934876,
FT                   934943..935100,936401..936574,936884..937022,
FT                   937124..937308,938031..939398)
FT                   /gene="CYP2W1"
FT                   /locus_tag="hCG_1747710"
FT                   /product="cytochrome P450, family 2, subfamily W,
FT                   polypeptide 1, transcript variant hCT1786066"
FT                   /note="gene_id=hCG1747710.1 transcript_id=hCT1786066.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(932975..933161,934189..934351,934727..934876,
FT                   934943..935100,936401..936574,936884..937022,
FT                   937124..937308,938031..938172,938389..939394)
FT                   /gene="CYP2W1"
FT                   /locus_tag="hCG_1747710"
FT                   /product="cytochrome P450, family 2, subfamily W,
FT                   polypeptide 1, transcript variant hCT2356923"
FT                   /note="gene_id=hCG1747710.1 transcript_id=hCT2356923.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   CDS             join(932988..933161,934189..934351,934727..934876,
FT                   934943..935100,936401..936574,936884..937022,
FT                   937124..937308,938031..938172,938389..938576)
FT                   /codon_start=1
FT                   /gene="CYP2W1"
FT                   /locus_tag="hCG_1747710"
FT                   /product="cytochrome P450, family 2, subfamily W,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=hCG1747710.1 transcript_id=hCT2356923.0
FT                   protein_id=hCP1922126.0 isoform=CRA_b"
FT                   /protein_id="EAW87187.1"
FT                   /translation="MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLH
FT                   LLRLSQQDRSLMELSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRPPIAI
FT                   FQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRG
FT                   RPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQLFNVYPW
FT                   LGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGLF
FT                   AEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLED
FT                   QQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQW
FT                   QTPGQFNPGHFLDANGHFVKREAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLP
FT                   PPGVSPASLDTTPARAFTMRPRAQALCAVLRP"
FT   CDS             join(932988..933161,934189..934351,934727..934876,
FT                   934943..935100,936401..936574,936884..937022,
FT                   937124..937308,938031..938282)
FT                   /codon_start=1
FT                   /gene="CYP2W1"
FT                   /locus_tag="hCG_1747710"
FT                   /product="cytochrome P450, family 2, subfamily W,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=hCG1747710.1 transcript_id=hCT1786066.1
FT                   protein_id=hCP1706009.2 isoform=CRA_a"
FT                   /protein_id="EAW87186.1"
FT                   /translation="MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLH
FT                   LLRLSQQDRSLMELSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRPPIAI
FT                   FQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRG
FT                   RPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLGSPGLQLFNVYPW
FT                   LGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGLF
FT                   AEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLED
FT                   QQALPYTSAVLHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQW
FT                   QTPGQFNPGHFLDANGHFVKREAFLPFSAGQQPSGPGWGGTSRAPGVGRPQLRLPPLHP
FT                   PPDLRF"
FT   gene            complement(946660..>1086342)
FT                   /gene="MGC11257"
FT                   /locus_tag="hCG_1747713"
FT                   /note="gene_id=hCG1747713.2"
FT   mRNA            complement(join(946660..947477,950143..950224,
FT                   959639..959832,1059018..1059151,1076504..1076633,
FT                   1086273..>1086342))
FT                   /gene="MGC11257"
FT                   /locus_tag="hCG_1747713"
FT                   /product="hypothetical protein MGC11257, transcript variant
FT                   hCT1786069"
FT                   /note="gene_id=hCG1747713.2 transcript_id=hCT1786069.2;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(946679..947123,947204..947477,
FT                   950143..950224,959639..959832,1059018..1059151,
FT                   1076504..1076633,1086273..>1086342))
FT                   /gene="MGC11257"
FT                   /locus_tag="hCG_1747713"
FT                   /product="hypothetical protein MGC11257, transcript variant
FT                   hCT2272445"
FT                   /note="gene_id=hCG1747713.2 transcript_id=hCT2272445.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(947298..947477,950143..950224,
FT                   959639..959832,1059018..>1059035))
FT                   /codon_start=1
FT                   /gene="MGC11257"
FT                   /locus_tag="hCG_1747713"
FT                   /product="hypothetical protein MGC11257, isoform CRA_a"
FT                   /note="gene_id=hCG1747713.2 transcript_id=hCT2272445.0
FT                   protein_id=hCP1787688.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R836"
FT                   /protein_id="EAW87188.1"
FT                   /translation="FFYWIKGEAVLRPGLDAEPELSPEEQRVLERKLKKERKKEERQRL
FT                   REAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEHF
FT                   STLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS"
FT   CDS             complement(join(947298..947477,950143..950224,
FT                   959639..959832,1059018..>1059035))
FT                   /codon_start=1
FT                   /gene="MGC11257"
FT                   /locus_tag="hCG_1747713"
FT                   /product="hypothetical protein MGC11257, isoform CRA_a"
FT                   /note="gene_id=hCG1747713.2 transcript_id=hCT1786069.2
FT                   protein_id=hCP1706007.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R836"
FT                   /protein_id="EAW87189.1"
FT                   /translation="FFYWIKGEAVLRPGLDAEPELSPEEQRVLERKLKKERKKEERQRL
FT                   REAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKTRQTWLLLHMYDSDKVPDEHF
FT                   STLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS"
FT   gene            complement(976140..>978324)
FT                   /locus_tag="hCG_1993407"
FT                   /note="gene_id=hCG1993407.0"
FT   mRNA            complement(join(976140..977002,978232..>978324))
FT                   /locus_tag="hCG_1993407"
FT                   /product="hCG1993407"
FT                   /note="gene_id=hCG1993407.0 transcript_id=hCT2272454.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(976952..977002,978232..>978324))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993407"
FT                   /product="hCG1993407"
FT                   /note="gene_id=hCG1993407.0 transcript_id=hCT2272454.0
FT                   protein_id=hCP1787687.0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8TAS9"
FT                   /protein_id="EAW87190.1"
FT                   /translation="AAGGAGRAVRTAGASLPRRRPCPRDLTAGSEAPARRVLCLRAQVT
FT                   SG"
FT   gene            1005137..1009050
FT                   /locus_tag="hCG_1747714"
FT                   /note="gene_id=hCG1747714.3"
FT   mRNA            join(1005137..1005272,1005893..1006618,1007281..1009050)
FT                   /locus_tag="hCG_1747714"
FT                   /product="hCG1747714, transcript variant hCT1786070"
FT                   /note="gene_id=hCG1747714.3 transcript_id=hCT1786070.3;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 21-APR-2003"
FT   mRNA            join(1005137..1005272,1007281..1009050)
FT                   /locus_tag="hCG_1747714"
FT                   /product="hCG1747714, transcript variant hCT2271259"
FT                   /note="gene_id=hCG1747714.3 transcript_id=hCT2271259.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 21-APR-2003"
FT   CDS             join(1006589..1006618,1007281..1008306)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1747714"
FT                   /product="hCG1747714, isoform CRA_b"
FT                   /note="gene_id=hCG1747714.3 transcript_id=hCT1786070.3
FT                   protein_id=hCP1706010.2 isoform=CRA_b"
FT                   /protein_id="EAW87192.1"
FT                   /translation="MVDIRLPEIAGRGASPAAMWSCSWFNGTGLVEELPACQDLQLGLS
FT                   LLSLLGLVVGVPVGLCYNALLVLANLHSKASMTMPDVYFVNMAVAGLVLSALAPVHLLG
FT                   PPSSRWALWSVGGEVHVALQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMASVYNTR
FT                   HVCGFVWGGALLTSFSSLLFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALATL
FT                   YALVLLSRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRG
FT                   KPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCS
FT                   PDHMGVQQVLA"
FT   CDS             1007305..1008306
FT                   /codon_start=1
FT                   /locus_tag="hCG_1747714"
FT                   /product="hCG1747714, isoform CRA_a"
FT                   /note="gene_id=hCG1747714.3 transcript_id=hCT2271259.1
FT                   protein_id=hCP1787738.0 isoform=CRA_a"
FT                   /db_xref="GOA:A4D2Q3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A4D2Q3"
FT                   /protein_id="EAW87191.1"
FT                   /translation="MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYN
FT                   ALLVLANLHSKASMTMPDVYFVNMAVAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVA
FT                   LQIPFNVSSLVAMYSTALLSLDHYIERALPRTYMASVYNTRHVCGFVWGGALLTSFSSL
FT                   LFYICSHVSTRALECAKMQNAEAADATLVFIGYVVPALATLYALVLLSRVRREDTPLDR
FT                   DTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDFS
FT                   KLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA"
FT   gene            <1030597..1031856
FT                   /locus_tag="hCG_2041866"
FT                   /note="gene_id=hCG2041866.0"
FT   mRNA            join(<1030597..1030657,1031616..1031856)
FT                   /locus_tag="hCG_2041866"
FT                   /product="hCG2041866"
FT                   /note="gene_id=hCG2041866.0 transcript_id=hCT2347097.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<1030601..1030657,1031616..1031840)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041866"
FT                   /product="hCG2041866"
FT                   /note="gene_id=hCG2041866.0 transcript_id=hCT2347097.0
FT                   protein_id=hCP1910788.0"
FT                   /protein_id="EAW87193.1"
FT                   /translation="EPLGLGPAPRPTLHELPLRVARPGYDRTGEQGGPRERGQHLTATS
FT                   TNAAPQEHALPHKAPAADSRREGTSGQPHAAFRPAVHVKRILFPICLN"
FT   gene            1036554..1044123
FT                   /gene="GPR30"
FT                   /locus_tag="hCG_1642447"
FT                   /note="gene_id=hCG1642447.3"
FT   mRNA            join(1036554..1036922,1041057..1044123)
FT                   /gene="GPR30"
FT                   /locus_tag="hCG_1642447"
FT                   /product="G protein-coupled receptor 30, transcript variant
FT                   hCT1642574"
FT                   /note="gene_id=hCG1642447.3 transcript_id=hCT1642574.3;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1037802..1037999,1041057..1044123)
FT                   /gene="GPR30"
FT                   /locus_tag="hCG_1642447"
FT                   /product="G protein-coupled receptor 30, transcript variant
FT                   hCT1961765"
FT                   /note="gene_id=hCG1642447.3 transcript_id=hCT1961765.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             1041379..1042506
FT                   /codon_start=1
FT                   /gene="GPR30"
FT                   /locus_tag="hCG_1642447"
FT                   /product="G protein-coupled receptor 30, isoform CRA_a"
FT                   /note="gene_id=hCG1642447.3 transcript_id=hCT1642574.3
FT                   protein_id=hCP1622651.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q99527"
FT                   /db_xref="HGNC:HGNC:4485"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99527"
FT                   /protein_id="EAW87194.1"
FT                   /translation="MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANG
FT                   TGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVA
FT                   DLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAM
FT                   RCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLG
FT                   FIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISV
FT                   HLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIE
FT                   QKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV"
FT   CDS             1041379..1042506
FT                   /codon_start=1
FT                   /gene="GPR30"
FT                   /locus_tag="hCG_1642447"
FT                   /product="G protein-coupled receptor 30, isoform CRA_a"
FT                   /note="gene_id=hCG1642447.3 transcript_id=hCT1961765.1
FT                   protein_id=hCP1774419.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R849"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R849"
FT                   /protein_id="EAW87195.1"
FT                   /translation="MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANG
FT                   TGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVA
FT                   DLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAM
FT                   RCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLG
FT                   FIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISV
FT                   HLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIE
FT                   QKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV"
FT   gene            complement(1098398..1105388)
FT                   /gene="ZFAND2A"
FT                   /locus_tag="hCG_1744855"
FT                   /note="gene_id=hCG1744855.2"
FT   mRNA            complement(join(1098398..1098715,1100944..1101075,
FT                   1102955..1103049,1103457..1103556,1105164..1105388))
FT                   /gene="ZFAND2A"
FT                   /locus_tag="hCG_1744855"
FT                   /product="zinc finger, AN1-type domain 2A, transcript
FT                   variant hCT1783095"
FT                   /note="gene_id=hCG1744855.2 transcript_id=hCT1783095.2;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(<1098399..1098732,1100944..1101075,
FT                   1102955..1103049,1103457..1103556,1105164..1105354))
FT                   /gene="ZFAND2A"
FT                   /locus_tag="hCG_1744855"
FT                   /product="zinc finger, AN1-type domain 2A, transcript
FT                   variant hCT2356895"
FT                   /note="gene_id=hCG1744855.2 transcript_id=hCT2356895.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(<1098399..1098732,1100944..1101075,
FT                   1102955..1103049,1103457..1103511))
FT                   /codon_start=1
FT                   /gene="ZFAND2A"
FT                   /locus_tag="hCG_1744855"
FT                   /product="zinc finger, AN1-type domain 2A, isoform CRA_b"
FT                   /note="gene_id=hCG1744855.2 transcript_id=hCT2356895.0
FT                   protein_id=hCP1922125.0 isoform=CRA_b"
FT                   /db_xref="GOA:A8MYA3"
FT                   /db_xref="HGNC:HGNC:28073"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniProtKB/TrEMBL:A8MYA3"
FT                   /protein_id="EAW87197.1"
FT                   /translation="MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCP
FT                   FAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKSLCSLRFLHT
FT                   VAQKRAARRKRCCRWYVPNVTATSVSSTDTLWTTAADTGVAPPSKLGEKRLRCDGSEHA
FT                   VACVEAAYTLVGSGAPLSTIPHWLLILFVEGDGTIIKLNAEV"
FT   CDS             complement(join(1098560..1098715,1100944..1101075,
FT                   1102955..1103049,1103457..1103511))
FT                   /codon_start=1
FT                   /gene="ZFAND2A"
FT                   /locus_tag="hCG_1744855"
FT                   /product="zinc finger, AN1-type domain 2A, isoform CRA_a"
FT                   /note="gene_id=hCG1744855.2 transcript_id=hCT1783095.2
FT                   protein_id=hCP1724575.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8N6M9"
FT                   /db_xref="HGNC:HGNC:28073"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N6M9"
FT                   /protein_id="EAW87196.1"
FT                   /translation="MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCP
FT                   FAFQKDVHVPVCPLCNTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEG
FT                   CKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG"
FT   gene            1105416..1109801
FT                   /locus_tag="hCG_1817675"
FT                   /note="gene_id=hCG1817675.1"
FT   mRNA            join(1105416..1106026,1107552..1107743,1107965..1108087,
FT                   1108648..1108691,1109357..1109801)
FT                   /locus_tag="hCG_1817675"
FT                   /product="hCG1817675"
FT                   /note="gene_id=hCG1817675.1 transcript_id=hCT1960040.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(1105948..1106026,1107552..1107743,1107965..1107990)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1817675"
FT                   /product="hCG1817675"
FT                   /note="gene_id=hCG1817675.1 transcript_id=hCT1960040.1
FT                   protein_id=hCP1770511.1"
FT                   /protein_id="EAW87198.1"
FT                   /translation="MWPRGVGSAQGRGHCTERPARKGLRLENSRAVKRAGPHQLHGGGD
FT                   WLHLAVPPNHTTSPLEGSAQARTPTFQDVWVSAGPPPWPHRSPWTGRDGVSPC"
FT   gene            <1177210..>1181167
FT                   /locus_tag="hCG_1642481"
FT                   /note="gene_id=hCG1642481.3"
FT   mRNA            join(<1177210..1177483,1177712..1177887,1180025..>1181167)
FT                   /locus_tag="hCG_1642481"
FT                   /product="hCG1642481"
FT                   /note="gene_id=hCG1642481.3 transcript_id=hCT1642608.3;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             join(1177210..1177483,1177712..1177887,1180025..>1181167)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642481"
FT                   /product="hCG1642481"
FT                   /note="gene_id=hCG1642481.3 transcript_id=hCT1642608.3
FT                   protein_id=hCP1612582.3"
FT                   /protein_id="EAW87199.1"
FT                   /translation="MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAA
FT                   AAASVPFSIDGLLGGSCAAAASVVNPTPLLPAACGVGGDGQPFKLSDSGDPDKESPGCK
FT                   RRRTRTNFTGWQLEELEKAFNESHYSDVFMREALALRLDLVESRVQVWFQNRRAKWRKK
FT                   ENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQGRHLHSP
FT                   GGLSLHSAPSSDSDSGGGGLSPEPPEPPPPAAKGPGAHASGAAGTAPAPPGEPPAPGTC
FT                   DPAFYPSQRSGAGPQPRPGRPADKDAASCGPGAAVAAVERGAAGLPKASPFSVESLLSD
FT                   SPPRRKAASNAAAAAAAGLDFAPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGG
FT                   AGLEPAPKDAPPAPAVPPAPPAQASFGAFSGPGGAPDSAFARRSPDAVASPGAPAPAPA
FT                   PFRDLASAAATEGGGGDCADAGTAGPAPPPPAPSPRPGPRPPSPAEEPATCGVPEPGAA
FT                   AGPSPPEGEELDMD"
FT   assembly_gap    1211378..1211526
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1217608..1220223
FT                   /estimated_length=2616
FT                   /gap_type="unknown"
FT   assembly_gap    1242427..1242446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1280452..1280826
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    1325970..1327063
FT                   /estimated_length=1094
FT                   /gap_type="unknown"
FT   assembly_gap    1337431..1337450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1352332..1352364
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    1363227..1364176
FT                   /estimated_length=950
FT                   /gap_type="unknown"
FT   assembly_gap    1368466..1368485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1382669..1408879)
FT                   /gene="MICAL-L2"
FT                   /locus_tag="hCG_17709"
FT                   /note="gene_id=hCG17709.3"
FT   mRNA            complement(join(1382669..1382976,1383405..1383451,
FT                   1385046..1385160,1385839..1385912,1386194..1386284,
FT                   1386401..1386524,1386593..1386657,1387144..1387299,
FT                   1388231..1388391,1388897..1388990,1390498..1390790,
FT                   1392958..1393656,1408650..1408879))
FT                   /gene="MICAL-L2"
FT                   /locus_tag="hCG_17709"
FT                   /product="MICAL-like 2, transcript variant hCT8762"
FT                   /note="gene_id=hCG17709.3 transcript_id=hCT8762.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(1382670..1382976,1383405..1383451,
FT                   1385046..1385160,1385839..1385912,1386194..1386284,
FT                   1386401..1386524,1386593..1386657,1387144..1387299,
FT                   1388231..1388391,1388897..1388990,1390498..1390790,
FT                   1392958..1393734,1396068..1396183,1396930..1397120,
FT                   1398038..1398179,1399645..1399693,1408590..1408856))
FT                   /gene="MICAL-L2"
FT                   /locus_tag="hCG_17709"
FT                   /product="MICAL-like 2, transcript variant hCT2356924"
FT                   /note="gene_id=hCG17709.3 transcript_id=hCT2356924.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(1382900..1382976,1383405..1383451,
FT                   1385046..1385160,1385839..1385912,1386194..1386284,
FT                   1386401..1386524,1386593..1386657,1387144..1387299,
FT                   1388231..1388391,1388897..1388990,1390498..1390790,
FT                   1392958..1393656,1408650..1408732))
FT                   /codon_start=1
FT                   /gene="MICAL-L2"
FT                   /locus_tag="hCG_17709"
FT                   /product="MICAL-like 2, isoform CRA_a"
FT                   /note="gene_id=hCG17709.3 transcript_id=hCT8762.3
FT                   protein_id=hCP33709.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q8IY33"
FT                   /db_xref="HGNC:HGNC:29672"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR022735"
FT                   /db_xref="InterPro:IPR029936"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IY33"
FT                   /protein_id="EAW87200.1"
FT                   /translation="MAAIRALQQWCRQQCEGYRDVNICNMTTHLPAAASASPKLTGLVP
FT                   RQPGAMGVDSRTSCSPQKAQEANKARPSAWEPAAGNSPARASVPAAPNPAATSATSVHV
FT                   RSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPAT
FT                   PQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSG
FT                   RGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQA
FT                   SPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGS
FT                   RPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLKPKEPRA
FT                   LAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVP
FT                   ASLDVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVR
FT                   LHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDSLMVDWFWLIHEK
FT                   QLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQELLEQYVST
FT                   VNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKSSPSQ"
FT   CDS             complement(join(1382900..1382976,1383405..1383451,
FT                   1385046..1385160,1385839..1385912,1386194..1386284,
FT                   1386401..1386524,1386593..1386657,1387144..1387299,
FT                   1388231..1388391,1388897..1388990,1390498..1390790,
FT                   1392958..1393734,1396068..1396183,1396930..1397120,
FT                   1398038..1398179,1399645..1399693,1408590..1408732))
FT                   /codon_start=1
FT                   /gene="MICAL-L2"
FT                   /locus_tag="hCG_17709"
FT                   /product="MICAL-like 2, isoform CRA_b"
FT                   /note="gene_id=hCG17709.3 transcript_id=hCT2356924.0
FT                   protein_id=hCP1922128.0 isoform=CRA_b"
FT                   /protein_id="EAW87201.1"
FT                   /translation="MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRP
FT                   DLINFSALKKENIYENNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYN
FT                   YFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAKLPSPAPARKPPLSPAQTNPVVQR
FT                   RNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTL
FT                   HSGAYKATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEANK
FT                   ARPSAWEPAAGNSPARASVPAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRV
FT                   TNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAA
FT                   TVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQ
FT                   ALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPP
FT                   APLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSL
FT                   QEGQEDGPAGWRANLKPVDRRSPAERTLKPKEPRALAEPRAGEAPRKVSGSFAGSVHIT
FT                   LTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSW
FT                   KEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDA
FT                   LELRGVELEKRLRAAEGDDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQL
FT                   DIEGELRRLMAKPEALKSLQERRREQELLEQYVSTVNDRSDIVDSLDEDRLREQEEDQM
FT                   LRDMIEKLGLQRKKSKFRLSKIWSPKSKSSPSQ"
FT   assembly_gap    1394604..1395929
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   assembly_gap    1397482..1397699
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    1398953..1398972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1417735..1453835)
FT                   /locus_tag="hCG_1993380"
FT                   /note="gene_id=hCG1993380.0"
FT   mRNA            complement(join(<1417735..1417899,1431183..1431325,
FT                   1431957..1432118,1433153..1433264,1441648..>1441689))
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, transcript variant hCT2272418"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272418.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1417735..1417899,1431183..1431325,
FT                   1431957..1432118,1433153..1433264,1441648..1441689))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, isoform CRA_d"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272418.0
FT                   protein_id=hCP1787660.0 isoform=CRA_d"
FT                   /protein_id="EAW87205.1"
FT                   /translation="MSAASAPLLTDGAASESQDQVFLRWSSGETATMHILVVHAMVILL
FT                   TLGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVD
FT                   AGPLERPPTPGDGAHTAAIQGARWSRHAAPLCGPRSRVGSPSPRGPGSQVQHPSCVAAS
FT                   PPARSHPYPMLHPLWAPGEPPPGWLSTPHSPEPAAASPASGPLLS"
FT   mRNA            complement(join(1419310..1420099,1420253..1420362,
FT                   1420540..1420631,1420978..1421048,1421680..1421793,
FT                   1422479..1422591,1422973..1423100,1423575..1423767,
FT                   1424114..1424247,1425357..1425480,1425638..1425864,
FT                   1425975..1426066,1426203..1426327,1426959..1427082,
FT                   1427162..1427345,1427775..1427915,1428135..1428295,
FT                   1428841..1429095,1429728..1429852,1430246..1430344,
FT                   1430753..1430899,1431957..1432118,1433153..1433264,
FT                   1433414..1433581,1434509..1434613,1434701..1434880,
FT                   1436036..1436185,1436333..1436512,1436731..1436860,
FT                   1437171..1437368,1438806..1438866,1439053..1439144,
FT                   1442472..1442568,1443216..1443373,1444278..1444355,
FT                   1444895..1445015,1445618..1445726,1446600..1446776,
FT                   1447874..1448015,1448169..1448314,1448437..1448623,
FT                   1448717..1448822,1448935..1449094,1449346..1449483,
FT                   1449632..1449828,1452363..1452653,1453365..1453463,
FT                   1453785..1453835))
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, transcript variant hCT2272416"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272416.0;
FT                   splice donor-acceptor pairs covered / total pairs = 47/47;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1419310..1420099,1420253..1420362,
FT                   1420540..1420631,1420978..1421048,1421680..1421793,
FT                   1422479..1422591,1422973..1423100,1423575..1423767,
FT                   1424114..1424247,1425357..1425480,1425638..1425861,
FT                   1425975..1426066,1426203..1426327,1426959..1427082,
FT                   1427162..1427345,1427775..1427915,1428135..1428295,
FT                   1428831..1429095,1429728..1429852,1430246..1430344,
FT                   1430666..1430899,1431957..1432118,1433153..1433264,
FT                   1433414..1433581,1434509..1434613,1434701..1434880,
FT                   1436036..1436185,1436333..1436512,1436731..1436860,
FT                   1437171..1437368,1438806..1438866,1439053..1439144,
FT                   1442472..1442568,1443216..1443373,1444278..1444355,
FT                   1444895..1445015,1445618..1445726,1446600..1446776,
FT                   1447874..1448015,1448169..1448314,1448437..1448623,
FT                   1448717..1448822,1448935..1449094,1449346..1449483,
FT                   1449632..1449828,1452363..1452653,1453365..1453463,
FT                   1453785..1453835))
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, transcript variant hCT2272417"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272417.0;
FT                   splice donor-acceptor pairs covered / total pairs = 45/47;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1419310..1420099,1420253..1420362,
FT                   1420540..1420631,1420978..1421048,1421680..1421791,
FT                   1422475..1422591,1422973..1423100,1423575..1423767,
FT                   1424114..1424247,1425357..1425480,1425638..1425864,
FT                   1426203..1426327,1426959..1427082,1427162..1427345,
FT                   1427775..1427915,1428135..1428295,1428841..1429095,
FT                   1429728..1429852,1430246..1430344,1430753..1430899,
FT                   1431957..1432118,1433153..1433581,1434509..1434613,
FT                   1434701..1434880,1436036..1436185,1436333..1436512,
FT                   1436731..1436860,1437171..1437368,1438806..1438866,
FT                   1439053..1439144,1442472..1442568,1443216..1443373,
FT                   1444278..1444355,1444895..1445015,1445618..1445726,
FT                   1446600..1446776,1447874..1448015,1448169..1448314,
FT                   1448437..1448623,1448717..1448822,1448935..1449094,
FT                   1449346..1449483,1449632..1449828,1452363..1452653,
FT                   1453365..1453463,1453785..1453835))
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, transcript variant hCT2272419"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272419.0;
FT                   splice donor-acceptor pairs covered / total pairs = 44/45;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1428137..1428295,1428841..1429095,
FT                   1429728..1429852,1430246..1430344,1430753..1430899,
FT                   1431957..1432118,1433153..1433264,1433414..1433581,
FT                   1434509..1434613,1434701..1434880,1436036..1436185,
FT                   1436333..1436512,1436731..1436860,1437171..1437368,
FT                   1438806..1438866,1439053..1439144,1442472..1442568,
FT                   1443216..1443373,1444278..1444355,1444895..1445015,
FT                   1445618..1445726,1446600..1446776,1447874..1448015,
FT                   1448169..1448314,1448437..1448623,1448717..1448822,
FT                   1448935..1449094,1449346..1449483,1449632..1449828,
FT                   1452363..1452653,1453365..1453422))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, isoform CRA_e"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272416.0
FT                   protein_id=hCP1787659.0 isoform=CRA_e"
FT                   /protein_id="EAW87206.1"
FT                   /translation="MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTL
FT                   LKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAIS
FT                   PSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLS
FT                   LMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENW
FT                   PEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGA
FT                   GSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRR
FT                   QPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHG
FT                   SEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNN
FT                   MQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCL
FT                   GLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLR
FT                   SFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESD
FT                   RNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVL
FT                   KVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIG
FT                   LAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGH
FT                   LAAASTKQTITESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRN
FT                   PDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVLPVQCLCEFLLHDAVDDAASGEEDDE
FT                   GESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKADEQTTCEVLDYFLRRLGSSQVASRVL
FT                   AMKGLSLVLSEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTAL
FT                   ALQQAIHMETDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKL
FT                   SPSAASDAVLSALLSIFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILV
FT                   VHAMVILLTLGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIR
FT                   SEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKN
FT                   YMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTEAPKPKSSPEQPIGQGRIRVGTQL
FT                   RVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALALQQALGQELARVVQGSPEVPGIT
FT                   VRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQLCQYQRCVPQVHRLLLALPEGAP
FT                   ADAAVAGQPWRGGRAPAGTAQDACQPGLSRAQAQ"
FT   CDS             complement(join(1428252..1428295,1428831..1429095,
FT                   1429728..1429852,1430246..1430344,1430666..1430899,
FT                   1431957..1432118,1433153..1433264,1433414..1433581,
FT                   1434509..1434613,1434701..1434880,1436036..1436185,
FT                   1436333..1436512,1436731..1436860,1437171..1437368,
FT                   1438806..1438866,1439053..1439144,1442472..1442568,
FT                   1443216..1443373,1444278..1444355,1444895..1445015,
FT                   1445618..1445726,1446600..1446776,1447874..1448015,
FT                   1448169..1448314,1448437..1448623,1448717..1448822,
FT                   1448935..1449094,1449346..1449483,1449632..1449828,
FT                   1452363..1452653,1453365..1453422))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, isoform CRA_b"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272417.0
FT                   protein_id=hCP1787656.0 isoform=CRA_b"
FT                   /protein_id="EAW87203.1"
FT                   /translation="MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTL
FT                   LKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAIS
FT                   PSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLS
FT                   LMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENW
FT                   PEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGA
FT                   GSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRR
FT                   QPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHG
FT                   SEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNN
FT                   MQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCL
FT                   GLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLR
FT                   SFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESD
FT                   RNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVL
FT                   KVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIG
FT                   LAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGH
FT                   LAAASTKQTITESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRN
FT                   PDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVLPVQCLCEFLLHDAVDDAASGEEDDE
FT                   GESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKADEQTTCEVLDYFLRRLGSSQVASRVL
FT                   AMKGLSLVLSEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTAL
FT                   ALQQAIHMETDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKL
FT                   SPSAASDAVLSALLSIFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILV
FT                   VHAMVILLTLGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIR
FT                   SEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKS
FT                   KMPGTCGVGSHTLTEPQPGQAFGAWVRADYMAHLVEVQHERGASGGQTFHSLLTASLPP
FT                   RRDSTEAPKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSP
FT                   RPVALALQQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLA
FT                   CPLLRQLCQYQVLGPLCATGTPASPRSS"
FT   CDS             complement(join(1433384..1433581,1434509..1434613,
FT                   1434701..1434880,1436036..1436185,1436333..1436512,
FT                   1436731..1436860,1437171..1437368,1438806..1438866,
FT                   1439053..1439144,1442472..1442568,1443216..1443373,
FT                   1444278..1444355,1444895..1445015,1445618..1445726,
FT                   1446600..1446776,1447874..1448015,1448169..1448314,
FT                   1448437..1448623,1448717..1448822,1448935..1449094,
FT                   1449346..1449483,1449632..1449828,1452363..1452653,
FT                   1453365..1453422))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, isoform CRA_c"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272419.0
FT                   protein_id=hCP1787663.0 isoform=CRA_c"
FT                   /protein_id="EAW87204.1"
FT                   /translation="MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTL
FT                   LKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAIS
FT                   PSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLS
FT                   LMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENW
FT                   PEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGA
FT                   GSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRR
FT                   QPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHG
FT                   SEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNN
FT                   MQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCL
FT                   GLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLR
FT                   SFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESD
FT                   RNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVL
FT                   KVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIG
FT                   LAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGH
FT                   LAAASTKQTITESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRN
FT                   PDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVLPVQCLCEFLLHDAVDDAASGEEDDE
FT                   GESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKADEQTTCEVLDYFLRRLGSSQVASRVL
FT                   AMKGLSLVLSEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTAL
FT                   ALQQAIHMETDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKL
FT                   SPSAASDAVLSALLSIFSRYVRRMRQSKEGEEVYSWVRARRSTAG"
FT   mRNA            complement(join(<1444287..1444355,1444879..1445015,
FT                   1445618..1445726,1446600..1446776,1447874..1448015,
FT                   1448169..1448314,1448437..1448623,1448717..1448822,
FT                   1448935..1449094,1449346..1449483,1449632..1449828,
FT                   1452363..1452653,1453365..1453463,1453785..1453835))
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, transcript variant hCT2272414"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272414.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/13;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1444287..1444355,1444879..1445015,
FT                   1445618..1445726,1446600..1446776,1447874..1448015,
FT                   1448169..1448314,1448437..1448623,1448717..1448822,
FT                   1448935..1449094,1449346..1449483,1449632..1449828,
FT                   1452363..1452653,1453365..1453422))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1993380"
FT                   /product="hCG1993380, isoform CRA_a"
FT                   /note="gene_id=hCG1993380.0 transcript_id=hCT2272414.0
FT                   protein_id=hCP1787661.0 isoform=CRA_a"
FT                   /protein_id="EAW87202.1"
FT                   /translation="MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTL
FT                   LKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAIS
FT                   PSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLS
FT                   LMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENW
FT                   PEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGA
FT                   GSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRR
FT                   QPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHG
FT                   SEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNN
FT                   MQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCL
FT                   GLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLR
FT                   SFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHWCGWGPPAQGAVHRAAGDLLQVGQL
FT                   ATRE"
FT   gene            1480020..1492331
FT                   /gene="MAFK"
FT                   /locus_tag="hCG_18899"
FT                   /note="gene_id=hCG18899.4"
FT   mRNA            join(1480020..1480187,1488438..1488517,1489230..1492331)
FT                   /gene="MAFK"
FT                   /locus_tag="hCG_18899"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian), transcript variant hCT9963"
FT                   /note="gene_id=hCG18899.4 transcript_id=hCT9963.3; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 02-MAY-2003"
FT   mRNA            join(1486775..1487746,1488438..1488517,1489230..1490563,
FT                   1491588..1491974)
FT                   /gene="MAFK"
FT                   /locus_tag="hCG_18899"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian), transcript variant hCT2271316"
FT                   /note="gene_id=hCG18899.4 transcript_id=hCT2271316.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 02-MAY-2003"
FT   CDS             join(1488482..1488517,1489230..1489664)
FT                   /codon_start=1
FT                   /gene="MAFK"
FT                   /locus_tag="hCG_18899"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian), isoform CRA_a"
FT                   /note="gene_id=hCG18899.4 transcript_id=hCT9963.3
FT                   protein_id=hCP37130.3 isoform=CRA_a"
FT                   /db_xref="GOA:O60675"
FT                   /db_xref="HGNC:HGNC:6782"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR024874"
FT                   /db_xref="InterPro:IPR028574"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60675"
FT                   /protein_id="EAW87207.1"
FT                   /translation="MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLT
FT                   KEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLEL
FT                   DALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS"
FT   CDS             join(1488482..1488517,1489230..1489664)
FT                   /codon_start=1
FT                   /gene="MAFK"
FT                   /locus_tag="hCG_18899"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   homolog K (avian), isoform CRA_a"
FT                   /note="gene_id=hCG18899.4 transcript_id=hCT2271316.1
FT                   protein_id=hCP1787745.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R804"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR024874"
FT                   /db_xref="InterPro:IPR028574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R804"
FT                   /protein_id="EAW87208.1"
FT                   /translation="MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLT
FT                   KEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLEL
FT                   DALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS"
FT   gene            complement(1490498..1505438)
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /note="gene_id=hCG19462.2"
FT   mRNA            complement(join(1490498..1491113,1497031..1497228,
FT                   1497808..1497977,1499143..1499234,1499412..1499487,
FT                   1499594..1499684,1500106..1500271,1504473..1504691,
FT                   1505321..1505438))
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, transcript variant
FT                   hCT10533"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT10533.2; splice
FT                   donor-acceptor pairs covered / total pairs = 7/8; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(1490983..1491113,1497031..1497228,
FT                   1497808..1497977,1499143..1499234,1499412..1499487,
FT                   1499594..1499684,1500106..1500271,1504473..1504691))
FT                   /codon_start=1
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, isoform CRA_c"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT10533.2
FT                   protein_id=hCP37125.2 isoform=CRA_c"
FT                   /protein_id="EAW87211.1"
FT                   /translation="MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGA
FT                   PWLFLTSALARGVSGIFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDS
FT                   WLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCL
FT                   YGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLY
FT                   VTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERC
FT                   GVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPETP
FT                   VTGGTLKAALQEKEAQGGVPSPLVPQCSWKEEQAKAPGED"
FT   mRNA            complement(join(1493103..1496470,1497031..1497228,
FT                   1497808..1497977,1499143..1499234,1499594..1499684,
FT                   1500106..1500271,1504473..1504620,1505058..1505318))
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, transcript variant
FT                   hCT2356894"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT2356894.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   CDS             complement(1494665..1496065)
FT                   /codon_start=1
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, isoform CRA_a"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT2356894.0
FT                   protein_id=hCP1922139.0 isoform=CRA_a"
FT                   /protein_id="EAW87209.1"
FT                   /translation="MALAGTQVGPPPQERAPEPIGRAWGPPGITQPSAPGATVGRRVSV
FT                   AAGPWLHGPHGSCEWVRLPGSGDRQRTDPRLGSWREGRRGAGQPGSDTVSSSGRRRPAG
FT                   STQAGRGWASLEPATALVGTWRRAHVSPHASHRGALARRPARGACAWDGSQNQRAPVRL
FT                   ASTVGLWESLLFIFKHLGFSTGSWLLFPQGMSLRSRTRWGSQEAAAQSLHAGKGSHLSG
FT                   VGSLVVQGSAGQSLGCAITATAFLLGASTSSKTGLVPAPPAASGQGHEGRALSTWAGGT
FT                   LPGGTEGAPTWAPASCPSLLPPRARWGPGFEEPRTRALPAGSWRRASGLGNRGRKNSSR
FT                   PGTKGASGRTHGWPRARGVTAGRPPGPGPVRGQYGDPACRWQSVLCVWGPQHRLGGGWG
FT                   RGSRSGQGLGGSGTGRGEQTGSSSGHHPGTAAPTRAAPHPWPRSPGTAGPGVSEGLSRA
FT                   GTDQWSPG"
FT   mRNA            complement(join(1495450..1496470,1497031..1497228,
FT                   1497808..1497977,1499143..1499234,1499412..1499487,
FT                   1499594..1499684,1500106..1500271,1504473..1504691,
FT                   1505321..1505438))
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, transcript variant
FT                   hCT2272412"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT2272412.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1496241..1496470,1497031..1497228,
FT                   1497808..1497977,1499143..1499234,1499412..1499487,
FT                   1499594..1499684,1500106..1500271,1504473..1504691))
FT                   /codon_start=1
FT                   /gene="MGC9712"
FT                   /locus_tag="hCG_19462"
FT                   /product="hypothetical protein MGC9712, isoform CRA_b"
FT                   /note="gene_id=hCG19462.2 transcript_id=hCT2272412.0
FT                   protein_id=hCP1787662.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZMB5"
FT                   /db_xref="HGNC:HGNC:28797"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZMB5"
FT                   /protein_id="EAW87210.1"
FT                   /translation="MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGA
FT                   PWLFLTSALARGVSGIFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDS
FT                   WLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCL
FT                   YGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLY
FT                   VTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERC
FT                   GVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPP
FT                   APMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKS
FT                   RSLEKRMLIPSEDL"
FT   gene            complement(1516517..1520197)
FT                   /gene="MGC10911"
FT                   /locus_tag="hCG_19463"
FT                   /note="gene_id=hCG19463.3"
FT   mRNA            complement(join(1516517..1517037,1518311..1518547,
FT                   1519661..1520197))
FT                   /gene="MGC10911"
FT                   /locus_tag="hCG_19463"
FT                   /product="hypothetical protein MGC10911, transcript variant
FT                   hCT10534"
FT                   /note="gene_id=hCG19463.3 transcript_id=hCT10534.3; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(1516517..1517037,1518311..1519188))
FT                   /gene="MGC10911"
FT                   /locus_tag="hCG_19463"
FT                   /product="hypothetical protein MGC10911, transcript variant
FT                   hCT1960836"
FT                   /note="gene_id=hCG19463.3 transcript_id=hCT1960836.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1516885..1517037,1518311..1518526))
FT                   /codon_start=1
FT                   /gene="MGC10911"
FT                   /locus_tag="hCG_19463"
FT                   /product="hypothetical protein MGC10911, isoform CRA_a"
FT                   /note="gene_id=hCG19463.3 transcript_id=hCT1960836.1
FT                   protein_id=hCP1771097.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9BT73"
FT                   /db_xref="HGNC:HGNC:22420"
FT                   /db_xref="InterPro:IPR018788"
FT                   /db_xref="PDB:2Z5E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BT73"
FT                   /protein_id="EAW87212.1"
FT                   /translation="MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTL
FT                   VSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDK
FT                   SMEGLKALREVIRVCQVW"
FT   CDS             complement(join(1516885..1517037,1518311..1518526))
FT                   /codon_start=1
FT                   /gene="MGC10911"
FT                   /locus_tag="hCG_19463"
FT                   /product="hypothetical protein MGC10911, isoform CRA_a"
FT                   /note="gene_id=hCG19463.3 transcript_id=hCT10534.3
FT                   protein_id=hCP37126.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR018788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R806"
FT                   /protein_id="EAW87213.1"
FT                   /translation="MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTL
FT                   VSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDK
FT                   SMEGLKALREVIRVCQVW"
FT   gene            1519300..1525060
FT                   /locus_tag="hCG_1744853"
FT                   /note="gene_id=hCG1744853.2"
FT   mRNA            join(1519300..1519466,1523904..1524052,1524862..1525060)
FT                   /locus_tag="hCG_1744853"
FT                   /product="hCG1744853"
FT                   /note="gene_id=hCG1744853.2 transcript_id=hCT1783093.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             join(1523975..1524052,1524862..1525047)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1744853"
FT                   /product="hCG1744853"
FT                   /note="gene_id=hCG1744853.2 transcript_id=hCT1783093.2
FT                   protein_id=hCP1724570.2"
FT                   /protein_id="EAW87214.1"
FT                   /translation="MISVFLCCPVMAGTRIVWSSDQEDSQKLFPLAKKPPCCPVWSSMT
FT                   KLISLSGSSFIIAAFSLFQERTESQCAVCHGPWMNVCGTGLN"
FT   gene            1535304..1537530
FT                   /locus_tag="hCG_1992621"
FT                   /note="gene_id=hCG1992621.0"
FT   mRNA            1535304..1537530
FT                   /locus_tag="hCG_1992621"
FT                   /product="hCG1992621"
FT                   /note="gene_id=hCG1992621.0 transcript_id=hCT2271331.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             1536116..1536910
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992621"
FT                   /product="hCG1992621"
FT                   /note="gene_id=hCG1992621.0 transcript_id=hCT2271331.0
FT                   protein_id=hCP1787743.0"
FT                   /db_xref="HGNC:HGNC:22230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96PY0"
FT                   /protein_id="EAW87215.1"
FT                   /translation="MMDCTWTLPGMRATWQPAPFLPWDQTPWRVSFSWSPVLLAWGGVW
FT                   SGEAHPCAHVLRPPASPCPPRPRRGCGDSGSSGMAQRAQAGSNQSRGKCGRDGRCPPRS
FT                   SPGAPEAAERVESAETRGPGKSWILSPSSMSEPRRGKARRSPGRRRHPHSSFPQASSPS
FT                   SPSRRETIPQVQSSGVPGAMSPEQTLFSRSPRGLSHLGQSLCRTVKESEAQRGKTMPPG
FT                   SHSPSGAGQGRTARKGPAREEIPSSDSSAKPSVYPHPHLTAT"
FT   assembly_gap    1562279..1562384
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1608428..1609019
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   assembly_gap    1613682..1614757
FT                   /estimated_length=1076
FT                   /gap_type="unknown"
FT   assembly_gap    1620026..1620045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1642054..>1642600)
FT                   /locus_tag="hCG_2041867"
FT                   /note="gene_id=hCG2041867.0"
FT   mRNA            complement(join(1642054..1642354,1642446..>1642600))
FT                   /locus_tag="hCG_2041867"
FT                   /product="hCG2041867"
FT                   /note="gene_id=hCG2041867.0 transcript_id=hCT2347098.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(1642162..1642354,1642446..>1642525))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041867"
FT                   /product="hCG2041867"
FT                   /note="gene_id=hCG2041867.0 transcript_id=hCT2347098.0
FT                   protein_id=hCP1910789.0"
FT                   /protein_id="EAW87216.1"
FT                   /translation="VDPDGQREQPSAQTPQRSPARPCSHDRSATWHTDHSESGETEAQQ
FT                   QKVSRRRSRRQEIADARRVMALRDERSPSCPALPRPPAIVAILGT"
FT   gene            1659242..1697748
FT                   /locus_tag="hCG_1818658"
FT                   /note="gene_id=hCG1818658.1"
FT   mRNA            join(1659242..1659403,1694458..1696331,1696398..1697748)
FT                   /locus_tag="hCG_1818658"
FT                   /product="hCG1818658"
FT                   /note="gene_id=hCG1818658.1 transcript_id=hCT1964895.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/2;
FT                   created on 26-AUG-2002"
FT   gene            complement(<1682505..>1692507)
FT                   /locus_tag="hCG_1817673"
FT                   /note="gene_id=hCG1817673.1"
FT   mRNA            complement(join(<1682505..1682608,1685343..1685403,
FT                   1685530..1685598,1688315..1688467,1689200..1689355,
FT                   1689721..1689766,1691535..1691625,1692363..>1692507))
FT                   /locus_tag="hCG_1817673"
FT                   /product="hCG1817673"
FT                   /note="gene_id=hCG1817673.1 transcript_id=hCT1960038.1;
FT                   splice donor-acceptor pairs covered / total pairs = 0/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1682505..1682608,1685343..1685403,
FT                   1685530..1685598,1688315..1688467,1689200..1689355,
FT                   1689721..1689766,1691535..1691625,1692363..1692507))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1817673"
FT                   /product="hCG1817673"
FT                   /note="gene_id=hCG1817673.1 transcript_id=hCT1960038.1
FT                   protein_id=hCP1770509.1"
FT                   /protein_id="EAW87218.1"
FT                   /translation="MGRMASGCARPPEGRVWPAAAQEACRKRGASATIVITFNLLLKIT
FT                   QSQGWGACVMREAGRPQPRVQPSPSCSAPAPEYRPGSVLTASSPQLSQGPEGASLTTKA
FT                   VLRPRAALRASSPPRVEENPASKHNLQGPLDGPPLLLTPSPLVSSVCAHPYQLQCLTPL
FT                   TQMERGLHVPGPGQPQEHHRPRHGTWDHAPSVVWEAGLGSRTEGTAACTTSPLCEDSSR
FT                   NTLQVCNREKLLFPRRSAGWSISCLSSYPLQPYVAPQYPGESPHFLKGLTGHQ"
FT   CDS             join(1694751..1696331,1696398..1697237)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1818658"
FT                   /product="hCG1818658"
FT                   /note="gene_id=hCG1818658.1 transcript_id=hCT1964895.1
FT                   protein_id=hCP1779385.1"
FT                   /protein_id="EAW87217.1"
FT                   /translation="MAGRGWGALWVCVAAATLLHAGGLARADCWLIEGDKGFVWLAICS
FT                   QNQPPYEAIPQQINSTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAF
FT                   SGQFNLQVLQLGYNRLRNLTEGMLRGLGKLEYLYLQANLIEVVMASSFWECPNIVNIDL
FT                   SMNRIQQLNSGTFAGLAKLSVCELYSNPFYCSCELLGFLRWLAAFTNATQTYDRMQCES
FT                   PPVYSGYYLLGQGRRGHRSILSKLQSVCTEDSYAAEVVGPPRPASGRSQPGRSPPPPPP
FT                   PEPSDMPCADDECFSGDGTTPLVALPTLATQAEARPLIKVKQLTQNSATITVQLPSPFH
FT                   RMYTLEHFNNSKASTVSRLTKAQEEIRLTNLFTLTNYTYCVVSTSAGLRHNHTCLTICL
FT                   PRLPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCLRRRRRQEEKHKKAASAAA
FT                   AGSLKKTIIELKYGPELEAPGLAPLSQGPLLGPEAVTRIPYLPAAGEVEQYKLVESADT
FT                   PKASKGSYMESSVAEISTIAKEVDKVNQIINNCIDALKSESTSFQGVKSGPVSVAEPPL
FT                   VLLSEPLAAKHGFLAPGYKDAFGHSLQRHHSVEAAGPPRASTSSSGSVRSPRAFRAEAV
FT                   GVHKAAAAEAKYIEKGSPAADAILTVTPAAAVLRAEAEKGRQYGEHRHSYPGSHPAEPP
FT                   APPGPPPPPPHEGLGRKASILEPLTRPRPRDLAYSQLSPQYHSLSYSSSPEYTCRASQS
FT                   IWERFRLSRRRHKEEEEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS"
FT   assembly_gap    1709068..1709338
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    1756023..1756251
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    1765269..1765641
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   gene            complement(1766059..2184656)
FT                   /gene="MAD1L1"
FT                   /locus_tag="hCG_1999174"
FT                   /note="gene_id=hCG1999174.0"
FT   mRNA            complement(join(1766059..1766746,1766816..1766862,
FT                   1851162..1851352,1889771..1889981,1910242..1910332,
FT                   1933066..1933154,1954630..1954686,1967063..1967203,
FT                   2021344..2021488,2101248..2101334,2164993..2165054,
FT                   2167666..2167780,2167938..2168068,2169743..2169824,
FT                   2171113..2171237,2174356..2174535,2177131..2177271,
FT                   2181705..2181864,2182270..2182485,2184593..2184656))
FT                   /gene="MAD1L1"
FT                   /locus_tag="hCG_1999174"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast),
FT                   transcript variant hCT2281849"
FT                   /note="gene_id=hCG1999174.0 transcript_id=hCT2281849.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1766059..1766862,1851162..1851352,
FT                   1889771..1889981,1910242..1910332,1933066..1933154,
FT                   1954630..1954686,1967063..1967203,2021344..2021488,
FT                   2101248..2101334,2164993..2165054,2167666..2167790,
FT                   2167949..2168068,2169743..2169824,2171113..2171237,
FT                   2174356..2174535,2177131..2177271,2181705..2181864,
FT                   2182270..2182485))
FT                   /gene="MAD1L1"
FT                   /locus_tag="hCG_1999174"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast),
FT                   transcript variant hCT2281848"
FT                   /note="gene_id=hCG1999174.0 transcript_id=hCT2281848.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1766704..1766746,1766816..1766862,
FT                   1851162..1851352,1889771..1889981,1910242..1910332,
FT                   1933066..1933154,1954630..1954686,1967063..1967203,
FT                   2021344..2021488,2101248..2101334,2164993..2165054,
FT                   2167666..2167780,2167938..2168068,2169743..2169824,
FT                   2171113..2171237,2174356..2174535,2177131..2177271,
FT                   2181705..2181854))
FT                   /codon_start=1
FT                   /gene="MAD1L1"
FT                   /locus_tag="hCG_1999174"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1999174.0 transcript_id=hCT2281849.0
FT                   protein_id=hCP1787848.0 isoform=CRA_b"
FT                   /protein_id="EAW87220.1"
FT                   /translation="MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQY
FT                   QQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQ
FT                   ELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALK
FT                   GRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHE
FT                   QQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQE
FT                   ELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVE
FT                   LQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQK
FT                   RVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQ
FT                   ALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEE
FT                   EKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLR
FT                   AMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYT
FT                   LTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSLTLELFSRQTV
FT                   A"
FT   CDS             complement(join(1766704..1766862,1851162..1851352,
FT                   1889771..1889981,1910242..1910332,1933066..1933154,
FT                   1954630..1954686,1967063..1967203,2021344..2021488,
FT                   2101248..2101334,2164993..2165054,2167666..2167776))
FT                   /codon_start=1
FT                   /gene="MAD1L1"
FT                   /locus_tag="hCG_1999174"
FT                   /product="MAD1 mitotic arrest deficient-like 1 (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1999174.0 transcript_id=hCT2281848.0
FT                   protein_id=hCP1787847.0 isoform=CRA_a"
FT                   /protein_id="EAW87219.1"
FT                   /translation="MRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQS
FT                   WERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQ
FT                   VSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRR
FT                   MREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLF
FT                   SREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSV
FT                   ARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESA
FT                   ELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSP
FT                   SGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA"
FT   assembly_gap    1770753..1771149
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    1773457..1773908
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    1782859..1783149
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    1787759..1789020
FT                   /estimated_length=1262
FT                   /gap_type="unknown"
FT   gene            <1792693..1794663
FT                   /locus_tag="hCG_1998965"
FT                   /note="gene_id=hCG1998965.1"
FT   mRNA            join(<1792693..1792749,1794481..1794663)
FT                   /locus_tag="hCG_1998965"
FT                   /product="hCG1998965"
FT                   /note="gene_id=hCG1998965.1 transcript_id=hCT2281477.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 25-NOV-2003"
FT   CDS             join(<1792694..1792749,1794481..1794607)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1998965"
FT                   /product="hCG1998965"
FT                   /note="gene_id=hCG1998965.1 transcript_id=hCT2281477.1
FT                   protein_id=hCP1787849.1"
FT                   /protein_id="EAW87221.1"
FT                   /translation="KAGTTSLTRQKLSFSEPPRQSWPRGAPAQTSLTAREAAMKAEPGE
FT                   GAQVRCRPPLSSSPS"
FT   assembly_gap    1829227..1829246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1882722..1882741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1948277..1948296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2185918..2193935)
FT                   /locus_tag="hCG_17134"
FT                   /note="gene_id=hCG17134.2"
FT   mRNA            complement(join(2185918..2187286,2191140..2191429,
FT                   2193886..2193935))
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, transcript variant hCT8182"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT8182.2; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2186013..2186719,2186775..2187286,
FT                   2191140..2191429,2193886..2193935))
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, transcript variant hCT1962800"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT1962800.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2186015..2187286,2189737..2190659,
FT                   2191140..2191429,2193886..2193922))
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, transcript variant hCT2356922"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT2356922.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(2186844..2187286,2191140..2191429,
FT                   2193886..2193893))
FT                   /codon_start=1
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, isoform CRA_b"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT1962800.1
FT                   protein_id=hCP1777351.1 isoform=CRA_b"
FT                   /db_xref="GOA:V9HWJ9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:V9HWJ9"
FT                   /protein_id="EAW87223.1"
FT                   /translation="MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVK
FT                   AAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSP
FT                   VGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFR
FT                   DLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEA
FT                   SRKESSEVYFLATQYHGRKGTVKQ"
FT   CDS             complement(join(2186844..2187286,2191140..2191429,
FT                   2193886..2193893))
FT                   /codon_start=1
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, isoform CRA_b"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT8182.2
FT                   protein_id=hCP36412.2 isoform=CRA_b"
FT                   /db_xref="GOA:V9HWJ9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:V9HWJ9"
FT                   /protein_id="EAW87224.1"
FT                   /translation="MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVK
FT                   AAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSP
FT                   VGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFR
FT                   DLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEA
FT                   SRKESSEVYFLATQYHGRKGTVKQ"
FT   CDS             complement(join(2186844..2187286,2189737..2189782))
FT                   /codon_start=1
FT                   /locus_tag="hCG_17134"
FT                   /product="hCG17134, isoform CRA_a"
FT                   /note="gene_id=hCG17134.2 transcript_id=hCT2356922.0
FT                   protein_id=hCP1922124.0 isoform=CRA_a"
FT                   /protein_id="EAW87222.1"
FT                   /translation="MLAPWICTSASLLVCDPSSPVGFVLGVDLLHIFPLEGATFLCPAD
FT                   VTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPG
FT                   GTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ"
FT   gene            2193946..2202956
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /note="gene_id=hCG18431.5"
FT   mRNA            join(2193946..2193980,2194649..2194772,2196287..2196450,
FT                   2201581..2201726,2202552..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356911"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356911.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2193946..2193980,2194649..2194699,2196287..2196450,
FT                   2201581..2201726,2202552..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356912"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356912.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2193946..2193980,2196287..2196450,2201581..2201726,
FT                   2202552..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356910"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356910.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2193983..2194016,2194649..2194699,2196287..2196450,
FT                   2201581..2201726,2202552..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356915"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356915.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2193985..2194016,2194649..2194772,2196287..2196450,
FT                   2201581..2201726,2202552..2202956)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT9490"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT9490.2; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   mRNA            join(2193985..2194016,2194649..2194772,2196287..2196450,
FT                   2201581..2201726,2202552..2202730,2202755..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT1962802"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT1962802.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2194530..2194772,2196287..2196450,2201581..2201726,
FT                   2202552..2202889)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356913"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356913.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2194629..2194699,2196287..2196450,2201581..2201726,
FT                   2202552..2202868)
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, transcript variant hCT2356914"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356914.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   CDS             join(2194716..2194772,2196287..2196450,2201581..2201726,
FT                   2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_b"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT1962802.1
FT                   protein_id=hCP1777350.1 isoform=CRA_b"
FT                   /db_xref="GOA:P36639"
FT                   /db_xref="HGNC:HGNC:8048"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:1IRY"
FT                   /db_xref="PDB:3Q93"
FT                   /db_xref="PDB:3WHW"
FT                   /db_xref="PDB:3ZR0"
FT                   /db_xref="PDB:3ZR1"
FT                   /db_xref="PDB:4C9W"
FT                   /db_xref="PDB:4C9X"
FT                   /db_xref="PDB:4N1T"
FT                   /db_xref="PDB:4N1U"
FT                   /db_xref="PDB:5ANS"
FT                   /db_xref="PDB:5ANT"
FT                   /db_xref="PDB:5ANU"
FT                   /db_xref="PDB:5ANV"
FT                   /db_xref="PDB:5ANW"
FT                   /db_xref="PDB:5FSI"
FT                   /db_xref="PDB:5FSK"
FT                   /db_xref="PDB:5FSL"
FT                   /db_xref="PDB:5FSM"
FT                   /db_xref="PDB:5FSN"
FT                   /db_xref="PDB:5FSO"
FT                   /db_xref="PDB:5GHI"
FT                   /db_xref="PDB:5GHJ"
FT                   /db_xref="PDB:5GHM"
FT                   /db_xref="PDB:5GHN"
FT                   /db_xref="PDB:5GHO"
FT                   /db_xref="PDB:5GHP"
FT                   /db_xref="PDB:5GHQ"
FT                   /db_xref="PDB:5WS7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36639"
FT                   /protein_id="EAW87227.1"
FT                   /translation="MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGM
FT                   KKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
FT                   DVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
FT                   GQDTILDYTLREVDTV"
FT   CDS             join(2194716..2194772,2196287..2196450,2201581..2201726,
FT                   2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_b"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356911.0
FT                   protein_id=hCP1922132.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R858"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R858"
FT                   /protein_id="EAW87228.1"
FT                   /translation="MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGM
FT                   KKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
FT                   DVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
FT                   GQDTILDYTLREVDTV"
FT   CDS             join(2194716..2194772,2196287..2196450,2201581..2201726,
FT                   2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_b"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT9490.2
FT                   protein_id=hCP36414.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R858"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R858"
FT                   /protein_id="EAW87230.1"
FT                   /translation="MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGM
FT                   KKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
FT                   DVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
FT                   GQDTILDYTLREVDTV"
FT   CDS             join(2194716..2194772,2196287..2196450,2201581..2201726,
FT                   2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_b"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356913.0
FT                   protein_id=hCP1922134.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R858"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R858"
FT                   /protein_id="EAW87232.1"
FT                   /translation="MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGM
FT                   KKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
FT                   DVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
FT                   GQDTILDYTLREVDTV"
FT   CDS             join(2196299..2196450,2201581..2201726,2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_a"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356912.0
FT                   protein_id=hCP1922133.0 isoform=CRA_a"
FT                   /db_xref="GOA:P36639"
FT                   /db_xref="HGNC:HGNC:8048"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="PDB:1IRY"
FT                   /db_xref="PDB:3Q93"
FT                   /db_xref="PDB:3WHW"
FT                   /db_xref="PDB:3ZR0"
FT                   /db_xref="PDB:3ZR1"
FT                   /db_xref="PDB:4C9W"
FT                   /db_xref="PDB:4C9X"
FT                   /db_xref="PDB:4N1T"
FT                   /db_xref="PDB:4N1U"
FT                   /db_xref="PDB:5ANS"
FT                   /db_xref="PDB:5ANT"
FT                   /db_xref="PDB:5ANU"
FT                   /db_xref="PDB:5ANV"
FT                   /db_xref="PDB:5ANW"
FT                   /db_xref="PDB:5FSI"
FT                   /db_xref="PDB:5FSK"
FT                   /db_xref="PDB:5FSL"
FT                   /db_xref="PDB:5FSM"
FT                   /db_xref="PDB:5FSN"
FT                   /db_xref="PDB:5FSO"
FT                   /db_xref="PDB:5GHI"
FT                   /db_xref="PDB:5GHJ"
FT                   /db_xref="PDB:5GHM"
FT                   /db_xref="PDB:5GHN"
FT                   /db_xref="PDB:5GHO"
FT                   /db_xref="PDB:5GHP"
FT                   /db_xref="PDB:5GHQ"
FT                   /db_xref="PDB:5WS7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36639"
FT                   /protein_id="EAW87225.1"
FT                   /translation="MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETI
FT                   EDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPC
FT                   WFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV"
FT   CDS             join(2196299..2196450,2201581..2201726,2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_a"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356915.0
FT                   protein_id=hCP1922136.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R819"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R819"
FT                   /protein_id="EAW87226.1"
FT                   /translation="MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETI
FT                   EDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPC
FT                   WFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV"
FT   CDS             join(2196299..2196450,2201581..2201726,2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_a"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356910.0
FT                   protein_id=hCP1922131.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R819"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R819"
FT                   /protein_id="EAW87229.1"
FT                   /translation="MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETI
FT                   EDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPC
FT                   WFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV"
FT   CDS             join(2196299..2196450,2201581..2201726,2202552..2202724)
FT                   /codon_start=1
FT                   /gene="NUDT1"
FT                   /locus_tag="hCG_18431"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 1, isoform CRA_a"
FT                   /note="gene_id=hCG18431.5 transcript_id=hCT2356914.0
FT                   protein_id=hCP1922135.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R819"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003563"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R819"
FT                   /protein_id="EAW87231.1"
FT                   /translation="MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETI
FT                   EDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPC
FT                   WFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV"
FT   gene            complement(2202888..2204372)
FT                   /locus_tag="hCG_1999172"
FT                   /note="gene_id=hCG1999172.0"
FT   mRNA            complement(join(2202888..2203852,2203868..2204372))
FT                   /locus_tag="hCG_1999172"
FT                   /product="hCG1999172"
FT                   /note="gene_id=hCG1999172.0 transcript_id=hCT2281844.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2203699..2203852,2203868..2204025))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999172"
FT                   /product="hCG1999172"
FT                   /note="gene_id=hCG1999172.0 transcript_id=hCT2281844.0
FT                   protein_id=hCP1787829.0"
FT                   /protein_id="EAW87233.1"
FT                   /translation="MPLQPSCCPRPKPKLVPVITALPSWQGQLRVMLVEMPDAACPVRT
FT                   AGGAVGGGAVGRGLPIMVKGDIFIGSSWSVSWVLGVTVQTAALCLPDTVQAGETGLGL"
FT   gene            complement(<2206315..>2305793)
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /note="gene_id=hCG18435.2"
FT   mRNA            complement(join(<2206315..2206892,2208597..2208746,
FT                   2209088..2209237,2209458..2209526,2214952..2215084,
FT                   2216020..2216180,2221282..2221362,2223577..2223698,
FT                   2226838..2226955,2229825..2230030,2305706..>2305793))
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, transcript variant hCT2281841"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT2281841.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(<2206315..2206892,2208597..2208746,
FT                   2209088..2209237,2209458..2209526,2214952..2215084,
FT                   2216020..2216167,2221305..2221362,2223577..2223698,
FT                   2226838..2226955,2229825..2230030,2265799..>2265911))
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, transcript variant hCT9494"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT9494.2; splice
FT                   donor-acceptor pairs covered / total pairs = 9/10; created
FT                   on 26-AUG-2002"
FT   CDS             complement(<2206315..>2206707)
FT                   /codon_start=1
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, isoform CRA_a"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT9494.2
FT                   protein_id=hCP36420.3 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R820"
FT                   /protein_id="EAW87234.1"
FT                   /translation="FPLDGSSPPRHAPCCSWSRGAHACGSGGASVDHGGSWATLSFALW
FT                   PASLVERGGGVLWNGFLLTPRAVRGGRDLSSHRDCAWGSVEAGPPGAGTVGRGSIMVLG
FT                   QPRREGRAALQPRHGTDHGQRGDSQWC"
FT   CDS             complement(<2206315..>2206707)
FT                   /codon_start=1
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, isoform CRA_a"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT2281841.0
FT                   protein_id=hCP1787824.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R820"
FT                   /protein_id="EAW87236.1"
FT                   /translation="FPLDGSSPPRHAPCCSWSRGAHACGSGGASVDHGGSWATLSFALW
FT                   PASLVERGGGVLWNGFLLTPRAVRGGRDLSSHRDCAWGSVEAGPPGAGTVGRGSIMVLG
FT                   QPRREGRAALQPRHGTDHGQRGDSQWC"
FT   mRNA            complement(join(2206431..2206892,2208597..2208746,
FT                   2209088..2209237,2209458..2209526,2214952..2215084,
FT                   2216020..2216180,2221282..2221362,2223577..2223698,
FT                   2226838..2226955,2229825..2230030,2265799..2265911))
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, transcript variant hCT1950353"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT1950353.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2206779..2206892,2208597..2208746,
FT                   2209088..2209237,2209458..2209526,2214952..2215084,
FT                   2216020..2216180,2221282..2221362,2223577..2223698,
FT                   2226838..2226955,2229825..2230030,2265799..2265892))
FT                   /codon_start=1
FT                   /gene="SNX8"
FT                   /locus_tag="hCG_18435"
FT                   /product="sorting nexin 8, isoform CRA_b"
FT                   /note="gene_id=hCG18435.2 transcript_id=hCT1950353.1
FT                   protein_id=hCP1761792.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9Y5X2"
FT                   /db_xref="HGNC:HGNC:14972"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y5X2"
FT                   /protein_id="EAW87235.1"
FT                   /translation="MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIV
FT                   QQVPAPSRMQMPQGNPLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKS
FT                   SVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHP
FT                   LFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISR
FT                   ELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTW
FT                   GSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLH
FT                   KHQRALHKYSLMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQ
FT                   ETQLIHVYLPLTSHILRAFVNSQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPP
FT                   EDGLCPH"
FT   gene            2306345..2332172
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /note="gene_id=hCG1998988.1"
FT   mRNA            join(2306345..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330937,
FT                   2331630..2332172)
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, transcript variant hCT2356899"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356899.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2306352..2306602,2306720..2306906,2312196..2312388,
FT                   2314131..2314250,2314556..2314613,2315118..2315246,
FT                   2315858..2316015,2317803..2317934,2318011..2318077,
FT                   2318485..2318531,2320958..2321168,2323264..2323336,
FT                   2324160..2324282,2326015..2326093,2326876..2327014,
FT                   2328437..2328562,2330115..2330192,2330560..2330668,
FT                   2330820..2330937,2331705..2332166)
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, transcript variant hCT2356898"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356898.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2306358..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330937,
FT                   2331705..2332171)
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, transcript variant hCT2281510"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2281510.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2306377..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330937,
FT                   2331705..2331829,2331941..2332166)
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, transcript variant hCT2356900"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356900.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 14-JUL-2004"
FT   CDS             join(2306408..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330923)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, isoform CRA_a"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2281510.0
FT                   protein_id=hCP1787889.0 isoform=CRA_a"
FT                   /db_xref="GOA:P55884"
FT                   /db_xref="HGNC:HGNC:3280"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="PDB:2KRB"
FT                   /db_xref="PDB:2NLW"
FT                   /db_xref="PDB:5K1H"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55884"
FT                   /protein_id="EAW87237.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ
FT                   GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV
FT                   SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY
FT                   PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI
FT                   PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV
FT                   RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQD
FT                   DPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLD
FT                   KKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKL
FT                   HWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSK
FT                   FAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGAL
FT                   AFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKN
FT                   NKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTM
FT                   MEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGN
FT                   QE"
FT   CDS             join(2306408..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330923)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, isoform CRA_a"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356899.0
FT                   protein_id=hCP1922147.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R821"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R821"
FT                   /protein_id="EAW87240.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ
FT                   GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV
FT                   SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY
FT                   PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI
FT                   PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV
FT                   RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQD
FT                   DPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLD
FT                   KKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKL
FT                   HWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSK
FT                   FAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGAL
FT                   AFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKN
FT                   NKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTM
FT                   MEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGN
FT                   QE"
FT   CDS             join(2306408..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323336,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..2330923)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, isoform CRA_a"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356900.0
FT                   protein_id=hCP1922148.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R821"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R821"
FT                   /protein_id="EAW87241.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ
FT                   GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV
FT                   SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY
FT                   PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI
FT                   PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV
FT                   RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQD
FT                   DPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLD
FT                   KKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKL
FT                   HWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSK
FT                   FAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGAL
FT                   AFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKN
FT                   NKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTM
FT                   MEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGN
FT                   QE"
FT   CDS             join(2306408..2306602,2306720..2306906,2312196..2312388,
FT                   2314131..2314250,2314556..2314613,2315118..2315246,
FT                   2315858..2316015,2317803..2317934,2318011..2318077,
FT                   2318485..2318531,2320958..2321168,2323264..2323336,
FT                   2324160..2324282,2326015..2326093,2326876..2327014,
FT                   2328437..2328562,2330115..2330192,2330560..2330668,
FT                   2330820..2330923)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, isoform CRA_b"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356898.0
FT                   protein_id=hCP1922146.0 isoform=CRA_b"
FT                   /db_xref="GOA:A4D210"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="UniProtKB/TrEMBL:A4D210"
FT                   /protein_id="EAW87238.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRAL
FT                   ENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEK
FT                   LKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTF
FT                   RVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFW
FT                   NDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLI
FT                   DFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFF
FT                   ARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQ
FT                   LPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPV
FT                   DVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIF
FT                   WSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWS
FT                   HKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQ
FT                   KDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVD
FT                   DWEEETIEFFVTEEIIPLGNQE"
FT   mRNA            join(<2306408..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323351,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..>2330920)
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, transcript variant hCT2356901"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356901.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 14-JUL-2004"
FT   CDS             join(2306408..2306906,2312196..2312388,2314131..2314250,
FT                   2314556..2314613,2315118..2315246,2315858..2316015,
FT                   2317803..2317934,2318011..2318077,2318485..2318531,
FT                   2320958..2321168,2323264..2323351,2324160..2324282,
FT                   2326015..2326093,2326876..2327014,2328437..2328562,
FT                   2330115..2330192,2330560..2330668,2330820..>2330920)
FT                   /codon_start=1
FT                   /gene="EIF3S9"
FT                   /locus_tag="hCG_1998988"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 9 eta, 116kDa, isoform CRA_c"
FT                   /note="gene_id=hCG1998988.1 transcript_id=hCT2356901.0
FT                   protein_id=hCP1922149.0 isoform=CRA_c"
FT                   /protein_id="EAW87239.1"
FT                   /translation="MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEA
FT                   AGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQ
FT                   GEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDV
FT                   SEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY
FT                   PEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDI
FT                   PEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYV
FT                   RWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQD
FT                   DPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLD
FT                   KKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKL
FT                   HWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKGKLYFKTIIAFAWE
FT                   PNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS
FT                   MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGR
FT                   LLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVE
FT                   RRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEI
FT                   IPLGNQE"
FT   gene            complement(<2306409..2377519)
FT                   /locus_tag="hCG_1999168"
FT                   /note="gene_id=hCG1999168.0"
FT   mRNA            complement(join(<2306409..2306744,2357758..2357949,
FT                   2377313..2377519))
FT                   /locus_tag="hCG_1999168"
FT                   /product="hCG1999168"
FT                   /note="gene_id=hCG1999168.0 transcript_id=hCT2281838.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(<2306409..2306695)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999168"
FT                   /product="hCG1999168"
FT                   /note="gene_id=hCG1999168.0 transcript_id=hCT2281838.0
FT                   protein_id=hCP1787815.0"
FT                   /protein_id="EAW87242.1"
FT                   /translation="MRPGQLLGGRRRGRLGRAGGRLCLGRRLGPHLGLRPGLRDPHLLT
FT                   GGLGPRGLRSAGPRGPQQPLGWRRLGGRLLLAGLGALLGRLGHRHVLRVL"
FT   gene            <2354616..2385964
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /note="gene_id=hCG1639774.3"
FT   mRNA            join(<2354616..2354658,2355335..>2355825)
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   transcript variant hCT2281514"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT2281514.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(2354616..2354658,2355335..>2355825)
FT                   /codon_start=1
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT2281514.0
FT                   protein_id=hCP1787853.0 isoform=CRA_a"
FT                   /protein_id="EAW87243.1"
FT                   /translation="MLEKGSDRQQALHKGGPSPGALISAFCGSSGSGREICGSDSATAE
FT                   AAAAPPAPRSPPARHQPLPPGRGRTNSRAWSSRIPSSRGPPCACCHLNGAPRPRRPQPW
FT                   SLQTPAAPAGRSGYPLNDLSLQKPQPCPSGRGNRAFSPGTVGLRPPLRAPGHRDTAGKA
FT                   LARAEAPSGRQHNKP"
FT   mRNA            join(2354982..2355070,2383936..2385964)
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   transcript variant hCT1639901"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT1639901.3;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2355514..2355631,2383936..2385964)
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   transcript variant hCT2281516"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT2281516.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             2384013..2385257
FT                   /codon_start=1
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT1639901.3
FT                   protein_id=hCP1619921.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R860"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R860"
FT                   /protein_id="EAW87244.1"
FT                   /translation="MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHT
FT                   GPPLPTPGPDRDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGY
FT                   DWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRH
FT                   GAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRR
FT                   YGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANH
FT                   TSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVG
FT                   KLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEAD
FT                   FVLFGYPKPENLLRD"
FT   CDS             2384013..2385257
FT                   /codon_start=1
FT                   /gene="CHST12"
FT                   /locus_tag="hCG_1639774"
FT                   /product="carbohydrate (chondroitin 4) sulfotransferase 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1639774.3 transcript_id=hCT2281516.0
FT                   protein_id=hCP1787855.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R860"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R860"
FT                   /protein_id="EAW87245.1"
FT                   /translation="MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHT
FT                   GPPLPTPGPDRDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGY
FT                   DWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRH
FT                   GAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRR
FT                   YGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANH
FT                   TSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVG
FT                   KLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEAD
FT                   FVLFGYPKPENLLRD"
FT   gene            <2389141..>2398055
FT                   /locus_tag="hCG_1998993"
FT                   /note="gene_id=hCG1998993.0"
FT   mRNA            join(<2389141..2389298,2397320..>2398055)
FT                   /locus_tag="hCG_1998993"
FT                   /product="hCG1998993"
FT                   /note="gene_id=hCG1998993.0 transcript_id=hCT2281517.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             <2397657..>2398055
FT                   /codon_start=1
FT                   /locus_tag="hCG_1998993"
FT                   /product="hCG1998993"
FT                   /note="gene_id=hCG1998993.0 transcript_id=hCT2281517.0
FT                   protein_id=hCP1787860.0"
FT                   /protein_id="EAW87246.1"
FT                   /translation="LSASRSPGDGSLVRLSECWPDWQRGGERKNPGSEEKPLQPSAWPG
FT                   INPLQPQEVVPPQAANKAVPELCLWMTEPRPVPQGSALRLCPGTPGCAHVGASRSLPAM
FT                   RMRCPGTSLLQLGPVGLCLLSRAPWRCHF"
FT   gene            <2401162..>2401494
FT                   /locus_tag="hCG_1998994"
FT                   /note="gene_id=hCG1998994.0"
FT   mRNA            <2401162..>2401494
FT                   /locus_tag="hCG_1998994"
FT                   /product="hCG1998994"
FT                   /note="gene_id=hCG1998994.0 transcript_id=hCT2281518.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             2401162..>2401494
FT                   /codon_start=1
FT                   /locus_tag="hCG_1998994"
FT                   /product="hCG1998994"
FT                   /note="gene_id=hCG1998994.0 transcript_id=hCT2281518.0
FT                   protein_id=hCP1787861.0"
FT                   /protein_id="EAW87247.1"
FT                   /translation="MTSWKCRFMCPQTVAGASRWLLAVTRVAERAKRSFPQVGGVGLEH
FT                   SPHAEMSVDSEDPDPLVSVCRGGLKVIALQKPGWVRWLTPVIPALWEAEAGGSPAVRSS
FT                   RPAWPTR"
FT   gene            <2418103..2419065
FT                   /locus_tag="hCG_2041847"
FT                   /note="gene_id=hCG2041847.0"
FT   mRNA            join(<2418103..2418414,2419042..2419065)
FT                   /locus_tag="hCG_2041847"
FT                   /product="hCG2041847"
FT                   /note="gene_id=hCG2041847.0 transcript_id=hCT2347078.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             <2418193..2418345
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041847"
FT                   /product="hCG2041847"
FT                   /note="gene_id=hCG2041847.0 transcript_id=hCT2347078.0
FT                   protein_id=hCP1910787.0"
FT                   /protein_id="EAW87248.1"
FT                   /translation="PFLSVQFSGIDYVHDIVQPSPHYQNFFIIPNGNSDDFFFFFCDFL
FT                   NEPTM"
FT   gene            complement(<2426520..>2427383)
FT                   /locus_tag="hCG_18434"
FT                   /note="gene_id=hCG18434.3"
FT   mRNA            complement(join(<2426520..2426687,2427050..2427209,
FT                   2427301..>2427383))
FT                   /locus_tag="hCG_18434"
FT                   /product="hCG18434"
FT                   /note="gene_id=hCG18434.3 transcript_id=hCT9493.3; splice
FT                   donor-acceptor pairs covered / total pairs = 1/2; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(<2426520..2426687,2427050..2427209,
FT                   2427301..>2427383))
FT                   /codon_start=1
FT                   /locus_tag="hCG_18434"
FT                   /product="hCG18434"
FT                   /note="gene_id=hCG18434.3 transcript_id=hCT9493.3
FT                   protein_id=hCP36419.3"
FT                   /protein_id="EAW87249.1"
FT                   /translation="QSKAFCAGGLAPGWKLLVQGHADSGEDRFETNFLLETGDIAFHIK
FT                   PRFSSATVVGNAFQYGRWGPEQVSSIFPLAPGEPFEIEVSWDAEHFHVYAPEHKVLQFP
FT                   CRQRPLGATTRVRVLSDHCLAQVELAKRGLSWG"
FT   gene            <2469888..2480511
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /note="gene_id=hCG18436.3"
FT   mRNA            join(<2469888..2469932,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2478480..2480431)
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), transcript
FT                   variant hCT2281526"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281526.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(2469888..2469932,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2478480..2478546)
FT                   /codon_start=1
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281526.0
FT                   protein_id=hCP1787871.0 isoform=CRA_a"
FT                   /protein_id="EAW87250.1"
FT                   /translation="MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSR
FT                   QALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRP
FT                   IQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCT
FT                   IGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFS
FT                   VEADPSRFRSIHCHLYPDTPWCPRTAIF"
FT   mRNA            join(<2471196..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2480208..2480511)
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), transcript
FT                   variant hCT2281527"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281527.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(<2471196..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2478480..2480431)
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), transcript
FT                   variant hCT9495"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT9495.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   CDS             join(2471196..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2480208..2480220)
FT                   /codon_start=1
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281527.0
FT                   protein_id=hCP1787872.0 isoform=CRA_c"
FT                   /protein_id="EAW87252.1"
FT                   /translation="MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSL
FT                   AGPAGAAPAPGLGAAAAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPR
FT                   PLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNV
FT                   VITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRD
FT                   VYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNT
FT                   AERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENK
FT                   RNAVHVKGPFSVEADPSRWGN"
FT   CDS             join(2471196..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2478480..2478546)
FT                   /codon_start=1
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT9495.3
FT                   protein_id=hCP36421.1 isoform=CRA_e"
FT                   /protein_id="EAW87254.1"
FT                   /translation="MLKRCGRRLLLALAGALLACLLVLTADPPPPPLPAERGRRALRSL
FT                   AGPAGAAPAPGLGAAAAAPGALVRDVHSLSEYFSLLTRARRDAGPPPGAAPRPADGHPR
FT                   PLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNV
FT                   VITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRD
FT                   VYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNT
FT                   AERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENK
FT                   RNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCPRTAIF"
FT   mRNA            join(2471255..2471412,2471453..2471627,2476029..2476077,
FT                   2476553..2476652,2476748..2476901,2477019..2477104,
FT                   2477578..2477743,2478170..2478255,2480208..2480511)
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), transcript
FT                   variant hCT1950354"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT1950354.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2471255..2471412,2471453..2471627,2476029..2476077,
FT                   2476553..2476652,2476748..2476901,2477019..2477104,
FT                   2477578..2477743,2478170..2478255,2478480..2480431)
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), transcript
FT                   variant hCT2281525"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281525.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   CDS             join(2471625..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2480208..2480220)
FT                   /codon_start=1
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT1950354.1
FT                   protein_id=hCP1751247.1 isoform=CRA_b"
FT                   /protein_id="EAW87251.1"
FT                   /translation="MTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRF
FT                   IESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRP
FT                   VHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVPLI
FT                   RSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRWGN"
FT   CDS             join(2471625..2471627,2476029..2476077,2476553..2476652,
FT                   2476748..2476901,2477019..2477104,2477578..2477743,
FT                   2478170..2478255,2478480..2478546)
FT                   /codon_start=1
FT                   /gene="LFNG"
FT                   /locus_tag="hCG_18436"
FT                   /product="lunatic fringe homolog (Drosophila), isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG18436.3 transcript_id=hCT2281525.0
FT                   protein_id=hCP1787873.0 isoform=CRA_d"
FT                   /protein_id="EAW87253.1"
FT                   /translation="MTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRF
FT                   IESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRP
FT                   VHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVPLI
FT                   RSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCH
FT                   LYPDTPWCPRTAIF"
FT   gene            complement(2489162..2507137)
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /note="gene_id=hCG18433.3"
FT   mRNA            complement(join(2489162..2490117,2490532..2490704,
FT                   2490897..2490995,2491139..2491241,2492332..2492405,
FT                   2492651..2492837,2493071..2493189,2493473..2493564,
FT                   2494575..2494694,2494961..2495333,2496280..2496427,
FT                   2498695..2498849,2505697..2505839,2506879..2507137))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT9492"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT9492.2; splice
FT                   donor-acceptor pairs covered / total pairs = 13/13; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2489162..2490117,2490532..2490704,
FT                   2490897..2490995,2491139..2491241,2492332..2492405,
FT                   2492651..2492837,2493071..2493189,2493473..2493564,
FT                   2494575..2495333,2496280..2496424,2498695..2498849,
FT                   2500437..2500495,2505697..2505839,2506879..2507137))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT1967739"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT1967739.1;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2489162..2490117,2490897..2490995,
FT                   2491139..2492135))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT2281832"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281832.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2489206..2489930,2490006..2490117,
FT                   2490532..2490704,2490897..2490995,2491139..2491241,
FT                   2492332..2492405,2492651..2492837,2493071..2493189,
FT                   2493473..2493564,2494575..2495333,2496280..2496427,
FT                   2498695..2498849,2505697..2505839,2506879..2507137))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT2281831"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281831.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/13;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2489234..2490704,2490897..2490995,
FT                   2491139..2492405,2492651..2492837,2493071..2493189,
FT                   2493473..2493564,2494575..2495333,2496280..2496427,
FT                   2498695..2498849,2505697..2505839,2506879..2506898))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT2356918"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2356918.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(2489422..2490117,2490532..2490704,
FT                   2490897..2490995,2491139..2491241,2492332..2492405,
FT                   2492651..2492837,2493071..2493189,2493473..2493564,
FT                   2494575..2494694,2494961..2495333,2496280..2496427,
FT                   2498695..2498849,2505697..2505823))
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT9492.2
FT                   protein_id=hCP36418.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="EAW87257.1"
FT                   /translation="MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESS
FT                   VVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFG
FT                   EPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASA
FT                   ASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLT
FT                   TTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWE
FT                   TVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGL
FT                   LDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLR
FT                   LCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLE
FT                   SPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVR
FT                   DSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQG
FT                   LHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFV
FT                   ATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRA
FT                   LCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLP
FT                   RWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGF
FT                   LQGDEADCY"
FT   CDS             complement(join(2489422..2489930,2490006..2490117,
FT                   2490532..2490704,2490897..2490995,2491139..2491241,
FT                   2492332..2492405,2492651..2492837,2493071..2493189,
FT                   2493473..2493564,2494575..2494615))
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281831.0
FT                   protein_id=hCP1787843.0 isoform=CRA_a"
FT                   /protein_id="EAW87255.1"
FT                   /translation="MGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPG
FT                   LLDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVL
FT                   RLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECL
FT                   ESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEV
FT                   RDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQ
FT                   GLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAEGLELAL
FT                   VFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQK
FT                   SCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLR
FT                   SLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY"
FT   CDS             complement(join(2489422..2490117,2490532..2490704,
FT                   2490897..2490995,2491139..2491241,2492332..2492405,
FT                   2492651..2492837,2493071..2493189,2493473..2493564,
FT                   2494575..2494615))
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT1967739.1
FT                   protein_id=hCP1780641.0 isoform=CRA_e"
FT                   /protein_id="EAW87259.1"
FT                   /translation="MGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPG
FT                   LLDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVL
FT                   RLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECL
FT                   ESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEV
FT                   RDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQ
FT                   GLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQF
FT                   VATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALR
FT                   ALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATL
FT                   PRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGG
FT                   FLQGDEADCY"
FT   CDS             complement(2489422..2490297)
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2356918.0
FT                   protein_id=hCP1922137.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="EAW87258.1"
FT                   /translation="MGKLRIGGPCAHCAAWEGVRAGCGPRLHVRGQPPSCTGVLLREPR
FT                   SCHPTNHPHLLPVPQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQF
FT                   VATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALR
FT                   ALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATL
FT                   PRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGG
FT                   FLQGDEADCY"
FT   CDS             complement(2489422..2490051)
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_f"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281832.0
FT                   protein_id=hCP1787841.0 isoform=CRA_f"
FT                   /protein_id="EAW87260.1"
FT                   /translation="MQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLEL
FT                   ALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVA
FT                   QKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAM
FT                   LRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY"
FT   mRNA            complement(join(<2492317..2492405,2492651..2492837,
FT                   2493071..2493189,2493473..2494406))
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, transcript
FT                   variant hCT2281828"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281828.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<2492317..2492405,2492651..2492837,
FT                   2493071..2493189,2493473..2494340))
FT                   /codon_start=1
FT                   /gene="C7orf27"
FT                   /locus_tag="hCG_18433"
FT                   /product="chromosome 7 open reading frame 27, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG18433.3 transcript_id=hCT2281828.0
FT                   protein_id=hCP1787842.0 isoform=CRA_b"
FT                   /protein_id="EAW87256.1"
FT                   /translation="MRELLCSEQGGPADALRSAALPPVPHRSFGWGFRSSPAHTPCGWG
FT                   AWGRCNGRAWGQDRWEGRGWPASVPGGLTIGVEVTSGPAAHRAQGYHEGPALSSGVSEC
FT                   LGESRPGEDGGTGPALQECIVGTLPPPRPRREGRSLPQSGRCTHLGTPGRLGAPHPCPP
FT                   ERALPLSLGAWPGPPGGPSVSAPKDIRSVRPISLVRPVLPATLSHGIPWPVACRECFSG
FT                   GVPTPWLICPRLAGDIRSTANLSRSQGRGTHLAFVSSPQALRTQAFQVLLQPLACVLKA
FT                   TVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQAS
FT                   LLGATVTVLRLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQ
FT                   ALAVLLECLESPGSSPTVRWWG"
FT   gene            2510424..2565813
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /note="gene_id=hCG1788871.2"
FT   mRNA            join(2510424..2510609,2522915..2523043,2523581..2523715,
FT                   2524807..2524877,2529122..2529235,2529356..2529406,
FT                   2533464..2533534,2534521..2534593,2535120..2535169,
FT                   2537092..2537255,2538696..2538751,2540781..2540980,
FT                   2543897..2544001,2545761..2545851,2549340..2549507,
FT                   2552316..2552339,2555756..2555866,2556751..2556872,
FT                   2557999..2558102,2560920..2565813)
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, transcript variant
FT                   hCT1828117"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT1828117.2;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2510440..2510609,2520343..2520388,2522915..2523043,
FT                   2523581..2523715,2524807..2524877,2529122..2529235,
FT                   2529356..2529406,2533464..2533534,2534521..2534593,
FT                   2535120..2535169,2537092..2537255,2538696..2538751,
FT                   2540781..2540980,2543897..2544001,2545761..2545851,
FT                   2549340..2549507,2552316..2552339,2555756..2555866,
FT                   2556751..2556872,2557999..2558102,2560920..2565813)
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, transcript variant
FT                   hCT2281529"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2281529.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2510470..2510609,2518505..2518552,2520343..2520388,
FT                   2522915..2523043,2523581..2523715,2524807..2524877,
FT                   2529122..2529235,2529356..2529406,2533464..2533534,
FT                   2534521..2534593,2535120..2535169,2537092..2537255,
FT                   2538696..2538751,2540781..2540980,2543897..2544001,
FT                   2545761..2545851,2549340..2549507,2552316..2552339,
FT                   2555756..2555866,2556751..2556872,2557999..2558430)
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, transcript variant
FT                   hCT2356916"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2356916.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 14-JUL-2004"
FT   CDS             join(2510574..2510609,2520343..2520388,2522915..2523043,
FT                   2523581..2523715,2524807..2524877,2529122..2529235,
FT                   2529356..2529406,2533464..2533534,2534521..2534593,
FT                   2535120..2535169,2537092..2537255,2538696..2538751,
FT                   2540781..2540980,2543897..2544001,2545761..2545851,
FT                   2549340..2549507,2552316..2552339,2555756..2555866,
FT                   2556751..2556872,2557999..2558102,2560920..2561038)
FT                   /codon_start=1
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, isoform CRA_a"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2281529.0
FT                   protein_id=hCP1787870.0 isoform=CRA_a"
FT                   /protein_id="EAW87261.1"
FT                   /translation="MFLGTGEPALDTKAKRKAFHKPPPTSPKSPYLSKPRKVASWRSLR
FT                   TAGSMPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWTGVPGGTPDCLTDTFRV
FT                   KRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSDVDLMRTKLRRLEEENS
FT                   RKDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKLEQQCKEKDGTISKLQT
FT                   DMKTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKKTGAKRQKKMGSALLSL
FT                   SRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLLRRIVELEKKLSVMESS
FT                   KSHAAEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRDLKEERTALQEQLLQRD
FT                   LEVKQLLQAKADLEKELECAREGEEERREREEVLREEIQTLTSKLQELQEMKKEEKEDC
FT                   PEVPHKAQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDGRRDAAARVLQAQWKVY
FT                   KHKKKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQSSPVPRVPSPI
FT                   AQATGSPVQEEAIVIIQSALRAHLARARHSATGKRTTTAASTRRRSASATHGDASSPPF
FT                   LAALPDPSPSGPQALAPLPGDDVNSDDSDDIVIAPSLPTKNFPV"
FT   CDS             join(2510574..2510609,2518505..2518552,2520343..2520388,
FT                   2522915..2523043,2523581..2523715,2524807..2524877,
FT                   2529122..2529235,2529356..2529406,2533464..2533534,
FT                   2534521..2534593,2535120..2535169,2537092..2537255,
FT                   2538696..2538751,2540781..2540980,2543897..2544001,
FT                   2545761..2545851,2549340..2549507,2552316..2552339,
FT                   2555756..2555866,2556751..2556872,2557999..2558242)
FT                   /codon_start=1
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, isoform CRA_c"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2356916.0
FT                   protein_id=hCP1922129.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A087WX45"
FT                   /db_xref="HGNC:HGNC:29171"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WX45"
FT                   /protein_id="EAW87263.1"
FT                   /translation="MFLGTGEPALDTGDDSLSAVTFDSDVETKAKRKAFHKPPPTSPKS
FT                   PYLSKPRKVASWRSLRTAGSMPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWT
FT                   GVPGGTPDCLTDTFRVKRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSD
FT                   VDLMRTKLRRLEEENSRKDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKL
FT                   EQQCKEKDGTISKLQTDMKTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKK
FT                   TGAKRQKKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLL
FT                   RRIVELEKKLSVMESSKSHAAEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRD
FT                   LKEERTALQEQLLQRDLEVKQLLQAKADLEKELECAREGEEERREREEVLREEIQTLTS
FT                   KLQELQEMKKEEKEDCPEVPHKAQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDG
FT                   RRDAAARVLQAQWKVYKHKKKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVP
FT                   GLPDQSSPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGKRTTTAASTR
FT                   RRSASATHGDASSPPFLAALPGNFIHLDSGTRAAGLLRSQPKSGHLQEARAVSGRKGGV
FT                   SHLELPLN"
FT   mRNA            join(2520346..2520388,2522915..2523043,2523581..2523715,
FT                   2524807..2524877,2529122..2529235,2529356..2529406,
FT                   2533464..2533534,2534521..2534593,2535120..2535169,
FT                   2537092..2537255,2538696..2538751,2540781..2540980,
FT                   2543897..2544001,2545761..2545851,2549340..2549507,
FT                   2552316..2552339,2555756..2555866,2556751..2556872,
FT                   2557999..2558102,2560920..2562830,2563805..2565603)
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, transcript variant
FT                   hCT2356917"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2356917.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 14-JUL-2004"
FT   CDS             join(2522980..2523043,2523581..2523715,2524807..2524877,
FT                   2529122..2529235,2529356..2529406,2533464..2533534,
FT                   2534521..2534593,2535120..2535169,2537092..2537255,
FT                   2538696..2538751,2540781..2540980,2543897..2544001,
FT                   2545761..2545851,2549340..2549507,2552316..2552339,
FT                   2555756..2555866,2556751..2556872,2557999..2558102,
FT                   2560920..2561038)
FT                   /codon_start=1
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, isoform CRA_b"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT2356917.0
FT                   protein_id=hCP1922130.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R853"
FT                   /protein_id="EAW87262.1"
FT                   /translation="MPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWTGVPGGT
FT                   PDCLTDTFRVKRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSDVDLMRT
FT                   KLRRLEEENSRKDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKLEQQCKE
FT                   KDGTISKLQTDMKTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKKTGAKRQ
FT                   KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLLRRIVEL
FT                   EKKLSVMESSKSHAAEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRDLKEERT
FT                   ALQEQLLQRDLEVKQLLQAKADLEKELECAREGEEERREREEVLREEIQTLTSKLQELQ
FT                   EMKKEEKEDCPEVPHKAQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDGRRDAAA
FT                   RVLQAQWKVYKHKKKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQS
FT                   SPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGKRTTTAASTRRRSASA
FT                   THGDASSPPFLAALPDPSPSGPQALAPLPGDDVNSDDSDDIVIAPSLPTKNFPV"
FT   CDS             join(2522980..2523043,2523581..2523715,2524807..2524877,
FT                   2529122..2529235,2529356..2529406,2533464..2533534,
FT                   2534521..2534593,2535120..2535169,2537092..2537255,
FT                   2538696..2538751,2540781..2540980,2543897..2544001,
FT                   2545761..2545851,2549340..2549507,2552316..2552339,
FT                   2555756..2555866,2556751..2556872,2557999..2558102,
FT                   2560920..2561038)
FT                   /codon_start=1
FT                   /gene="IQCE"
FT                   /locus_tag="hCG_1788871"
FT                   /product="IQ motif containing E, isoform CRA_b"
FT                   /note="gene_id=hCG1788871.2 transcript_id=hCT1828117.2
FT                   protein_id=hCP1724576.1 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R853"
FT                   /protein_id="EAW87264.1"
FT                   /translation="MPLGGRASLTPQKLWLGTAKPGSLTQALNSPLTWEHAWTGVPGGT
FT                   PDCLTDTFRVKRPHLRRSASNGHVPGTPVYREKEDMYDEIIELKKSLHVQKSDVDLMRT
FT                   KLRRLEEENSRKDRQIEQLLDPSRGTDFVRTLAEKRPDASWVINGLKQRILKLEQQCKE
FT                   KDGTISKLQTDMKTTNLEEMRIAMETYYEEVHRLQTLLASSETTGKKPLGEKKTGAKRQ
FT                   KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKPRLLRRIVEL
FT                   EKKLSVMESSKSHAAEPVRSHPPACLASSSALHRQPRGDRNKDHERLRGAVRDLKEERT
FT                   ALQEQLLQRDLEVKQLLQAKADLEKELECAREGEEERREREEVLREEIQTLTSKLQELQ
FT                   EMKKEEKEDCPEVPHKAQELPAPTPSSRHCEQDWPPDSSEEGLPRPRSPCSDGRRDAAA
FT                   RVLQAQWKVYKHKKKKAVLDEAAVVLQAAFRGHLTRTKLLASKAHGSEPPSVPGLPDQS
FT                   SPVPRVPSPIAQATGSPVQEEAIVIIQSALRAHLARARHSATGKRTTTAASTRRRSASA
FT                   THGDASSPPFLAALPDPSPSGPQALAPLPGDDVNSDDSDDIVIAPSLPTKNFPV"
FT   gene            2582854..2615714
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /note="gene_id=hCG18437.4"
FT   mRNA            join(2582854..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2612580..2615712)
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), transcript variant
FT                   hCT2356921"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2356921.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   mRNA            join(2582857..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2610850..2610926,2612580..2615714)
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), transcript variant
FT                   hCT9496"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT9496.3; splice
FT                   donor-acceptor pairs covered / total pairs = 13/14; created
FT                   on 26-AUG-2002"
FT   mRNA            join(2582857..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2612580..2615355,2615485..2615712)
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), transcript variant
FT                   hCT2281533"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2281533.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   CDS             join(2583036..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2612580..2612651)
FT                   /codon_start=1
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2356921.0
FT                   protein_id=hCP1922138.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9C0H2"
FT                   /db_xref="HGNC:HGNC:22222"
FT                   /db_xref="InterPro:IPR006990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0H2"
FT                   /protein_id="EAW87266.1"
FT                   /translation="MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLL
FT                   LGAAALACLALDLLFLLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVG
FT                   FYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPE
FT                   PLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVI
FT                   ICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKM
FT                   VEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATK
FT                   DPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTA
FT                   LMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETS
FT                   IPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRP
FT                   DSSGSH"
FT   CDS             join(2583036..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2612580..2612651)
FT                   /codon_start=1
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2281533.0
FT                   protein_id=hCP1787885.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R816"
FT                   /db_xref="InterPro:IPR006990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R816"
FT                   /protein_id="EAW87267.1"
FT                   /translation="MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLL
FT                   LGAAALACLALDLLFLLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVG
FT                   FYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPE
FT                   PLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVI
FT                   ICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKM
FT                   VEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATK
FT                   DPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTA
FT                   LMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETS
FT                   IPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRP
FT                   DSSGSH"
FT   CDS             join(2583036..2583158,2597737..2597906,2598026..2598137,
FT                   2598302..2598522,2598843..2598938,2600477..2600549,
FT                   2600823..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2610850..2610926,2612580..2612595)
FT                   /codon_start=1
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT9496.3
FT                   protein_id=hCP36422.2 isoform=CRA_c"
FT                   /protein_id="EAW87268.1"
FT                   /translation="MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLL
FT                   LGAAALACLALDLLFLLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVG
FT                   FYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPE
FT                   PLRAVQRLQGLLETLLGYTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVI
FT                   ICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKM
FT                   VEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATK
FT                   DPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTA
FT                   LMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETS
FT                   IPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSRYLAALDSGSHAGWQFK
FT                   PMDSARTLCTPPA"
FT   mRNA            join(2598308..2598522,2600477..2600549,2600823..2600898,
FT                   2603097..2603152,2603828..2603920,2607002..2607094,
FT                   2607308..2607444,2609196..2609369,2609850..2609925,
FT                   2612580..2615355,2615485..2615712)
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), transcript variant
FT                   hCT2281531"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2281531.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             join(2600868..2600898,2603097..2603152,2603828..2603920,
FT                   2607002..2607094,2607308..2607444,2609196..2609369,
FT                   2609850..2609925,2612580..2612651)
FT                   /codon_start=1
FT                   /gene="TTYH3"
FT                   /locus_tag="hCG_18437"
FT                   /product="tweety homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=hCG18437.4 transcript_id=hCT2281531.0
FT                   protein_id=hCP1787884.0 isoform=CRA_a"
FT                   /protein_id="EAW87265.1"
FT                   /translation="MVEEYSVLSGDILQYYLACSPRAANPFQQKLSGSHKALVEMQDVV
FT                   AELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDG
FT                   VEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPDEDGEEEAAPGPRQAHDSLYRVHM
FT                   PSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNANFQNPRCENTPLIGRESPPPSYT
FT                   SSMRAKYLATSQPRPDSSGSH"
FT   gene            2630152..2682804
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /note="gene_id=hCG18440.3"
FT   mRNA            join(2630152..2630210,2630502..2630579,2650849..2651370,
FT                   2653339..2653506,2659208..2659336,2659695..2659864,
FT                   2660271..2660447,2662961..>2663506)
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, transcript variant hCT1950356"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT1950356.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2630152..2630210,2630502..2630579,2650849..2651370,
FT                   2653339..2653506,2659208..2659336,2660271..2660447,
FT                   2662961..>2663005)
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, transcript variant hCT2269884"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT2269884.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2638788..2638911,2650849..2651370,2653339..2653506,
FT                   2659208..2659336,2660271..2660447,2681650..2682804)
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, transcript variant hCT9499"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT9499.3; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   CDS             join(2651067..2651370,2653339..2653506,2659208..2659336,
FT                   2659695..2659864,2660271..2660447,2662961..>2663506)
FT                   /codon_start=1
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, isoform CRA_a"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT1950356.1
FT                   protein_id=hCP1761794.1 isoform=CRA_a"
FT                   /db_xref="GOA:A4D202"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="UniProtKB/TrEMBL:A4D202"
FT                   /protein_id="EAW87269.1"
FT                   /translation="MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLA
FT                   EAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLS
FT                   EEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSF
FT                   LKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARFSGEFPKSGPSAP
FT                   DLALVEAAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQG
FT                   ALSLDEALRRPLDLCPICLRKLQHVLGFRLIERYQRLYTWTQAVVGTWPSQEAGEPSVW
FT                   EDTPPASADSGMCCESDSEPGTSVSEPLTPDAGSHTFASGPEEGLSYLAASEAPLPPGG
FT                   PAEAIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSR
FT                   DSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDGEES"
FT   CDS             join(2651067..2651370,2653339..2653506,2659208..2659336,
FT                   2660271..2660447,2662961..>2663005)
FT                   /codon_start=1
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, isoform CRA_c"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT2269884.0
FT                   protein_id=hCP1787934.0 isoform=CRA_c"
FT                   /protein_id="EAW87271.1"
FT                   /translation="MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLA
FT                   EAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLS
FT                   EEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSF
FT                   LKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHGHVPRALPPSGPGELPLAPLPH
FT                   AGCAQPGRGPAAAPGPLSHLPEEAAACPGFQAHREVPETLHLDSGGGGDVAQ"
FT   CDS             join(2659292..2659336,2660271..2660447,2681650..2681823)
FT                   /codon_start=1
FT                   /gene="AMZ1"
FT                   /locus_tag="hCG_18440"
FT                   /product="archaemetzincin-1, isoform CRA_b"
FT                   /note="gene_id=hCG18440.3 transcript_id=hCT9499.3
FT                   protein_id=hCP36413.3 isoform=CRA_b"
FT                   /protein_id="EAW87270.1"
FT                   /translation="MRPGASPSASSFQGTVTCHELCHLLGLGNCRWLRCLMQGALSLDE
FT                   ALRRPLDLCPICLRKLQHVLGFRLIERYQSSLAGWSDSIPEPGIPGHGSEKPTQGPHRQ
FT                   HTPKSLTDSRGGCSTTTNPGASSLTAA"
FT   gene            complement(2672636..2794985)
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /note="gene_id=hCG1991876.1"
FT   mRNA            complement(join(2672636..2672768,2745544..2745759,
FT                   2794503..2794985))
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, transcript variant hCT2270088"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2270088.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 16-MAY-2003"
FT   CDS             complement(join(2672703..2672768,2745544..2745759,
FT                   2794503..2794811))
FT                   /codon_start=1
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, isoform CRA_b"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2270088.1
FT                   protein_id=hCP1787897.1 isoform=CRA_b"
FT                   /protein_id="EAW87273.1"
FT                   /translation="MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDA
FT                   LLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKG
FT                   SRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGI
FT                   REAFSRRSEFQLAPAHAAGGHTAEGTSWTAFWL"
FT   mRNA            complement(join(2679195..2682379,2684082..2684132,
FT                   2745544..2745759,2794503..2794985))
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, transcript variant hCT2270089"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2270089.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-MAY-2003"
FT   mRNA            complement(join(2679195..2682379,2684082..2684132,
FT                   2745544..2745759,2794503..2794559,2794947..2794982))
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, transcript variant hCT2344868"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2344868.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 16-MAY-2003"
FT   CDS             complement(join(2681810..2682379,2684082..2684132,
FT                   2745544..2745759,2794503..2794811))
FT                   /codon_start=1
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, isoform CRA_a"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2270089.1
FT                   protein_id=hCP1787896.0 isoform=CRA_a"
FT                   /protein_id="EAW87272.1"
FT                   /translation="MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDA
FT                   LLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKG
FT                   SRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGI
FT                   REAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIP
FT                   FKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIV
FT                   NNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR
FT                   NRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ"
FT   CDS             complement(join(2681810..2682379,2684082..2684132,
FT                   2745544..2745684))
FT                   /codon_start=1
FT                   /gene="GNA12"
FT                   /locus_tag="hCG_1991876"
FT                   /product="guanine nucleotide binding protein (G protein)
FT                   alpha 12, isoform CRA_c"
FT                   /note="gene_id=hCG1991876.1 transcript_id=hCT2344868.0
FT                   protein_id=hCP1910153.0 isoform=CRA_c"
FT                   /protein_id="EAW87274.1"
FT                   /translation="MFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEF
FT                   QLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQR
FT                   SQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSI
FT                   ILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF
FT                   TTAIDTENVRFVFHAVKDTILQENLKDIMLQ"
FT   gene            complement(2704364..2704685)
FT                   /pseudo
FT                   /locus_tag="hCG_1991877"
FT                   /note="gene_id=hCG1991877.1"
FT   mRNA            complement(2704364..2704685)
FT                   /pseudo
FT                   /locus_tag="hCG_1991877"
FT                   /note="gene_id=hCG1991877.1 transcript_id=hCT2270090.1;
FT                   overlap evidence=yes; created on 16-MAY-2003"
FT   gene            <2786224..2786625
FT                   /locus_tag="hCG_1644059"
FT                   /note="gene_id=hCG1644059.1"
FT   mRNA            <2786224..2786625
FT                   /locus_tag="hCG_1644059"
FT                   /product="hCG1644059"
FT                   /note="gene_id=hCG1644059.1 transcript_id=hCT1644186.1;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             2786224..2786559
FT                   /codon_start=1
FT                   /locus_tag="hCG_1644059"
FT                   /product="hCG1644059"
FT                   /note="gene_id=hCG1644059.1 transcript_id=hCT1644186.1
FT                   protein_id=hCP1619919.1"
FT                   /protein_id="EAW87275.1"
FT                   /translation="MVATMKKTAAEDVNVTFEEQQKINKFAWNTSRITELKEEIEVKQK
FT                   QLQNVEDARDGTMLADADCLMMPYQIGDVFISHSQEETQEMLEAANKNLQEATDALESK
FT                   VEAIQWV"
FT   gene            complement(2855493..2994511)
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /note="gene_id=hCG18438.3"
FT   mRNA            complement(join(2855493..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909264,2994309..2994511))
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   transcript variant hCT1950355"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT1950355.2;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2855493..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883216,2885079..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909264,2994309..2994511))
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   transcript variant hCT1967740"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT1967740.1;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2855493..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879331,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909264,2931152..2931201))
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   transcript variant hCT9497"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT9497.4; splice
FT                   donor-acceptor pairs covered / total pairs = 23/24; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2855493..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909264,2931152..2931201))
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   transcript variant hCT2270083"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT2270083.0;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2857279..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879331,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909139))
FT                   /codon_start=1
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT9497.4
FT                   protein_id=hCP36423.3 isoform=CRA_c"
FT                   /protein_id="EAW87278.1"
FT                   /translation="MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPY
FT                   LRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYK
FT                   LVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEK
FT                   KQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRS
FT                   RDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQ
FT                   ELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKY
FT                   LEEKEDLELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIE
FT                   KDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTII
FT                   SQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLK
FT                   RTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMPPRSRSSIMSITAEPPGNDSIVRRY
FT                   KEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQV
FT                   NLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSV
FT                   KPGSLAEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVN
FT                   HEGYRKLVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRHE
FT                   WLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTL
FT                   QPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLA
FT                   RSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQ
FT                   RLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKN
FT                   KHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEK
FT                   ELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL"
FT   CDS             complement(join(2857279..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909139))
FT                   /codon_start=1
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT1950355.2
FT                   protein_id=hCP1751252.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R854"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R854"
FT                   /protein_id="EAW87276.1"
FT                   /translation="MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPY
FT                   LRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYK
FT                   LVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEK
FT                   KQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRS
FT                   RDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQ
FT                   ELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKY
FT                   LEEKEDLELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIE
FT                   KDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTII
FT                   SQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLK
FT                   RTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRR
FT                   YKEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQ
FT                   VNLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHS
FT                   VKPGSLAEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKV
FT                   NHEGYRKLVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRH
FT                   EWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNT
FT                   LQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSL
FT                   ARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLV
FT                   QRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAK
FT                   NKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKE
FT                   KELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL"
FT   CDS             complement(join(2857279..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883224,2885087..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909139))
FT                   /codon_start=1
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT2270083.0
FT                   protein_id=hCP1787905.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R854"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R854"
FT                   /protein_id="EAW87279.1"
FT                   /translation="MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPY
FT                   LRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYK
FT                   LVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEK
FT                   KQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRS
FT                   RDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQ
FT                   ELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKY
FT                   LEEKEDLELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIE
FT                   KDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTII
FT                   SQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLK
FT                   RTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRR
FT                   YKEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQ
FT                   VNLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHS
FT                   VKPGSLAEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKV
FT                   NHEGYRKLVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRH
FT                   EWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNT
FT                   LQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSL
FT                   ARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLV
FT                   QRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAK
FT                   NKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKE
FT                   KELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL"
FT   CDS             complement(join(2857279..2857483,2860689..2860804,
FT                   2862811..2862935,2863926..2864105,2865876..2866011,
FT                   2867929..2868024,2869130..2869226,2870011..2870251,
FT                   2873269..2873395,2873767..2873968,2874868..2875000,
FT                   2877375..2877427,2879234..2879334,2880628..2880710,
FT                   2883173..2883216,2885079..2885263,2887671..2887868,
FT                   2888541..2888666,2889313..2889465,2890383..2890562,
FT                   2894847..2895172,2896452..2896589,2898208..2898420,
FT                   2909133..2909139))
FT                   /codon_start=1
FT                   /gene="CARD11"
FT                   /locus_tag="hCG_18438"
FT                   /product="caspase recruitment domain family, member 11,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG18438.3 transcript_id=hCT1967740.1
FT                   protein_id=hCP1780638.1 isoform=CRA_b"
FT                   /protein_id="EAW87277.1"
FT                   /translation="MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPY
FT                   LRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYK
FT                   LVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEK
FT                   KQMTLTRVELLTFQERYYKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRS
FT                   RDLQLEIDQLKHRLNKMEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQ
FT                   ELQSIIQAGKRSLPDSDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKY
FT                   LEEKEDLELKCSTLGKDCEMYKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIE
FT                   KDKYRKQIRELEEKNDEMRIEMVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTII
FT                   SQDFGDASPRTNGQEADDSSTSEESPEDSKYFLPYHPPQRRMNLKGIQVHGAKSPISLK
FT                   RTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRR
FT                   YKEDAPHRSTVEEDNDSGGFDALDLDDDSHERYSFGPSSIHSSSSSHQSEGLDAYDLEQ
FT                   VNLMFRKFSLERPFRPSVTSVGHVRGPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHS
FT                   VKPGSLAEKAGLREGHQLLLLEGCIRGERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKV
FT                   NHEGYRKLVKDMEDGLITSGDSFYIRLNLNISSQLDACTMSLKCDDVVHVRDTMYQDRH
FT                   EWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNT
FT                   LQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSL
FT                   ARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLV
FT                   QRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAK
FT                   NKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKE
FT                   KELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL"
FT   gene            complement(<2885944..>2886291)
FT                   /locus_tag="hCG_1991874"
FT                   /note="gene_id=hCG1991874.0"
FT   mRNA            complement(<2885944..>2886291)
FT                   /locus_tag="hCG_1991874"
FT                   /product="hCG1991874"
FT                   /note="gene_id=hCG1991874.0 transcript_id=hCT2270086.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             complement(<2885944..2886291)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1991874"
FT                   /product="hCG1991874"
FT                   /note="gene_id=hCG1991874.0 transcript_id=hCT2270086.0
FT                   protein_id=hCP1787909.0"
FT                   /protein_id="EAW87280.1"
FT                   /translation="MKECLLQGKCYHYYSSGFTECCHVQVPRNVPSVHYLIYPTELSCM
FT                   ESMLSVLIYKGRDPDQARWLRPVIPALWEDPCSRLQLQREHRPGISPLCCQQGMTGASI
FT                   RLQSGSQGAAGG"
FT   gene            complement(3033879..>3037054)
FT                   /locus_tag="hCG_2041869"
FT                   /note="gene_id=hCG2041869.0"
FT   mRNA            complement(join(3033879..3034249,3036983..>3037054))
FT                   /locus_tag="hCG_2041869"
FT                   /product="hCG2041869"
FT                   /note="gene_id=hCG2041869.0 transcript_id=hCT2347100.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(3033937..>3034212)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041869"
FT                   /product="hCG2041869"
FT                   /note="gene_id=hCG2041869.0 transcript_id=hCT2347100.0
FT                   protein_id=hCP1910790.0"
FT                   /protein_id="EAW87281.1"
FT                   /translation="ITSIQGMCSHISELLRNIWLDKVEFKQAINQTRVWFRTSPQSEFL
FT                   GAAPQLVGWAGSVVLVLASRANHSFTICLSHIPGRQAEDSTHLNGT"
FT   gene            complement(<3054981..>3055310)
FT                   /locus_tag="hCG_1991872"
FT                   /note="gene_id=hCG1991872.0"
FT   mRNA            complement(<3054981..>3055310)
FT                   /locus_tag="hCG_1991872"
FT                   /product="hCG1991872"
FT                   /note="gene_id=hCG1991872.0 transcript_id=hCT2270081.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(<3054981..3055310)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1991872"
FT                   /product="hCG1991872"
FT                   /note="gene_id=hCG1991872.0 transcript_id=hCT2270081.0
FT                   protein_id=hCP1787894.0"
FT                   /protein_id="EAW87282.1"
FT                   /translation="MTPEHPAIPLFLKSTSLPGRYPGLLLATFQDSVERSLPLVPGSLF
FT                   HLTTSYGAFIFAWTCEFPEASFVSPAHCCTAKSWDGVATPQGFETSNQHSKSWRWGRHR
FT                   GTRGEG"
FT   gene            complement(3097611..>3125263)
FT                   /locus_tag="hCG_2038867"
FT                   /note="gene_id=hCG2038867.0"
FT   mRNA            complement(join(3097611..3097889,3108749..3108866,
FT                   3116642..3116742,3125206..>3125263))
FT                   /locus_tag="hCG_2038867"
FT                   /product="hCG2038867"
FT                   /note="gene_id=hCG2038867.0 transcript_id=hCT2343293.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 07-APR-2003"
FT   CDS             complement(join(3108780..3108866,3116642..3116742,
FT                   3125206..>3125251))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038867"
FT                   /product="hCG2038867"
FT                   /note="gene_id=hCG2038867.0 transcript_id=hCT2343293.0
FT                   protein_id=hCP1908184.0"
FT                   /protein_id="EAW87283.1"
FT                   /translation="WLRAQASLGKEGERTGSRSVSQAGVQWHDHSSLQPQLLGSSKPPA
FT                   SASQKRNQFWTGGCLPAFALPASPHILLWQGE"
FT   gene            <3288669..3289216
FT                   /locus_tag="hCG_1642689"
FT                   /note="gene_id=hCG1642689.3"
FT   mRNA            <3288669..3289216
FT                   /locus_tag="hCG_1642689"
FT                   /product="hCG1642689, transcript variant hCT1642816"
FT                   /note="gene_id=hCG1642689.3 transcript_id=hCT1642816.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   mRNA            join(<3288669..3288704,3288902..>3289141)
FT                   /locus_tag="hCG_1642689"
FT                   /product="hCG1642689, transcript variant hCT2269844"
FT                   /note="gene_id=hCG1642689.3 transcript_id=hCT2269844.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(3288669..3288704,3288902..>3289141)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642689"
FT                   /product="hCG1642689, isoform CRA_b"
FT                   /note="gene_id=hCG1642689.3 transcript_id=hCT2269844.0
FT                   protein_id=hCP1787930.0 isoform=CRA_b"
FT                   /protein_id="EAW87285.1"
FT                   /translation="MMNDKEKRERHLVRARLLPRELMCVLSTLSTLKSQDSFLKHVKEN
FT                   DQKKKEAKEKCTRVQLKSQPVPREAHFVRSSGEEPELLGCLSYESMA"
FT   CDS             3288669..3288932
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642689"
FT                   /product="hCG1642689, isoform CRA_a"
FT                   /note="gene_id=hCG1642689.3 transcript_id=hCT1642816.2
FT                   protein_id=hCP1622088.2 isoform=CRA_a"
FT                   /protein_id="EAW87284.1"
FT                   /translation="MMNDKEKRERHLVCSLGLLENMDLFFWPHTCKSIRKMILETSREW
FT                   VLFRKEAPQVLPWQNCKSLRCYSACCWHCKQTRSGHDSCQEN"
FT   gene            <3584616..4217601
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /note="gene_id=hCG2036979.0"
FT   mRNA            join(<3584616..3584650,3589534..3589640,3592488..3592635,
FT                   3771932..3772065,3901392..3901503,3902199..3902389,
FT                   3909402..3909485,3913128..3913322,3917292..3917408,
FT                   3919231..3919398,3921440..3921542,3924344..3924520,
FT                   3939227..3939363,3963006..3963153,3964135..3964275,
FT                   3969197..3969378,4001374..4001489,4003664..4003856,
FT                   4019845..4019943,4029005..4029196,4031471..4031592,
FT                   4062643..4062752,4065269..4065419,4066017..4066254,
FT                   4079361..4079476,4081888..4082077,4084303..4084401,
FT                   4097569..4097763,4101109..4101310,4110294..4110397,
FT                   4113632..4113702,4126071..4126206,4127624..4127683,
FT                   4130334..4130435,4157644..4157759,4159864..4160050,
FT                   4161790..4161927,4171874..4172035,4173004..4173129,
FT                   4185016..4185180,4189408..4189545,4193554..4193674,
FT                   4197437..4197566,4216319..4217601)
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), transcript variant
FT                   hCT2341327"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341327.0;
FT                   splice donor-acceptor pairs covered / total pairs = 43/43;
FT                   created on 12-MAR-2003"
FT   CDS             join(3584616..3584650,3589534..3589640,3592488..3592635,
FT                   3771932..3772065,3901392..3901503,3902199..3902389,
FT                   3909402..3909485,3913128..3913322,3917292..3917408,
FT                   3919231..3919398,3921440..3921542,3924344..3924520,
FT                   3939227..3939363,3963006..3963153,3964135..3964275,
FT                   3969197..3969378,4001374..4001489,4003664..4003856,
FT                   4019845..4019943,4029005..4029196,4031471..4031592,
FT                   4062643..4062752,4065269..4065419,4066017..4066254,
FT                   4079361..4079476,4081888..4082077,4084303..4084401,
FT                   4097569..4097763,4101109..4101310,4110294..4110397,
FT                   4113632..4113702,4126071..4126206,4127624..4127683,
FT                   4130334..4130435,4157644..4157759,4159864..4160050,
FT                   4161790..4161927,4171874..4172035,4173004..4173129,
FT                   4185016..4185180,4189408..4189545,4193554..4193674,
FT                   4197437..4197566,4216319..4216579)
FT                   /codon_start=1
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), isoform CRA_a"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341327.0
FT                   protein_id=hCP1907910.0 isoform=CRA_a"
FT                   /protein_id="EAW87286.1"
FT                   /translation="MLCLRAGTCRGRYIIPSLQKLDAGFYRCVVRNRMGALLQRKSEVQ
FT                   VAYMGSFMDTDQRKTVSQGRAAILNLLPITSYPRPQVTWFREGHKIIPSNRIAITLENQ
FT                   LVILATTTSDAGAYYVQAVNEKNGENKTSPFIHLSIARDVGTPETMAPTIVVPPGNRSV
FT                   VAGSSETTLECIASARPVEDLSVTWKRNGVRITSGLHSFGRRLTISNPTSADTGPYVCE
FT                   AALPGSAFEPARATAFLFIIEPPYFTAEPESRISAEVEETVDIGCQAMGVPLPTLQWYK
FT                   DAISISRLQNPRYKVLASGGLRIQKLRPEDSGIFQCFASNEGGEIQTHTYLDVTNIAPV
FT                   FTQRPVDTTVTDGMTAILRCEVSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQI
FT                   APVFIQDAGNYTCYAANTEGSLNASATLTVWNRTSIVHPPEDHVVIKGTTATLHCGATH
FT                   DPRVSLRYVWKKDNVALTPSSTSRIVVEKDGSLLISQTWSGDIGDYSCEIVSEGGNDSR
FT                   MARLEVIELPHSPQNLLVSPNSSHSHAVVLSWVRPFDGNSPILYYIVELSENNSPWKVH
FT                   LSNVGPEMTGVTVSGLTPARTYQFRVCAVNEVGRGQYSAETSRLMLPEEPPSAPPKNIV
FT                   ASGRTNQSIMVQWQPPPETEHNGVLRGYILRYRLAGLPGEYQQRNITSPEVNYCLVTDL
FT                   IIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQTEAVNSTTIQFLWNPPP
FT                   QQFINGINQGYKLLAWPADAPEAVTVVTIAPDFHGVHHGHITNLKKFTAYFTSVLCFTT
FT                   PGDGPPSTPQLVWTQEDKPGAVGHLSFTEILDTSLKVSWQEPLEKNGIITGYQISWEVY
FT                   GRNNSRLTHTLNSTTHEYKIQGLSSLTTYTIDVAAVTAVGTGLVTSSTISSGVPPDLPG
FT                   APSNLVISNISPRSATLQFRPGYDGKTSISRWIVEGQVGAIGDEEEWVTLYEEENEPDA
FT                   QMLEIPNLTPYTHYRFRMKQVNIVGPSPYSPSSRVIQTLQAPPDVAPTSVTVRTASETS
FT                   LRLRWVPLPDSQYNGNPESVGYRIKYWRSDLQSSAVAQVVSDRLEREFTIEELEEWMEY
FT                   ELQMQAFNAVGAGPWSEVVRGRTRESVPSAAPENVSAEAVSSTQILLTWTSVPEQDQNG
FT                   LILGYKILFRAKDLDPEPRSHIVRGNHTQSALLAGLRKFVLYELQVLAFTRIGNGVPST
FT                   PLILERTKDDAPGPPVRLVFPEVRLTSVRIVWQPPEEPNGIILGYQIAYRLASSSPHTF
FT                   TTVEVGATVRQFTATDLAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPPRELL
FT                   VPQAEVTARSLRLQWVPGSDGASPIRYFTMQVRELPRGEWQTYSSSISHEATACVVDRL
FT                   RPFTSYKLRLKATNDIGDSDFSSETEAVTTLQDVPGEPPGSVSATPHTTSSVLIQWQPP
FT                   RDESLNGLLQGYRIYYRELEYEAGSGTEAKTLKNPIALRAELTAQSSFKTVNSSSTSTM
FT                   CELTHLKKYRRYEVIMTAYNIIGESPASAPVEVFVGEAAPAMAPQNVQVTPLTASQLEV
FT                   TWDPPPPESQNGNIQGYKIYYWEADSQNETEKMKVLFLPEPVVRLKNLTSHTKYLVSIS
FT                   AFNAAGDGPKSDPQQGRTHQAAPGAPSFLAFSEITSTTLNVSWGEPAAANGILQGYRVV
FT                   YEPLAPVQGVSKVVTVEVRGNWQRWLKVRDLTKGVTYFFRVQARTITYGPELQANITAG
FT                   PAEGSPGSPRDVLVTKSASELTLQWTEGHSGDTPTTGYVIEARPSDEGLWDMFVKDIPR
FT                   SATSYTLSLDKLRQGVTYEFRVVAVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMA
FT                   LSSLIVILLVVFALVLHGQNKKYKNCSTGKGISTMEESVTLDNGGFAALELSSRHLNVK
FT                   STFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLTESVSLKEKSADASESEATDSDY
FT                   EDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYEAVAGSEAGAQLHPVITTQSAG
FT                   GVYTPAGPGARTPLTGFSSFV"
FT   mRNA            join(<3584616..3584650,3589534..3589640,3592488..3592635,
FT                   3604994..3605063,3605165..3605215)
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), transcript variant
FT                   hCT2341328"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341328.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/4;
FT                   created on 12-MAR-2003"
FT   CDS             join(<3584645..3584650,3589534..3589640,3592488..3592602)
FT                   /codon_start=1
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), isoform CRA_b"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341328.0
FT                   protein_id=hCP1907911.0 isoform=CRA_b"
FT                   /protein_id="EAW87287.1"
FT                   /translation="RQVHYSIFAEARCWVLPLRGAKQNGSTPAKKIRSSSRIYGKFHGY
FT                   GPEENSFSRTCSDSKPAAHHQLPQTSSDLV"
FT   mRNA            join(3771932..3772065,3901392..3901503,3902199..3902389,
FT                   3908511..3908844,3909402..3909485,3910598..3910789,
FT                   3913128..3913322,3913874..>3914052)
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), transcript variant
FT                   hCT2341326"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341326.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/7;
FT                   created on 12-MAR-2003"
FT   gene            complement(3814608..>3815496)
FT                   /locus_tag="hCG_1991885"
FT                   /note="gene_id=hCG1991885.0"
FT   mRNA            complement(3814608..>3815496)
FT                   /locus_tag="hCG_1991885"
FT                   /product="hCG1991885"
FT                   /note="gene_id=hCG1991885.0 transcript_id=hCT2270098.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(3814990..3815496)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1991885"
FT                   /product="hCG1991885"
FT                   /note="gene_id=hCG1991885.0 transcript_id=hCT2270098.0
FT                   protein_id=hCP1787915.0"
FT                   /protein_id="EAW87289.1"
FT                   /translation="MCSELAPLRDQWSESKLKWDSLLNMEDLCWGKMLLTHICFLLCGE
FT                   NALSSLLVLVIHYCHSLFLCSLILSLTGERSVTELIGEFGSNKQGVFPGAPSSFPLLSR
FT                   LDQEAHQLCPSHPQGCLRLDGQGQLCPSRPWGCLRLGGQVQLWFCCLETYFLAEILATS
FT                   LISVY"
FT   CDS             join(3909482..3909485,3910598..3910789,3913128..3913322,
FT                   3913874..>3914052)
FT                   /codon_start=1
FT                   /gene="SDK1"
FT                   /locus_tag="hCG_2036979"
FT                   /product="sidekick homolog 1 (chicken), isoform CRA_c"
FT                   /note="gene_id=hCG2036979.0 transcript_id=hCT2341326.0
FT                   protein_id=hCP1907912.0 isoform=CRA_c"
FT                   /protein_id="EAW87288.1"
FT                   /translation="MAPKREMIFTVPQENQALESMVKYSAKGTGPLNEMGSFSGEVIAQ
FT                   CVACGSYSLNTGYLTYLGPHGVPLPTLQWYKDAISISRLQNPRYKVLASGGLRIQKLRP
FT                   EDSGIFQCFASNEGGEIQTHTYLDVTSSQLPDLDVSSEHTQADGYPDVSSGYTHAHGYP
FT                   DVSSGYTLAHSYLDVSSGYTYQQSQTC"
FT   assembly_gap    3926288..3928710
FT                   /estimated_length=2423
FT                   /gap_type="unknown"
FT   gene            4218852..4220192
FT                   /locus_tag="hCG_1991810"
FT                   /note="gene_id=hCG1991810.0"
FT   mRNA            4218852..4220192
FT                   /locus_tag="hCG_1991810"
FT                   /product="hCG1991810"
FT                   /note="gene_id=hCG1991810.0 transcript_id=hCT2269982.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             4219466..4219945
FT                   /codon_start=1
FT                   /locus_tag="hCG_1991810"
FT                   /product="hCG1991810"
FT                   /note="gene_id=hCG1991810.0 transcript_id=hCT2269982.0
FT                   protein_id=hCP1787971.0"
FT                   /protein_id="EAW87290.1"
FT                   /translation="MGVQSSLLLGCQGRDSRQVSRQRAARPHPLGLLHGHLLGESVQPK
FT                   PLSPASPSASLPACFYKAHFTQCCSQKTRGPRERGPRWPHTERASTAPGGGSLCTGLRR
FT                   PCLYLTVTGLKHDVCLMVRSMVFISYAFLAHSVAILLTSNPSAYLSVAPRGSASW"
FT   assembly_gap    4535858..4542565
FT                   /estimated_length=6708
FT                   /gap_type="unknown"
FT   assembly_gap    4622793..4624099
FT                   /estimated_length=1307
FT                   /gap_type="unknown"
FT   gene            4624265..4704955
FT                   /gene="FOXK1"
FT                   /locus_tag="hCG_14961"
FT                   /note="gene_id=hCG14961.2"
FT   mRNA            join(4624265..4624545,4682514..4682699,4696138..4696294,
FT                   4696916..4697062,4698673..4698866,4700730..4700896,
FT                   4700990..4701274,4702743..4702967,4703863..4704955)
FT                   /gene="FOXK1"
FT                   /locus_tag="hCG_14961"
FT                   /product="forkhead box K1"
FT                   /note="gene_id=hCG14961.2 transcript_id=hCT5982.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             join(4624337..4624545,4682514..4682699,4696138..4696294,
FT                   4696916..4697062,4698673..4698866,4700730..4700896,
FT                   4700990..4701274,4702743..4702967,4703863..4704143)
FT                   /codon_start=1
FT                   /gene="FOXK1"
FT                   /locus_tag="hCG_14961"
FT                   /product="forkhead box K1"
FT                   /note="gene_id=hCG14961.2 transcript_id=hCT5982.3
FT                   protein_id=hCP35163.3"
FT                   /protein_id="EAW87291.1"
FT                   /translation="MRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRC
FT                   LGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQ
FT                   ISPLKIHIPEPDLRSMVSPVPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAA
FT                   EFAAKAASEQQADTSGGDSPKDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHY
FT                   PYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR
FT                   QRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGLQTPECLSREGSPIPHDPEFGSKL
FT                   ASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVV
FT                   QQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAF
FT                   ATIPAAGGVIQTVASQMAPGVPGHTVTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNS
FT                   LAGNAYALTSPLQLLATQASSSAPVVVTRVCEVGPKEPAAAVAATATTTPATATTASAS
FT                   ASSTGEPEVKRSRVEEPSGAVTTPAGVIAAAGPQGPGTGE"
FT   gene            complement(4705642..4710654)
FT                   /locus_tag="hCG_1991952"
FT                   /note="gene_id=hCG1991952.0"
FT   mRNA            complement(join(4705642..4706624,4709096..4709792,
FT                   4710114..4710654))
FT                   /locus_tag="hCG_1991952"
FT                   /product="hCG1991952"
FT                   /note="gene_id=hCG1991952.0 transcript_id=hCT2270235.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(4710337..4710606)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1991952"
FT                   /product="hCG1991952"
FT                   /note="gene_id=hCG1991952.0 transcript_id=hCT2270235.0
FT                   protein_id=hCP1787939.0"
FT                   /protein_id="EAW87292.1"
FT                   /translation="MAGPEGRPPLTDPQGFILQGLGCFSGQESDLPAAGTDLDVTDRHG
FT                   EVHQSETNPPHHSPRSSLSRGLLICPESLLTHLQEKPAQLHTPR"
FT   gene            <4710900..4713117
FT                   /locus_tag="hCG_2038376"
FT                   /note="gene_id=hCG2038376.0"
FT   mRNA            join(<4710900..4711114,4711405..4711446,4712182..4713117)
FT                   /locus_tag="hCG_2038376"
FT                   /product="hCG2038376"
FT                   /note="gene_id=hCG2038376.0 transcript_id=hCT2342802.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 07-APR-2003"
FT   CDS             join(<4711095..4711114,4711405..4711446,4712182..4712611)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038376"
FT                   /product="hCG2038376"
FT                   /note="gene_id=hCG2038376.0 transcript_id=hCT2342802.0
FT                   protein_id=hCP1908185.0"
FT                   /protein_id="EAW87293.1"
FT                   /translation="SGLQVTLHRAWPLSLFLLLTHLGNRGRLCLKNNNQIKYFKFGSSF
FT                   FQERLFGYLEYLHVCGLISVSGKGGREERQQPCSRVCPEMSLSPDTWAARALQMTKAGS
FT                   SAHVQEGLKPILSFCSCCFNLNDYSPVKIIWEGRVLFGVCVCVCVCVCVCIFFFTVAPV
FT                   "
FT   gene            4717164..4736075
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /note="gene_id=hCG1991828.0"
FT   mRNA            join(4717164..4717435,4722854..4722995,4723254..4723433,
FT                   4724995..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4731893..4732270,
FT                   4732352..4732566,4732794..4736075)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2270009"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270009.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4717164..4717435,4722854..4722991,4723247..4723433,
FT                   4724995..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4731893..4732270,
FT                   4732352..4732566,4732794..4736075)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2270011"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270011.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4717164..4717435,4722854..4722991,4723247..4723433,
FT                   4724995..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4732138..4732270,
FT                   4732352..4732566,4732794..4736075)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2270013"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270013.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4717164..4717435,4722854..4722991,4723247..4723433,
FT                   4724995..4725105,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4732138..4732270,
FT                   4732352..4732566,4732794..4736075)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2270012"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270012.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4717164..4717435,4722854..4722991,4724995..4725105,
FT                   4725368..4725477,4725882..4726050,4726587..4726727,
FT                   4727094..4727131,4727201..4727363,4727929..4728107,
FT                   4729313..4729455,4729833..4729973,4730519..4730630,
FT                   4731511..4731608,4732138..4732270,4732352..4732566,
FT                   4732794..4736075)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2270007"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270007.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4717312..4717435,4724995..4725139,4725368..4725477,
FT                   4725882..4726050,4726587..4726727,4727094..4727131,
FT                   4727201..4727363,4727929..4728107,4729313..4729455,
FT                   4729833..4729973,4730519..4730630,4731511..4732270,
FT                   4732352..4732566,4732794..4733429)
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, transcript variant hCT2356919"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2356919.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   CDS             join(4717395..4717435,4722854..4722991,4723247..4723433,
FT                   4724995..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4732138..4732270,
FT                   4732352..4732566,4732794..4733064)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_b"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270013.0
FT                   protein_id=hCP1787976.0 isoform=CRA_b"
FT                   /protein_id="EAW87295.1"
FT                   /translation="MFSAGAESLLHQAREIQDEELKKFCSRICKLLQAEDLGPDTLDSL
FT                   QRLFLIISATKYSRRLEKTCVDLLQATLGLPACPEQLQVLCAAILREMSPSDSLSLAWD
FT                   HTQNSRQLSLVASVLLAQGDRNEEVRAVGQGVLRALESRQPEGPSLRHLLPVMAKVVVL
FT                   SPGTLQEDQATLLSKRLVDWLRYASLQQGLPHSGGFFSTPRARQPGPVTEVDGAVATDF
FT                   FTVLSSGHRFTDDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATS
FT                   SAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDP
FT                   SFLYRSLSCLKALHGRVRGDPASVRVLLPLAHFFLSHGEAAAVDSEAVYQHLFTRIPVE
FT                   QFHSPMLAFEFIQFCRDNLHLFSGHLSTLRLSFPNLFKFLAWNSPPLTSEFVALLPALV
FT                   DAGTALEMLHALLDLPCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEAFRDPQFQGL
FT                   FQYLLRPKASGATERLAPLHQLLQPMAGCARVAQCAQAVPTLLQAFFSAVTQVADGSLI
FT                   NQLALLLLGRSDSLYPAPGYAAGVHSVLSSQFLALCTLKPSLVVELARDLLEFLGSVNG
FT                   LCSRASLVTSVVWAIGEYLSVTYDRRCTVEQINKFFEALEALLFEVTQCRPSAALPRCP
FT                   PQVVTVLMTTLTKLASRSQDLIPRASLLLSKMRTLAHSPATSSTHSEEGAEAIRTRATE
FT                   LLTLLKMPSVAQFVLTPSTEVCSPRYHRDANTALPLALRTVSRLVEREAGLMPG"
FT   CDS             join(4717395..4717435,4722854..4722991,4723247..4723433,
FT                   4724995..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731608,4731893..4731929)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_e"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270011.0
FT                   protein_id=hCP1787974.0 isoform=CRA_e"
FT                   /protein_id="EAW87299.1"
FT                   /translation="MFSAGAESLLHQAREIQDEELKKFCSRICKLLQAEDLGPDTLDSL
FT                   QRLFLIISATKYSRRLEKTCVDLLQATLGLPACPEQLQVLCAAILREMSPSDSLSLAWD
FT                   HTQNSRQLSLVASVLLAQGDRNEEVRAVGQGVLRALESRQPEGPSLRHLLPVMAKVVVL
FT                   SPGTLQEDQATLLSKRLVDWLRYASLQQGLPHSGGFFSTPRARQPGPVTEVDGAVATDF
FT                   FTVLSSGHRFTDDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATS
FT                   SAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDP
FT                   SFLYRSLSCLKALHGRVRGDPASVRVLLPLAHFFLSHGEAAAVDSEAVYQHLFTRIPVE
FT                   QFHSPMLAFEFIQFCRDNLHLFSGHLSTLRLSFPNLFKFLAWNSPPLTSEFVALLPALV
FT                   DAGTALEMLHALLDLPCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEAFRDPQFQGL
FT                   FQYLLRPKASGATERLAPLHQLLQPMAGCARVAQCAQAVPTLLQAFFSAVTQVADGSLI
FT                   NQLALLLLGRSDSLYPAPGYAAGVHRPDACRPILVPL"
FT   CDS             join(4723344..4723433,4724995..4725139,4725368..4725477,
FT                   4725882..4726050,4726587..4726727,4727094..4727131,
FT                   4727201..4727363,4727929..4728107,4729313..4729455,
FT                   4729833..4729973,4730519..4730630,4731511..4731608,
FT                   4731893..4731929)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_a"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270009.0
FT                   protein_id=hCP1787975.0 isoform=CRA_a"
FT                   /protein_id="EAW87294.1"
FT                   /translation="MSPSDSLSLAWDHTQNSRQLSLVASVLLAQGDRNEEVRAVGQGVL
FT                   RALESRQPEGPSLRHLLPVMAKVVVLSPGTLQEDQATLLSKRLVDWLRYASLQQGLPHS
FT                   GGFFSTPRARQPGPVTEVDGAVATDFFTVLSSGHRFTDDQWLNVQAFSMLRAWLLHSGP
FT                   EGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALR
FT                   KGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASVRVLLPLAHF
FT                   FLSHGEAAAVDSEAVYQHLFTRIPVEQFHSPMLAFEFIQFCRDNLHLFSGHLSTLRLSF
FT                   PNLFKFLAWNSPPLTSEFVALLPALVDAGTALEMLHALLDLPCLTAVLDLQLRSAPAAS
FT                   ERPLWDTSLRAPSCLEAFRDPQFQGLFQYLLRPKASGATERLAPLHQLLQPMAGCARVA
FT                   QCAQAVPTLLQAFFSAVTQVADGSLINQLALLLLGRSDSLYPAPGYAAGVHRPDACRPI
FT                   LVPL"
FT   CDS             join(4725097..4725139,4725368..4725477,4725882..4726050,
FT                   4726587..4726727,4727094..4727131,4727201..4727363,
FT                   4727929..4728107,4729313..4729455,4729833..4729973,
FT                   4730519..4730630,4731511..4731612)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_c"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2356919.0
FT                   protein_id=hCP1922140.0 isoform=CRA_c"
FT                   /protein_id="EAW87296.1"
FT                   /translation="MAKVVVLSPGTLQEDQATLLSKRLVDWLRYASLQQGLPHSGGFFS
FT                   TPRARQPGPVTEVDGAVATDFFTVLSSGHRFTDDQWLNVQAFSMLRAWLLHSGPEGPGT
FT                   LDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSD
FT                   LQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASVRVLLPLAHFFLSHG
FT                   EAAAVDSEAVYQHLFTRIPVEQFHSPMLAFEFIQFCRDNLHLFSGHLSTLRLSFPNLFK
FT                   FLAWNSPPLTSEFVALLPALVDAGTALEMLHALLDLPCLTAVLDLQLRSAPAASERPLW
FT                   DTSLRAPSCLEAFRDPQFQGLFQYLLRPKASGATERLAPLHQLLQPMAGCARVAQCAQA
FT                   VPTLLQAFFSAVTQVADGSLINQLALLLLGRSDSLYPAPGYAAGVHR"
FT   CDS             join(4725993..4726050,4726587..4726727,4727094..4727131,
FT                   4727201..4727363,4727929..4728107,4729313..4729455,
FT                   4729833..4729973,4730519..4730630,4731511..4731608,
FT                   4732138..4732270,4732352..4732566,4732794..4733064)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_d"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270007.0
FT                   protein_id=hCP1787979.0 isoform=CRA_d"
FT                   /db_xref="GOA:A0A024R817"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR028222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R817"
FT                   /protein_id="EAW87297.1"
FT                   /translation="MLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPP
FT                   RERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
FT                   CLKALHGRVRGDPASVRVLLPLAHFFLSHGEAAAVDSEAVYQHLFTRIPVEQFHSPMLA
FT                   FEFIQFCRDNLHLFSGHLSTLRLSFPNLFKFLAWNSPPLTSEFVALLPALVDAGTALEM
FT                   LHALLDLPCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEAFRDPQFQGLFQYLLRPK
FT                   ASGATERLAPLHQLLQPMAGCARVAQCAQAVPTLLQAFFSAVTQVADGSLINQLALLLL
FT                   GRSDSLYPAPGYAAGVHSVLSSQFLALCTLKPSLVVELARDLLEFLGSVNGLCSRASLV
FT                   TSVVWAIGEYLSVTYDRRCTVEQINKFFEALEALLFEVTQCRPSAALPRCPPQVVTVLM
FT                   TTLTKLASRSQDLIPRASLLLSKMRTLAHSPATSSTHSEEGAEAIRTRATELLTLLKMP
FT                   SVAQFVLTPSTEVCSPRYHRDANTALPLALRTVSRLVEREAGLMPG"
FT   CDS             join(4725993..4726050,4726587..4726727,4727094..4727131,
FT                   4727201..4727363,4727929..4728107,4729313..4729455,
FT                   4729833..4729973,4730519..4730630,4731511..4731608,
FT                   4732138..4732270,4732352..4732566,4732794..4733064)
FT                   /codon_start=1
FT                   /gene="KIAA0415"
FT                   /locus_tag="hCG_1991828"
FT                   /product="KIAA0415 protein, isoform CRA_d"
FT                   /note="gene_id=hCG1991828.0 transcript_id=hCT2270012.0
FT                   protein_id=hCP1787980.0 isoform=CRA_d"
FT                   /db_xref="GOA:A0A024R817"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR028222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R817"
FT                   /protein_id="EAW87298.1"
FT                   /translation="MLRAWLLHSGPEGPGTLDTDDRSEQEGSTLSVISATSSAGRLLPP
FT                   RERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLS
FT                   CLKALHGRVRGDPASVRVLLPLAHFFLSHGEAAAVDSEAVYQHLFTRIPVEQFHSPMLA
FT                   FEFIQFCRDNLHLFSGHLSTLRLSFPNLFKFLAWNSPPLTSEFVALLPALVDAGTALEM
FT                   LHALLDLPCLTAVLDLQLRSAPAASERPLWDTSLRAPSCLEAFRDPQFQGLFQYLLRPK
FT                   ASGATERLAPLHQLLQPMAGCARVAQCAQAVPTLLQAFFSAVTQVADGSLINQLALLLL
FT                   GRSDSLYPAPGYAAGVHSVLSSQFLALCTLKPSLVVELARDLLEFLGSVNGLCSRASLV
FT                   TSVVWAIGEYLSVTYDRRCTVEQINKFFEALEALLFEVTQCRPSAALPRCPPQVVTVLM
FT                   TTLTKLASRSQDLIPRASLLLSKMRTLAHSPATSSTHSEEGAEAIRTRATELLTLLKMP
FT                   SVAQFVLTPSTEVCSPRYHRDANTALPLALRTVSRLVEREAGLMPG"
FT   gene            complement(4736333..4824820)
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /note="gene_id=hCG1991943.2"
FT   mRNA            complement(join(4736333..4736621,4738735..4741162,
FT                   4741309..4741448,4741850..4741989,4743332..4743674,
FT                   4744661..4744869,4746681..4746831,4756393..4756565,
FT                   4757343..4757580,4758354..4758466,4763509..4763669,
FT                   4773256..4773293,4775722..4776354,4777473..4777720,
FT                   4818718..4819316,4824706..4824820))
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, transcript variant
FT                   hCT2270217"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270217.2;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 08-JAN-2004"
FT   mRNA            complement(join(4736333..4736621,4738735..4741162,
FT                   4741309..4741448,4741850..4741989,4743332..4743674,
FT                   4744661..4744869,4746681..4746831,4756393..4756565,
FT                   4757343..4757580,4758354..4758466,4763509..4763669,
FT                   4773256..4773293,4775722..4776349,4777473..4777720,
FT                   4818718..4819316,4824706..4824764))
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, transcript variant
FT                   hCT2356920"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2356920.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(4736333..4736621,4738735..4741162,
FT                   4741309..4741448,4741850..4741989,4743332..4743674,
FT                   4744661..4744869,4746681..4746831,4756393..4756565,
FT                   4757343..4757580,4758354..4758466,4763509..4763669,
FT                   4773256..4773293,4775722..4776354,4777473..4777720,
FT                   4778944..4779292))
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, transcript variant
FT                   hCT2270212"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270212.2;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 08-JAN-2004"
FT   mRNA            complement(join(4736333..4736621,4738735..4741162,
FT                   4741309..4741448,4741850..4741989,4743332..4743674,
FT                   4744661..4745191))
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, transcript variant
FT                   hCT2270220"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270220.2;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 08-JAN-2004"
FT   CDS             complement(join(4741057..4741162,4741309..4741448,
FT                   4741850..4741989,4743332..4743674,4744661..4744869,
FT                   4746681..4746831,4756393..4756565,4757343..4757580,
FT                   4758354..4758466,4763509..4763669,4773256..4773293,
FT                   4775722..4776354,4777473..4777720,4818718..4819252))
FT                   /codon_start=1
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, isoform CRA_b"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270217.2
FT                   protein_id=hCP1787955.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q96JH8"
FT                   /db_xref="HGNC:HGNC:22226"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1UM1"
FT                   /db_xref="PDB:3EC8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96JH8"
FT                   /protein_id="EAW87301.1"
FT                   /translation="MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSS
FT                   LGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDP
FT                   RQAGQYVLCDVVGQAGDAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRS
FT                   DVEELAAKEVDTITAGINAQARRLQRSRAKGTPTPALGDARSSPPPRLRRTVSETSLSP
FT                   VNALPAAAQGPEEPGPDAMRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPS
FT                   SKPSISLSAPDILPLHCTIRRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLH
FT                   HGDLLSLGLYYLLLFKDPAQAQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAAL
FT                   PRRQQLLLEFEPHLEDTLLQRIMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQ
FT                   LLLKIARLIRETVWEKTKELAEKQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELL
FT                   YFIQQKCPLYMQSMEEQLDITGSKESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSK
FT                   SLYICLPALLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQ
FT                   MLAYLFFFSGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFF
FT                   QKLSCTLNLLATPRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPG
FT                   AQDSPEAFRSEDVLESYENPPPIVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRS
FT                   RASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPL
FT                   RGAPWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKAL
FT                   PERQRNGLSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMG
FT                   LIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRH
FT                   GGKKMRFLVAKSDVETAKKIHFRTPPL"
FT   CDS             complement(join(4741057..4741162,4741309..4741448,
FT                   4741850..4741989,4743332..4743674,4744661..4744869,
FT                   4746681..4746831,4756393..4756565,4757343..4757580,
FT                   4758354..4758466,4763509..4763669,4773256..4773293,
FT                   4775722..4776354,4777473..4777535))
FT                   /codon_start=1
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, isoform CRA_a"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270212.2
FT                   protein_id=hCP1787952.0 isoform=CRA_a"
FT                   /protein_id="EAW87300.1"
FT                   /translation="MRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPSSKPS
FT                   ISLSAPDILPLHCTIRRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLHHGDL
FT                   LSLGLYYLLLFKDPAQAQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAALPRRQ
FT                   QLLLEFEPHLEDTLLQRIMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLLLK
FT                   IARLIRETVWEKTKELAEKQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQ
FT                   QKCPLYMQSMEEQLDITGSKESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYI
FT                   CLPALLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAY
FT                   LFFFSGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLS
FT                   CTLNLLATPRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDS
FT                   PEAFRSEDVLESYENPPPIVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASP
FT                   GSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAP
FT                   WAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQ
FT                   RNGLSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDG
FT                   MHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKK
FT                   MRFLVAKSDVETAKKIHFRTPPL"
FT   CDS             complement(join(4741057..4741162,4741309..4741448,
FT                   4741850..4741989,4743332..4743674,4744661..4744869,
FT                   4746681..4746831,4756393..4756565,4757343..4757580,
FT                   4758354..4758466,4763509..4763669,4773256..4773293,
FT                   4775722..4775874))
FT                   /codon_start=1
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, isoform CRA_c"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2356920.0
FT                   protein_id=hCP1922141.0 isoform=CRA_c"
FT                   /protein_id="EAW87302.1"
FT                   /translation="MTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLLLKIARL
FT                   IRETVWEKTKELAEKQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQQKCP
FT                   LYMQSMEEQLDITGSKESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYICLPA
FT                   LLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAYLFFF
FT                   SGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLSCTLN
FT                   LLATPRAQLIQMSWTALRAAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDSPEAF
FT                   RSEDVLESYENPPPIVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPG
FT                   RPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQA
FT                   PPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGL
FT                   SGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTH
FT                   LGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFL
FT                   VAKSDVETAKKIHFRTPPL"
FT   CDS             complement(join(4741057..4741162,4741309..4741448,
FT                   4741850..4741989,4743332..4743674,4744661..4745083))
FT                   /codon_start=1
FT                   /gene="FLJ10324"
FT                   /locus_tag="hCG_1991943"
FT                   /product="hypothetical protein FLJ10324, isoform CRA_d"
FT                   /note="gene_id=hCG1991943.2 transcript_id=hCT2270220.2
FT                   protein_id=hCP1787956.0 isoform=CRA_d"
FT                   /protein_id="EAW87303.1"
FT                   /translation="MSHRVVGGNSEGMSPRVGPVTVARIPASCVHRAGDSGLNLLAPGF
FT                   PHRWAGRPGEGGSFSCGHYGHPLSPAEDVLESYENPPPIVLPSDGFQVDLEANCLDDSI
FT                   YQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRD
FT                   PGPAAREVAPERTLPLRGAPWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEP
FT                   GDPDWPESGGPCGKALPERQRNGLSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCY
FT                   VFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGS
FT                   SLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL"
FT   gene            complement(4798856..4803151)
FT                   /pseudo
FT                   /locus_tag="hCG_1744538"
FT                   /note="gene_id=hCG1744538.4"
FT   mRNA            complement(4798856..4803151)
FT                   /pseudo
FT                   /locus_tag="hCG_1744538"
FT                   /note="gene_id=hCG1744538.4 transcript_id=hCT1782764.4;
FT                   overlap evidence=yes; created on 09-JUL-2003"
FT   gene            complement(4806492..4806939)
FT                   /pseudo
FT                   /locus_tag="hCG_1788845"
FT                   /note="gene_id=hCG1788845.3"
FT   mRNA            complement(4806492..4806939)
FT                   /pseudo
FT                   /locus_tag="hCG_1788845"
FT                   /note="gene_id=hCG1788845.3 transcript_id=hCT1828091.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(4843088..>4843918)
FT                   /locus_tag="hCG_2041835"
FT                   /note="gene_id=hCG2041835.0"
FT   mRNA            complement(join(4843088..4843115,4843502..>4843918))
FT                   /locus_tag="hCG_2041835"
FT                   /product="hCG2041835"
FT                   /note="gene_id=hCG2041835.0 transcript_id=hCT2347066.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(4843604..>4843918)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041835"
FT                   /product="hCG2041835"
FT                   /note="gene_id=hCG2041835.0 transcript_id=hCT2347066.0
FT                   protein_id=hCP1910784.0"
FT                   /protein_id="EAW87304.1"
FT                   /translation="AGRGQRVGRWAPVKFATMYSVTRCRNAGSGDSIYGIQKEPVTIPA
FT                   PTSNEHANVTGVVFSRCDEKELEAGQAEAHLSGSPPGCQSPLVVSRCCLHRFTQTPPVG
FT                   "
FT   gene            complement(4847108..4900478)
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /note="gene_id=hCG1991975.1"
FT   mRNA            complement(join(4847108..4848717,4850847..4850896,
FT                   4850999..4851068,4852263..4852364,4857123..4857197,
FT                   4861289..4861449,4866569..4866650,4900080..4900300))
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, transcript variant hCT2356897"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2356897.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(4847108..4848717,4850999..4851140,
FT                   4852263..4852364,4857123..4857197,4861289..4861449,
FT                   4866569..4866650,4900080..4900274))
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, transcript variant hCT2356896"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2356896.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(4847295..4848717,4850999..4851068,
FT                   4852263..4852364,4857123..4857197,4861289..4861449,
FT                   4866569..4866650,4900080..4900299))
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, transcript variant hCT2270270"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2270270.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(4848514..4848717,4850999..4851068,
FT                   4852263..4852364,4857123..4857197,4861289..4861449,
FT                   4866569..4866650,4900080..4900126))
FT                   /codon_start=1
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, isoform CRA_b"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2270270.0
FT                   protein_id=hCP1787948.0 isoform=CRA_b"
FT                   /protein_id="EAW87306.1"
FT                   /translation="MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFW
FT                   IIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLH
FT                   MFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERYKLVELL
FT                   CYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFG
FT                   AGTHYYAIWRYLYLPSTLQTKVSK"
FT   CDS             complement(join(4848514..4848717,4850999..4851140,
FT                   4852263..4852364,4857123..4857197,4861289..4861449,
FT                   4866569..4866650,4900080..4900126))
FT                   /codon_start=1
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, isoform CRA_a"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2356896.0
FT                   protein_id=hCP1922142.0 isoform=CRA_a"
FT                   /protein_id="EAW87305.1"
FT                   /translation="MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFW
FT                   IIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLH
FT                   MFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQF
FT                   LRGEACPKAGTACLPARYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLG
FT                   MVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK"
FT   CDS             complement(join(4850852..4850896,4850999..4851068,
FT                   4852263..4852364,4857123..4857197,4861289..4861449,
FT                   4866569..4866650,4900080..4900126))
FT                   /codon_start=1
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, isoform CRA_c"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2356897.0
FT                   protein_id=hCP1922143.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8IY49"
FT                   /db_xref="HGNC:HGNC:30133"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IY49"
FT                   /protein_id="EAW87307.1"
FT                   /translation="MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFW
FT                   IIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLH
FT                   MFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERYKLVELL
FT                   CYVVMGFFPALVILSMAGKLRPGMTCLKRQ"
FT   mRNA            complement(join(<4850999..4851068,4852263..4852364,
FT                   4857123..4857197,4861289..4861449,4865008..4865144,
FT                   4866569..4866650,4900080..4900478))
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, transcript variant hCT2270269"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2270269.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<4850999..4851068,4852263..4852364,
FT                   4857123..4857196))
FT                   /codon_start=1
FT                   /gene="MMD2"
FT                   /locus_tag="hCG_1991975"
FT                   /product="monocyte to macrophage differentiation-associated
FT                   2, isoform CRA_d"
FT                   /note="gene_id=hCG1991975.1 transcript_id=hCT2270269.0
FT                   protein_id=hCP1787947.0 isoform=CRA_d"
FT                   /protein_id="EAW87308.1"
FT                   /translation="MVEHCLHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIM
FT                   ASVGTIYVFFFHERYKLVELLCYVVMGFFPALVILSM"
FT   assembly_gap    4900481..4901664
FT                   /estimated_length=1184
FT                   /gap_type="unknown"
FT   gene            4915398..4939547
FT                   /locus_tag="hCG_2040556"
FT                   /note="gene_id=hCG2040556.3"
FT   mRNA            join(4915398..4915543,4917682..4917817,4925052..4925154,
FT                   4926291..4926456,4927947..4928011,4930442..4930556,
FT                   4936855..4936962,4937990..4939546)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2356904"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356904.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   mRNA            join(4915424..4915543,4917682..4917817,4923022..4923238,
FT                   4925052..4925154,4926291..4926456,4930442..4930556,
FT                   4937990..4939547)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2349131"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2349131.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 21-APR-2004"
FT   mRNA            join(4915424..4915543,4917682..4917817,4925052..4925154,
FT                   4926291..4926456,4930442..4930556,4936855..4936962,
FT                   4937990..4939547)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2351719"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2351719.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 21-APR-2004"
FT   mRNA            join(4915424..4915543,4917682..4917817,4925052..4925154,
FT                   4926291..4926456,4930442..4930556,4937990..4939547)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2345785"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2345785.2;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 21-APR-2004"
FT   mRNA            join(4915442..4915543,4917682..4917817,4925052..4925154,
FT                   4926343..4926456,4930442..4930556,4936855..4936902)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2356907"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356907.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 14-JUL-2004"
FT   mRNA            join(4915451..4915543,4917682..4917817,4925052..4925154,
FT                   4926291..4926456,4937990..>4938238)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2356908"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356908.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   mRNA            join(4915452..4915543,4917682..4917817,4925052..4925154,
FT                   4926343..4926456,4930442..4930556,4937990..4938024)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2356905"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356905.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 14-JUL-2004"
FT   mRNA            join(4915463..4915543,4917682..4917817,4926291..4926456,
FT                   4937990..>4938245)
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, transcript variant hCT2356906"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356906.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   CDS             join(4917751..4917817,4925052..4925113)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_b"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2345785.2
FT                   protein_id=hCP1910782.2 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R827"
FT                   /protein_id="EAW87310.1"
FT                   /translation="MEEGNNNEEVIHLNNFHCHRGQDFVIFFWKTQIIQREKTESL"
FT   CDS             join(4917751..4917817,4925052..4925113)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_b"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2351719.0
FT                   protein_id=hCP1916949.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R827"
FT                   /protein_id="EAW87311.1"
FT                   /translation="MEEGNNNEEVIHLNNFHCHRGQDFVIFFWKTQIIQREKTESL"
FT   CDS             join(4917751..4917817,4923022..4923218)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_f"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2349131.1
FT                   protein_id=hCP1914381.1 isoform=CRA_f"
FT                   /protein_id="EAW87316.1"
FT                   /translation="MEEGNNNEEVIHLNNFHCHRGQGVPSLELLACQISSSMRSYEDVG
FT                   RLKSDRLPHCFCPRVQILEQRLPLVSVEEKLCPSFPVPPNVT"
FT   CDS             join(4925144..4925154,4926343..4926456,4930442..4930520)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_a"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356907.0
FT                   protein_id=hCP1922154.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R867"
FT                   /protein_id="EAW87309.1"
FT                   /translation="MRQSTASSKLLTSSWPTSKCSVVRTSCGPCTSSKDTMQSPERPFL
FT                   MPLKNGRSYHQKPVEKGKREKK"
FT   CDS             join(4925144..4925154,4926343..4926456,4930442..4930520)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_a"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356905.0
FT                   protein_id=hCP1922152.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R867"
FT                   /protein_id="EAW87315.1"
FT                   /translation="MRQSTASSKLLTSSWPTSKCSVVRTSCGPCTSSKDTMQSPERPFL
FT                   MPLKNGRSYHQKPVEKGKREKK"
FT   CDS             join(4926373..4926456,4927947..4928011,4930442..4930520)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_e"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356904.0
FT                   protein_id=hCP1922151.0 isoform=CRA_e"
FT                   /db_xref="HGNC:HGNC:33610"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NUR6"
FT                   /protein_id="EAW87314.1"
FT                   /translation="MADFKVLSSQDIMWALHELKGHYAITRKDFESHQHMENLTSQDEV
FT                   PRDTRPFLMPLKNGRSYHQKPVEKGKREKK"
FT   CDS             join(4926440..4926456,4937990..>4938245)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_c"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356906.0
FT                   protein_id=hCP1922153.0 isoform=CRA_c"
FT                   /protein_id="EAW87312.1"
FT                   /translation="MQSPERGWHLHILPGHLVGTARLPPGLAHLPPLQAPPGPGLLCDL
FT                   RPVEPAATVAPSPSCGPVLSPLPQYVALHFLGLWLVLLLWVWLQGT"
FT   CDS             join(4926440..4926456,4937990..>4938238)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040556"
FT                   /product="hCG2040556, isoform CRA_d"
FT                   /note="gene_id=hCG2040556.3 transcript_id=hCT2356908.0
FT                   protein_id=hCP1922155.0 isoform=CRA_d"
FT                   /protein_id="EAW87313.1"
FT                   /translation="MQSPERGWHLHILPGHLVGTARLPPGLAHLPPLQAPPGPGLLCDL
FT                   RPVEPAATVAPSPSCGPVLSPLPQYVALHFLGLWLVLLLWVWL"
FT   gene            4934889..4939547
FT                   /locus_tag="hCG_2044539"
FT                   /note="gene_id=hCG2044539.0"
FT   mRNA            join(4934889..4935193,4936855..4936962,4937990..4939547)
FT                   /locus_tag="hCG_2044539"
FT                   /product="hCG2044539, transcript variant hCT2351718"
FT                   /note="gene_id=hCG2044539.0 transcript_id=hCT2351718.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/2;
FT                   created on 21-APR-2004"
FT   mRNA            join(4934889..4935193,4937990..4939547)
FT                   /locus_tag="hCG_2044539"
FT                   /product="hCG2044539, transcript variant hCT2351717"
FT                   /note="gene_id=hCG2044539.0 transcript_id=hCT2351717.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 21-APR-2004"
FT   CDS             join(4935004..4935193,4937990..4938186)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2044539"
FT                   /product="hCG2044539, isoform CRA_b"
FT                   /note="gene_id=hCG2044539.0 transcript_id=hCT2351717.0
FT                   protein_id=hCP1916947.0 isoform=CRA_b"
FT                   /protein_id="EAW87318.1"
FT                   /translation="MQERGQGLLVWQQEEPSEFDLAYANFLSLDISMLRLFETLETAPQ
FT                   LTLVLAIMLQSGWAEYYQWVGICTSFLGISWALLDYHQALHTCLPSKPLLGLGSSVIYV
FT                   LWNLLLLWPRVLAVALFSALFPSM"
FT   CDS             join(4935004..4935193,4936855..4936883)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2044539"
FT                   /product="hCG2044539, isoform CRA_a"
FT                   /note="gene_id=hCG2044539.0 transcript_id=hCT2351718.0
FT                   protein_id=hCP1916948.0 isoform=CRA_a"
FT                   /protein_id="EAW87317.1"
FT                   /translation="MQERGQGLLVWQQEEPSEFDLAYANFLSLDISMLRLFETLETAPQ
FT                   LTLVLAIMLQSGWAEYYQCTGLLGDPK"
FT   gene            4987298..5014601
FT                   /locus_tag="hCG_1647537"
FT                   /note="gene_id=hCG1647537.4"
FT   mRNA            join(4987298..4987772,4989409..4989467,4998671..4998797,
FT                   4999060..4999155,5005071..5005131,5013738..5013873,
FT                   5014298..5014601)
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, transcript variant hCT2349051"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT2349051.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 21-APR-2004"
FT   mRNA            join(4987298..4987772,4989409..4989467,4998671..4998797,
FT                   4999060..4999155,5005071..5005131,5011403..5011569,
FT                   5012597..5012880)
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, transcript variant hCT2351711"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT2351711.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 21-APR-2004"
FT   mRNA            join(4987298..4987772,4989409..4989467,4998671..4998797,
FT                   4999060..4999155,5005071..5010867)
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, transcript variant hCT1647664"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT1647664.4;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 21-APR-2004"
FT   CDS             join(4989453..4989467,4998671..4998797,4999060..4999155,
FT                   5005071..5005131,5013738..5013873,5014298..5014594)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, isoform CRA_b"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT2349051.1
FT                   protein_id=hCP1914301.1 isoform=CRA_b"
FT                   /db_xref="GOA:I3L0D1"
FT                   /db_xref="HGNC:HGNC:42971"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="UniProtKB/TrEMBL:I3L0D1"
FT                   /protein_id="EAW87320.1"
FT                   /translation="MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLV
FT                   SVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSSRPAR
FT                   RPCGPRCCCCCCCSRPPRSPPPKPLPTRMLTPRKAFRTCSKESGLAETESCGQTHTWPR
FT                   ALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGEHGAFPVHSQGVWASTHWQGT
FT                   AVCPLQTPPPDAFIRNNKVLS"
FT   CDS             join(4989453..4989467,4998671..4998797,4999060..4999155,
FT                   5005071..5005131,5011403..5011541)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, isoform CRA_d"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT2351711.0
FT                   protein_id=hCP1916941.0 isoform=CRA_d"
FT                   /protein_id="EAW87322.1"
FT                   /translation="MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLV
FT                   SVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRDSVL
FT                   LCCWTQTPGLKWSTQLGRPKSWDSRSEPPRPAMCFSFHLTH"
FT   CDS             join(4989453..4989467,4998671..4998797,4999060..4999155,
FT                   5005071..5006977)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, isoform CRA_c"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT1647664.4
FT                   protein_id=hCP1602980.4 isoform=CRA_c"
FT                   /db_xref="GOA:Q9NYW8"
FT                   /db_xref="HGNC:HGNC:17680"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NYW8"
FT                   /protein_id="EAW87321.1"
FT                   /translation="MNTLQGPVSFKDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLV
FT                   SVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAAC
FT                   INSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQLISSDGSYARTKPD
FT                   ECNECGKTYHGEKMCEFNQNGDTYSHNEENILQKISILEKPFEYNECMEALDNEAVFIA
FT                   HKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPFECSECGKSFCKKSKFIIHQR
FT                   AHTGEKPYECNVCGKSFSQKGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHS
FT                   GEKPYECSECGKTFCQKTHLTLHQRNHSGERPYPCNECGKSFSRKSALSDHQRTHTGEK
FT                   LYKCNECGKSYYRKSTLITHQRTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYE
FT                   CNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQLYLTDHHTAHLEEKPYECNECG
FT                   KTFLVNSAFDGHQPLPKGEKSYECNVCGKLFNELSYYTEHYRSHSEEKPYGCSECGKTF
FT                   SHNSSLFRHQRVHTGEKPYECYECGKFFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRM
FT                   SNLTVHYRSHSGEKPYECNECGKVFSQKSYLTVHYRTHSGEKPYECNECGKKFHHRSAF
FT                   NSHQRIHRRGNMNVLDVENL"
FT   mRNA            join(5013469..5013576,5013738..5013873,5014298..5014601)
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, transcript variant hCT1972715"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT1972715.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 21-APR-2004"
FT   CDS             join(5013835..5013873,5014298..5014594)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1647537"
FT                   /product="hCG1647537, isoform CRA_a"
FT                   /note="gene_id=hCG1647537.4 transcript_id=hCT1972715.1
FT                   protein_id=hCP1784436.1 isoform=CRA_a"
FT                   /db_xref="HGNC:HGNC:33770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6NC62"
FT                   /protein_id="EAW87319.1"
FT                   /translation="MLTPRKAFRTCSKESGLAETESCGQTHTWPRALAVLMGLWWPRDQ
FT                   KAGEEDLRFRERRPGLQATATGSGEHGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFI
FT                   RNNKVLS"
FT   gene            5058526..5059579
FT                   /pseudo
FT                   /locus_tag="hCG_1786137"
FT                   /note="gene_id=hCG1786137.2"
FT   mRNA            5058526..5059579
FT                   /pseudo
FT                   /locus_tag="hCG_1786137"
FT                   /note="gene_id=hCG1786137.2 transcript_id=hCT1825168.2;
FT                   overlap evidence=no; created on 28-JAN-2004"
FT   assembly_gap    5062542..5062561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5062562..>5068883)
FT                   /locus_tag="hCG_1786132"
FT                   /note="gene_id=hCG1786132.2"
FT   mRNA            complement(join(5062562..5063359,5067966..5068132,
FT                   5068753..>5068883))
FT                   /locus_tag="hCG_1786132"
FT                   /product="hCG1786132"
FT                   /note="gene_id=hCG1786132.2 transcript_id=hCT1825163.2;
FT                   splice donor-acceptor pairs covered / total pairs = 1/2;
FT                   created on 29-AUG-2003"
FT   CDS             complement(join(5063007..5063359,5067966..5068132,
FT                   5068753..>5068883))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786132"
FT                   /product="hCG1786132"
FT                   /note="gene_id=hCG1786132.2 transcript_id=hCT1825163.2
FT                   protein_id=hCP1725715.2"
FT                   /protein_id="EAW87323.1"
FT                   /translation="PGVTVIRGRGCGLHPERVAAAGPGAEDPVPGCDAGDLQPPALCGL
FT                   NCLLAWKAQLAQHKSFNCFSPTGCQVSKPAVISSLEQGKEPWMEEEEIRTWSFPEEVWQ
FT                   VATQPDSQQQHEDQHLSHTFLDKKDWTGNELHECNELGKKLHQNPNLLPSKQQVRTRDL
FT                   CRKSLMCNLDFTPNAYLARRRFQCDGHGNFSIRNLKLHLQERIHAEVTSVAVL"
FT   gene            5131355..5174968
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /note="gene_id=hCG95500.3"
FT   mRNA            join(5131355..5131645,5134270..5134323,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170885,
FT                   5171982..5174968)
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   transcript variant hCT2270958"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270958.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5131355..5131645,5134270..5134323,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5169921..>5170017)
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   transcript variant hCT2270956"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270956.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/11;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5131383..5131460,5131555..5131645,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170885,
FT                   5171982..5174968)
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   transcript variant hCT2270959"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270959.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5131419..5131466,5131549..5131645,5134270..5134323,
FT                   5140728..5140810,5155682..5155851,5157713..5157809,
FT                   5158240..5158337,5159072..5159164,5163749..5163819,
FT                   5166970..5167077,5168327..5168491,5169251..5169358,
FT                   5170755..5170885,5171982..5174968)
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   transcript variant hCT86800"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT86800.3; splice
FT                   donor-acceptor pairs covered / total pairs = 13/13; created
FT                   on 26-AUG-2002"
FT   CDS             join(5131572..5131645,5134270..5134323,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170885,
FT                   5171982..5172094)
FT                   /codon_start=1
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270958.0
FT                   protein_id=hCP1788018.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R823"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR032911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R823"
FT                   /protein_id="EAW87326.1"
FT                   /translation="MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSL
FT                   AVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF
FT                   KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA
FT                   LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE
FT                   KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK
FT                   EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ
FT                   KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQT
FT                   YGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD"
FT   CDS             join(5131572..5131645,5134270..5134323,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170885,
FT                   5171982..5172094)
FT                   /codon_start=1
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT86800.3
FT                   protein_id=hCP201340.3 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R823"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR032911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R823"
FT                   /protein_id="EAW87327.1"
FT                   /translation="MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSL
FT                   AVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF
FT                   KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA
FT                   LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE
FT                   KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK
FT                   EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ
FT                   KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQT
FT                   YGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD"
FT   CDS             join(5131572..5131645,5140728..5140810,5155682..5155851,
FT                   5157713..5157809,5158240..5158337,5159072..5159164,
FT                   5163749..5163819,5166970..5167077,5168327..5168491,
FT                   5169251..5169358,5170755..5170885,5171982..5172094)
FT                   /codon_start=1
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270959.0
FT                   protein_id=hCP1788021.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q9Y4P8"
FT                   /db_xref="HGNC:HGNC:32225"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR032911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y4P8"
FT                   /protein_id="EAW87328.1"
FT                   /translation="MNLASQSGEAGAGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDK
FT                   LEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAV
FT                   KLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATI
FT                   GEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFE
FT                   FRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVL
FT                   MASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYN
FT                   LDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRL
FT                   AYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD"
FT   CDS             join(5131572..5131645,5134270..5134323,5140728..5140810,
FT                   5155682..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5169921..>5170017)
FT                   /codon_start=1
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270956.0
FT                   protein_id=hCP1788023.0 isoform=CRA_b"
FT                   /protein_id="EAW87325.1"
FT                   /translation="MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSL
FT                   AVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF
FT                   KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA
FT                   LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE
FT                   KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK
FT                   EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ
FT                   KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLESSGAVTAHCSLDLPGSRDPSTSA
FT                   SLVAGTT"
FT   mRNA            join(5155416..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170852,
FT                   5171982..5174968)
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   transcript variant hCT2270954"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270954.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             join(5155648..5155851,5157713..5157809,5158240..5158337,
FT                   5159072..5159164,5163749..5163819,5166970..5167077,
FT                   5168327..5168491,5169251..5169358,5170755..5170852,
FT                   5171982..5172094)
FT                   /codon_start=1
FT                   /gene="WIPI2"
FT                   /locus_tag="hCG_95500"
FT                   /product="WD repeat domain, phosphoinositide interacting 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG95500.3 transcript_id=hCT2270954.0
FT                   protein_id=hCP1788019.0 isoform=CRA_a"
FT                   /protein_id="EAW87324.1"
FT                   /translation="MFTHVLPFVISADTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHF
FT                   KKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHTIRETPPNPAGLCA
FT                   LSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASE
FT                   KGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVK
FT                   EKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQ
FT                   KIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQT
FT                   YGAAAGKAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD"
FT   assembly_gap    5176435..5176454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5180140..5180159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5201173..5201192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5225134..5225562
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   gene            5230160..5246405
FT                   /gene="SLC29A4"
FT                   /locus_tag="hCG_2036981"
FT                   /note="gene_id=hCG2036981.0"
FT   mRNA            join(5230160..5230338,5233088..5233219,5233480..5233593,
FT                   5234049..5234177,5237216..5237290,5239292..5239554,
FT                   5241334..5241472,5241586..5241773,5242768..5243008,
FT                   5245143..5246405)
FT                   /gene="SLC29A4"
FT                   /locus_tag="hCG_2036981"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 4, transcript variant hCT2341330"
FT                   /note="gene_id=hCG2036981.0 transcript_id=hCT2341330.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 12-MAR-2003"
FT   mRNA            join(5230160..5230338,5233088..5233219,5233480..5233593,
FT                   5234086..5234177,5237221..5237290,5239292..5239554,
FT                   5241334..5241472,5241586..5241773,5242768..5243008,
FT                   5245143..5246405)
FT                   /gene="SLC29A4"
FT                   /locus_tag="hCG_2036981"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 4, transcript variant hCT2356909"
FT                   /note="gene_id=hCG2036981.0 transcript_id=hCT2356909.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 14-JUL-2004"
FT   CDS             join(5230170..5230338,5233088..5233219,5233480..5233593,
FT                   5234049..5234177,5237216..5237290,5239292..5239554,
FT                   5241334..5241472,5241586..5241773,5242768..5243008,
FT                   5245143..5245285)
FT                   /codon_start=1
FT                   /gene="SLC29A4"
FT                   /locus_tag="hCG_2036981"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 4, isoform CRA_a"
FT                   /note="gene_id=hCG2036981.0 transcript_id=hCT2341330.0
FT                   protein_id=hCP1907914.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q7RTT9"
FT                   /db_xref="HGNC:HGNC:23097"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030198"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7RTT9"
FT                   /protein_id="EAW87329.1"
FT                   /translation="MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGL
FT                   RARGVPAFTDTTLDEPVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSI
FT                   VFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRD
FT                   QAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKL
FT                   LLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGY
FT                   RVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFR
FT                   ALLLHRYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSD
FT                   FVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGI
FT                   SNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCL
FT                   HASTANGSILAGL"
FT   CDS             join(5230170..5230338,5233088..5233219,5233480..5233593,
FT                   5234086..5234177,5237221..5237290,5239292..5239554,
FT                   5241334..5241472,5241586..5241773,5242768..5243008,
FT                   5245143..5245285)
FT                   /codon_start=1
FT                   /gene="SLC29A4"
FT                   /locus_tag="hCG_2036981"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 4, isoform CRA_b"
FT                   /note="gene_id=hCG2036981.0 transcript_id=hCT2356909.0
FT                   protein_id=hCP1922150.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q7RTT9"
FT                   /db_xref="HGNC:HGNC:23097"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030198"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7RTT9"
FT                   /protein_id="EAW87330.1"
FT                   /translation="MGSVGSQRLEEPSVAGTPDPGVVMSFTFDSHQLEEAAEAAQGQGL
FT                   RARGVPAFTDTTLDEPVPDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSI
FT                   VFDMSLTYILVALAAVLLNNVLVERLTLHTRITAASATCGCSSSLGTRPTPSTWPLWAP
FT                   WPSAAQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFL
FT                   VSVALELLCFLLHLLVRRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFE
FT                   HPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVARVIW
FT                   ADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWR
FT                   GTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAA
FT                   GKVSPKQRELAGNTMTVSYMSGLTLGSAVAYCTYSLTRDAHGSCLHASTANGSILAGL"
FT   gene            complement(5249140..5367902)
FT                   /locus_tag="hCG_96198"
FT                   /note="gene_id=hCG96198.5"
FT   mRNA            complement(join(5249140..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5337006,5367779..5367902))
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, transcript variant hCT87498"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT87498.5; splice
FT                   donor-acceptor pairs covered / total pairs = 28/30; created
FT                   on 12-DEC-2003"
FT   mRNA            complement(join(5249140..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5337006,5363548..5363977,5365929..5366037))
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, transcript variant hCT2348642"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2348642.1;
FT                   splice donor-acceptor pairs covered / total pairs = 29/31;
FT                   created on 12-DEC-2003"
FT   mRNA            complement(join(5249140..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5337006,5349561..5349685,5354473..5354559))
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, transcript variant hCT2273091"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273091.1;
FT                   splice donor-acceptor pairs covered / total pairs = 29/31;
FT                   created on 12-DEC-2003"
FT   mRNA            complement(join(5249140..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5271344))
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, transcript variant hCT2273090"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273090.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/11;
FT                   created on 12-DEC-2003"
FT   CDS             complement(join(5250453..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5337006,5363548..5363734))
FT                   /codon_start=1
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, isoform CRA_b"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2348642.1
FT                   protein_id=hCP1913892.1 isoform=CRA_b"
FT                   /protein_id="EAW87332.1"
FT                   /translation="MDGRDFGPQRSVHGPPPPLLSGLAMDSHRVGAATAGRLPASGLPG
FT                   PLPPGKYMAGLNLHPHPGEAFLGSFVASGMGPSASSHGSPVPLPSDLSFRSPTPSNLPM
FT                   VQLWAAHAHEGFSHLPSGLYPSYLHLNHLEPPSSGSPLLSQLGQPSIFDTQKGQGPGGD
FT                   GFYLPTAGAPGSLHSHAPSARTPGGGHSSGAPAKGSSSRDGPAKERAGRGGEPPPLFGK
FT                   KDPRARGEEASGPRGVVDLTQEARAEGRQDRGPPRLAERLSPFLAESKTKNAALQPSVL
FT                   TMCNGGAGDVGLPALVAEAGRGGAKEAARQDEGARLLRRTETLLPGPRPCPSPLPPPPA
FT                   PPKGPPAPPAATPAGVYTVFREQGREHRVVAPTFVPSVEAFDERPGPIQIASQARDARA
FT                   REREAGRPGVLQAPPGSPRPLDRPEGLREKNSVIRSLKRPPPADAPTVRATRASPDPRA
FT                   YVPAKELLKPEADPRPCERAPRGPAGPAAQQAAKLFGLEPGRPPPTGPEHKWKPFELGN
FT                   FAATQMAVLAAQHHHSRAEEEAAVVAASSSKKAYLDPGAVLPRSAATCGRPVADMHSAA
FT                   HGSGEASAMQSLIKYSGSFARDAVAVRPGGCGKKSPFGGLGTMKPEPAPTSAGASRAQA
FT                   RLPHSGGPAAGGGRQLKRDPERPESAKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDS
FT                   GGSGRLGPGLVDQERSLSLSNVKGHGRADEDCVDDRARHREERLLGARLDRDQEKLLRE
FT                   SKELADLARLHPTSCAPNGLNPNLMVTGGPALAGSGRWSADPAAHLATHPWLPRSGNAS
FT                   MWLAGHPYGLGPPSLHQGMAPAFPPGLGGSLPSAYQFVRDPQSGQLVVIPSDHLPHFAE
FT                   LMERATVPPLWPALYPPGRSPLHHAQQLQLFSQQHFLRQQEFLYLQQQAAQALELQRSA
FT                   QLVQERLKAQEHRAEMEEKGSKRGLEAAGKAGLATAGPGLLPRKPPGLAAGPAGTYGKA
FT                   VSPPPSPRASPVAALKAKVIQKLEDVSKPPAYAYPATPSSHPTSPPPASPPPTPGITRK
FT                   EEAPENVVEKKDLELEKEAPSPFQALFSDIPPRYPFQALPPHYGRPYPFLLQPTAAADA
FT                   DGLAPDVPLPADGPERLALSPEDKPIRLSPSKITEPLREGPEEEPLAEREVKAEVEDMD
FT                   EGPTELPPLESPLPLPAAEAMATPSPAGGCGGGLLEAQALSATGQSCAEPSECPDFVEG
FT                   PEPRVDSPGRTEPCTAALDLGVQLTPETLVEAKEEPVEVPVAVPVVEAVPEEGLAQVAP
FT                   SESQPTLEMSDCDVPAGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMN
FT                   ALAAAAELPQARPLPSPGAAGAQALEKLEAAESLVLEQSFLHGITLLSEIAELELERRS
FT                   QEMGGAERALVARPSLESLLAAGSHMLREVLDGPVVDPLKNLRLPRELKPNKKYSWMRK
FT                   KEERMYAMKSSLEDMDALELDFRMRLAEVQRQYKEKQRELVKLQRRRDSEDRREEPHRS
FT                   LARRGPGRPRKRTHAPSALSPPRKRGKSGHSSGKLSSKSLLTSDDYELGAGIRKRHKGS
FT                   EEEHDALIGMGKARGRNQTWDEHEASSDFISQLKIKKKKMASDQEQLASKLDKALSLTK
FT                   QDKLKSPFKFSDSAGGKSKTSGGCGRYLTPYDSLLGKNRKALAKGLGLSLKSSREGKHK
FT                   RAAKTRKMEVGFKARGQPKSAHSPFASEVSSYSYNTDSEEDEEFLKDEWPAQGPSSSKL
FT                   TPSLLCSMVAKNSKAAGGPKLTKRGLAAPRTLKPKPATSRKQPFCLLLREAEARSSFSD
FT                   SSEESFDQDESSEEEDEEEELEEEDEASGGGYRLGARERALSPGLEESGLGLLARFAAS
FT                   ALPSPTVGPSLSVVQLEAKQKARKKEERQSLLGTEFEYTDSESEVKVRKRSPAGLLRPK
FT                   KGLGEPGPSLAAPTPGARGPDPSSPDKAKLAVEKGRKARKLRGPKEPGFEAGPEASDDD
FT                   LWTRRRSERIFLHDASAAAPAPVSTAPATKTSRCAKGGPLSPRKDAGRAKDRKDPRKVP
FT                   ATVSKGRHWKKKGKEAGPGAGLPPPRAPALPSEARAPHASSLTAAKRSKAKAKGKEVKK
FT                   ENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPAPRSCIIDKDE
FT                   LKDGLRVLIPMDDKLLYAGHVQTVHSPDIYRVVVEGERGNRPHIYCLEQLLQEAIIDVR
FT                   PASTRFLPQGTRIAAYWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTGRIPLSH
FT                   IRLLPPDYKIQCAEPSPALLVPSAKRRSRKTSKDTGEGKDGGTAGSEEPGAKARGRGRK
FT                   PSAKAKGDRAATLEEGNPTDEVPSTPLALEPSSTPGSKKSPPEPVDKRAKAPKARPAPP
FT                   QPSPAPPAFTSCPAPEPFAELPAPATSLAPAPLITMPATRPKPKKARAAEESGAKGPRR
FT                   PGEEAELLVKLDHEAPTAGPSAQAALPTKATKQAGKARPSAHSPGKKTPAPQPQAPPPQ
FT                   PTQPLQPKAQAGAKSRPKKREGVHLPTTKELAKRQRLPSVENRPKIAAFLPARQLWKWF
FT                   GKPTQRRGMKGKARKLFYKAIVRGKEMIRIGDCAVFLSAGRPNLPYIGRIQSMWESWGN
FT                   NMVVRVKWFYHPEETSPGKQFHQGQHWDQKSSRSLPAALRVSSQRKDFMERALYQSSHV
FT                   DENDVQTVSHKCLVVGLEQYEQMLKTKKYQDSEGLYYLAGTYEPTTGMIFSTDGVPVLC
FT                   "
FT   CDS             complement(join(5250453..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5336971))
FT                   /codon_start=1
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, isoform CRA_a"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273091.1
FT                   protein_id=hCP1787987.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R856"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R856"
FT                   /protein_id="EAW87331.1"
FT                   /translation="MGPSASSHGSPVPLPSDLSFRSPTPSNLPMVQLWAAHAHEGFSHL
FT                   PSGLYPSYLHLNHLEPPSSGSPLLSQLGQPSIFDTQKGQGPGGDGFYLPTAGAPGSLHS
FT                   HAPSARTPGGGHSSGAPAKGSSSRDGPAKERAGRGGEPPPLFGKKDPRARGEEASGPRG
FT                   VVDLTQEARAEGRQDRGPPRLAERLSPFLAESKTKNAALQPSVLTMCNGGAGDVGLPAL
FT                   VAEAGRGGAKEAARQDEGARLLRRTETLLPGPRPCPSPLPPPPAPPKGPPAPPAATPAG
FT                   VYTVFREQGREHRVVAPTFVPSVEAFDERPGPIQIASQARDARAREREAGRPGVLQAPP
FT                   GSPRPLDRPEGLREKNSVIRSLKRPPPADAPTVRATRASPDPRAYVPAKELLKPEADPR
FT                   PCERAPRGPAGPAAQQAAKLFGLEPGRPPPTGPEHKWKPFELGNFAATQMAVLAAQHHH
FT                   SRAEEEAAVVAASSSKKAYLDPGAVLPRSAATCGRPVADMHSAAHGSGEASAMQSLIKY
FT                   SGSFARDAVAVRPGGCGKKSPFGGLGTMKPEPAPTSAGASRAQARLPHSGGPAAGGGRQ
FT                   LKRDPERPESAKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGGSGRLGPGLVDQER
FT                   SLSLSNVKGHGRADEDCVDDRARHREERLLGARLDRDQEKLLRESKELADLARLHPTSC
FT                   APNGLNPNLMVTGGPALAGSGRWSADPAAHLATHPWLPRSGNASMWLAGHPYGLGPPSL
FT                   HQGMAPAFPPGLGGSLPSAYQFVRDPQSGQLVVIPSDHLPHFAELMERATVPPLWPALY
FT                   PPGRSPLHHAQQLQLFSQQHFLRQQEFLYLQQQAAQALELQRSAQLVQERLKAQEHRAE
FT                   MEEKGSKRGLEAAGKAGLATAGPGLLPRKPPGLAAGPAGTYGKAVSPPPSPRASPVAAL
FT                   KAKVIQKLEDVSKPPAYAYPATPSSHPTSPPPASPPPTPGITRKEEAPENVVEKKDLEL
FT                   EKEAPSPFQALFSDIPPRYPFQALPPHYGRPYPFLLQPTAAADADGLAPDVPLPADGPE
FT                   RLALSPEDKPIRLSPSKITEPLREGPEEEPLAEREVKAEVEDMDEGPTELPPLESPLPL
FT                   PAAEAMATPSPAGGCGGGLLEAQALSATGQSCAEPSECPDFVEGPEPRVDSPGRTEPCT
FT                   AALDLGVQLTPETLVEAKEEPVEVPVAVPVVEAVPEEGLAQVAPSESQPTLEMSDCDVP
FT                   AGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLP
FT                   SPGAAGAQALEKLEAAESLVLEQSFLHGITLLSEIAELELERRSQEMGGAERALVARPS
FT                   LESLLAAGSHMLREVLDGPVVDPLKNLRLPRELKPNKKYSWMRKKEERMYAMKSSLEDM
FT                   DALELDFRMRLAEVQRQYKEKQRELVKLQRRRDSEDRREEPHRSLARRGPGRPRKRTHA
FT                   PSALSPPRKRGKSGHSSGKLSSKSLLTSDDYELGAGIRKRHKGSEEEHDALIGMGKARG
FT                   RNQTWDEHEASSDFISQLKIKKKKMASDQEQLASKLDKALSLTKQDKLKSPFKFSDSAG
FT                   GKSKTSGGCGRYLTPYDSLLGKNRKALAKGLGLSLKSSREGKHKRAAKTRKMEVGFKAR
FT                   GQPKSAHSPFASEVSSYSYNTDSEEDEEFLKDEWPAQGPSSSKLTPSLLCSMVAKNSKA
FT                   AGGPKLTKRGLAAPRTLKPKPATSRKQPFCLLLREAEARSSFSDSSEESFDQDESSEEE
FT                   DEEEELEEEDEASGGGYRLGARERALSPGLEESGLGLLARFAASALPSPTVGPSLSVVQ
FT                   LEAKQKARKKEERQSLLGTEFEYTDSESEVKVRKRSPAGLLRPKKGLGEPGPSLAAPTP
FT                   GARGPDPSSPDKAKLAVEKGRKARKLRGPKEPGFEAGPEASDDDLWTRRRSERIFLHDA
FT                   SAAAPAPVSTAPATKTSRCAKGGPLSPRKDAGRAKDRKDPRKVPATVSKGRHWKKKGKE
FT                   AGPGAGLPPPRAPALPSEARAPHASSLTAAKRSKAKAKGKEVKKENRGKGGAVSKLMES
FT                   MAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPAPRSCIIDKDELKDGLRVLIPMDDKL
FT                   LYAGHVQTVHSPDIYRVVVEGERGNRPHIYCLEQLLQEAIIDVRPASTRFLPQGTRIAA
FT                   YWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTGRIPLSHIRLLPPDYKIQCAEP
FT                   SPALLVPSAKRRSRKTSKDTGEGKDGGTAGSEEPGAKARGRGRKPSAKAKGDRAATLEE
FT                   GNPTDEVPSTPLALEPSSTPGSKKSPPEPVDKRAKAPKARPAPPQPSPAPPAFTSCPAP
FT                   EPFAELPAPATSLAPAPLITMPATRPKPKKARAAEESGAKGPRRPGEEAELLVKLDHEA
FT                   PTAGPSAQAALPTKATKQAGKARPSAHSPGKKTPAPQPQAPPPQPTQPLQPKAQAGAKS
FT                   RPKKREGVHLPTTKELAKRQRLPSVENRPKIAAFLPARQLWKWFGKPTQRRGMKGKARK
FT                   LFYKAIVRGKEMIRIGDCAVFLSAGRPNLPYIGRIQSMWESWGNNMVVRVKWFYHPEET
FT                   SPGKQFHQGQHWDQKSSRSLPAALRVSSQRKDFMERALYQSSHVDENDVQTVSHKCLVV
FT                   GLEQYEQMLKTKKYQDSEGLYYLAGTYEPTTGMIFSTDGVPVLC"
FT   CDS             complement(join(5250453..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267681,5272362..5272394,5275047..5275474,
FT                   5287979..5288227,5294236..5294511,5299334..5299694,
FT                   5301816..5301987,5304012..5304140,5304315..5304451,
FT                   5305068..5305243,5312786..5313775,5316466..5316895,
FT                   5318445..5318635,5319258..5319404,5319782..5319987,
FT                   5320333..5320435,5330083..5331747,5332896..5333039,
FT                   5336851..5336971))
FT                   /codon_start=1
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, isoform CRA_a"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT87498.5
FT                   protein_id=hCP201176.5 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R856"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R856"
FT                   /protein_id="EAW87334.1"
FT                   /translation="MGPSASSHGSPVPLPSDLSFRSPTPSNLPMVQLWAAHAHEGFSHL
FT                   PSGLYPSYLHLNHLEPPSSGSPLLSQLGQPSIFDTQKGQGPGGDGFYLPTAGAPGSLHS
FT                   HAPSARTPGGGHSSGAPAKGSSSRDGPAKERAGRGGEPPPLFGKKDPRARGEEASGPRG
FT                   VVDLTQEARAEGRQDRGPPRLAERLSPFLAESKTKNAALQPSVLTMCNGGAGDVGLPAL
FT                   VAEAGRGGAKEAARQDEGARLLRRTETLLPGPRPCPSPLPPPPAPPKGPPAPPAATPAG
FT                   VYTVFREQGREHRVVAPTFVPSVEAFDERPGPIQIASQARDARAREREAGRPGVLQAPP
FT                   GSPRPLDRPEGLREKNSVIRSLKRPPPADAPTVRATRASPDPRAYVPAKELLKPEADPR
FT                   PCERAPRGPAGPAAQQAAKLFGLEPGRPPPTGPEHKWKPFELGNFAATQMAVLAAQHHH
FT                   SRAEEEAAVVAASSSKKAYLDPGAVLPRSAATCGRPVADMHSAAHGSGEASAMQSLIKY
FT                   SGSFARDAVAVRPGGCGKKSPFGGLGTMKPEPAPTSAGASRAQARLPHSGGPAAGGGRQ
FT                   LKRDPERPESAKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGGSGRLGPGLVDQER
FT                   SLSLSNVKGHGRADEDCVDDRARHREERLLGARLDRDQEKLLRESKELADLARLHPTSC
FT                   APNGLNPNLMVTGGPALAGSGRWSADPAAHLATHPWLPRSGNASMWLAGHPYGLGPPSL
FT                   HQGMAPAFPPGLGGSLPSAYQFVRDPQSGQLVVIPSDHLPHFAELMERATVPPLWPALY
FT                   PPGRSPLHHAQQLQLFSQQHFLRQQEFLYLQQQAAQALELQRSAQLVQERLKAQEHRAE
FT                   MEEKGSKRGLEAAGKAGLATAGPGLLPRKPPGLAAGPAGTYGKAVSPPPSPRASPVAAL
FT                   KAKVIQKLEDVSKPPAYAYPATPSSHPTSPPPASPPPTPGITRKEEAPENVVEKKDLEL
FT                   EKEAPSPFQALFSDIPPRYPFQALPPHYGRPYPFLLQPTAAADADGLAPDVPLPADGPE
FT                   RLALSPEDKPIRLSPSKITEPLREGPEEEPLAEREVKAEVEDMDEGPTELPPLESPLPL
FT                   PAAEAMATPSPAGGCGGGLLEAQALSATGQSCAEPSECPDFVEGPEPRVDSPGRTEPCT
FT                   AALDLGVQLTPETLVEAKEEPVEVPVAVPVVEAVPEEGLAQVAPSESQPTLEMSDCDVP
FT                   AGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLP
FT                   SPGAAGAQALEKLEAAESLVLEQSFLHGITLLSEIAELELERRSQEMGGAERALVARPS
FT                   LESLLAAGSHMLREVLDGPVVDPLKNLRLPRELKPNKKYSWMRKKEERMYAMKSSLEDM
FT                   DALELDFRMRLAEVQRQYKEKQRELVKLQRRRDSEDRREEPHRSLARRGPGRPRKRTHA
FT                   PSALSPPRKRGKSGHSSGKLSSKSLLTSDDYELGAGIRKRHKGSEEEHDALIGMGKARG
FT                   RNQTWDEHEASSDFISQLKIKKKKMASDQEQLASKLDKALSLTKQDKLKSPFKFSDSAG
FT                   GKSKTSGGCGRYLTPYDSLLGKNRKALAKGLGLSLKSSREGKHKRAAKTRKMEVGFKAR
FT                   GQPKSAHSPFASEVSSYSYNTDSEEDEEFLKDEWPAQGPSSSKLTPSLLCSMVAKNSKA
FT                   AGGPKLTKRGLAAPRTLKPKPATSRKQPFCLLLREAEARSSFSDSSEESFDQDESSEEE
FT                   DEEEELEEEDEASGGGYRLGARERALSPGLEESGLGLLARFAASALPSPTVGPSLSVVQ
FT                   LEAKQKARKKEERQSLLGTEFEYTDSESEVKVRKRSPAGLLRPKKGLGEPGPSLAAPTP
FT                   GARGPDPSSPDKAKLAVEKGRKARKLRGPKEPGFEAGPEASDDDLWTRRRSERIFLHDA
FT                   SAAAPAPVSTAPATKTSRCAKGGPLSPRKDAGRAKDRKDPRKVPATVSKGRHWKKKGKE
FT                   AGPGAGLPPPRAPALPSEARAPHASSLTAAKRSKAKAKGKEVKKENRGKGGAVSKLMES
FT                   MAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPAPRSCIIDKDELKDGLRVLIPMDDKL
FT                   LYAGHVQTVHSPDIYRVVVEGERGNRPHIYCLEQLLQEAIIDVRPASTRFLPQGTRIAA
FT                   YWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTGRIPLSHIRLLPPDYKIQCAEP
FT                   SPALLVPSAKRRSRKTSKDTGEGKDGGTAGSEEPGAKARGRGRKPSAKAKGDRAATLEE
FT                   GNPTDEVPSTPLALEPSSTPGSKKSPPEPVDKRAKAPKARPAPPQPSPAPPAFTSCPAP
FT                   EPFAELPAPATSLAPAPLITMPATRPKPKKARAAEESGAKGPRRPGEEAELLVKLDHEA
FT                   PTAGPSAQAALPTKATKQAGKARPSAHSPGKKTPAPQPQAPPPQPTQPLQPKAQAGAKS
FT                   RPKKREGVHLPTTKELAKRQRLPSVENRPKIAAFLPARQLWKWFGKPTQRRGMKGKARK
FT                   LFYKAIVRGKEMIRIGDCAVFLSAGRPNLPYIGRIQSMWESWGNNMVVRVKWFYHPEET
FT                   SPGKQFHQGQHWDQKSSRSLPAALRVSSQRKDFMERALYQSSHVDENDVQTVSHKCLVV
FT                   GLEQYEQMLKTKKYQDSEGLYYLAGTYEPTTGMIFSTDGVPVLC"
FT   CDS             complement(join(5250453..5250659,5251222..5251296,
FT                   5251479..5251715,5254858..5255183,5255909..5256283,
FT                   5257404..5257568,5258375..5258491,5262736..5262844,
FT                   5262950..5263025,5263491..5263608,5266647..5266788,
FT                   5267529..5267711))
FT                   /codon_start=1
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, isoform CRA_c"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273090.1
FT                   protein_id=hCP1787989.1 isoform=CRA_c"
FT                   /protein_id="EAW87333.1"
FT                   /translation="MAPLCCFLLQKKKGKEAGPGAGLPPPRAPALPSEARAPHASSLTA
FT                   AKRSKAKAKGKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVER
FT                   PLTPAPRSCIIDKDELKDGLRVLIPMDDKLLYAGHVQTVHSPDIYRVVVEGERGNRPHI
FT                   YCLEQLLQEAIIDVRPASTRFLPQGTRIAAYWSQQYRCLYPGTVVRGLLDLEDDGDLIT
FT                   VEFDDGDTGRIPLSHIRLLPPDYKIQCAEPSPALLVPSAKRRSRKTSKDTGEGKDGGTA
FT                   GSEEPGAKARGRGRKPSAKAKGDRAATLEEGNPTDEVPSTPLALEPSSTPGSKKSPPEP
FT                   VDKRAKAPKARPAPPQPSPAPPAFTSCPAPEPFAELPAPATSLAPAPLITMPATRPKPK
FT                   KARAAEESGAKGPRRPGEEAELLVKLDHEAPTAGPSAQAALPTKATKQAGKARPSAHSP
FT                   GKKTPAPQPQAPPPQPTQPLQPKAQAGAKSRPKKREGVHLPTTKELAKRQRLPSVENRP
FT                   KIAAFLPARQLWKWFGKPTQRRGMKGKARKLFYKAIVRGKEMIRIGDCAVFLSAGRPNL
FT                   PYIGRIQSMWESWGNNMVVRVKWFYHPEETSPGKQFHQGQHWDQKSSRSLPAALRVSSQ
FT                   RKDFMERALYQSSHVDENDVQTVSHKCLVVGLEQYEQMLKTKKYQDSEGLYYLAGTYEP
FT                   TTGMIFSTDGVPVLC"
FT   assembly_gap    5255184..5255471
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   gene            5317102..5319100
FT                   /locus_tag="hCG_1992405"
FT                   /note="gene_id=hCG1992405.1"
FT   mRNA            5317102..5319100
FT                   /locus_tag="hCG_1992405"
FT                   /product="hCG1992405"
FT                   /note="gene_id=hCG1992405.1 transcript_id=hCT2270965.1;
FT                   overlap evidence=yes; created on 12-DEC-2003"
FT   CDS             5318017..5318934
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992405"
FT                   /product="hCG1992405"
FT                   /note="gene_id=hCG1992405.1 transcript_id=hCT2270965.1
FT                   protein_id=hCP1788040.1"
FT                   /protein_id="EAW87336.1"
FT                   /translation="MGPCRQEAAGQASLCLSERPPGEKRPGWAQATAGAHWTPSVSNHP
FT                   SPVPKATSLPWFPPRSCTLPCQSPSASAHSSLRLENSSTDGSRSRFHCCLLQKPSLTTC
FT                   PSAVFSLPVTVWRFCWLTRLPRHPWGPPEGAAPHPPRLTTSWALLCSSKAWAACCCRYR
FT                   NSCCRRKCCCEKSCSCWAWCRGLRPGGYRAGQRGGTVARSISSAAGTETVRCTCGLMLH
FT                   HHAHYEGKLKPERGHTHTVGSWALCGPPAAPQGPGSLSCPPWATCAPQARGTQPCPHPG
FT                   WDVPTASQPEQVSTQTRTRTTVRT"
FT   mRNA            complement(join(5331883..5333039,5336851..5337006,
FT                   5367779..5367902))
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, transcript variant hCT2273083"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273083.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 12-DEC-2003"
FT   CDS             complement(join(5332768..5333039,5336851..5336971))
FT                   /codon_start=1
FT                   /locus_tag="hCG_96198"
FT                   /product="hCG96198, isoform CRA_d"
FT                   /note="gene_id=hCG96198.5 transcript_id=hCT2273083.1
FT                   protein_id=hCP1788015.1 isoform=CRA_d"
FT                   /db_xref="HGNC:HGNC:11962"
FT                   /db_xref="UniProtKB/TrEMBL:A8MTZ4"
FT                   /protein_id="EAW87335.1"
FT                   /translation="MGPSASSHGSPVPLPSDLSFRSPTPSNLPMVQLWAAHAHEGFSHL
FT                   PSGLYPSYLHLNHLEPPSSGSPLLSQLGQPSIFDTQKGQGPGGGKTGVRGWGWHRGLLR
FT                   GFWGLWQHPGSPQLCPGCWLFFFFFF"
FT   assembly_gap    5356673..5356870
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    5357973..5358264
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            complement(5373811..5455559)
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /note="gene_id=hCG1993852.0"
FT   mRNA            complement(join(5373811..5373978,5380964..5381125,
FT                   5390241..5390358,5433547..5433765,5442772..5444315,
FT                   5447199..5447417,5455442..5455559))
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18,
FT                   transcript variant hCT2273126"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273126.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(5390352..5390358,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455459))
FT                   /codon_start=1
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273126.0
FT                   protein_id=hCP1788003.0 isoform=CRA_c"
FT                   /protein_id="EAW87340.1"
FT                   /translation="MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPS
FT                   TDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGC
FT                   YWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLS
FT                   SECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQS
FT                   NVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKN
FT                   LLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGK
FT                   DLRSLASLNLSGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSE
FT                   GLGRHLCQLLARLRHLRSLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQS
FT                   CPSPFSGQACPQPSSVFWSLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQ
FT                   SVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVY
FT                   MPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLA
FT                   FMARCLQVVMCHLFTGESLATCKSLQQSLLRSR"
FT   assembly_gap    5417199..5417538
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5419773..5419837,5423240..5424248,
FT                   5433547..5433765,5442772..5444315,5447199..5447417,
FT                   5455442..5455559))
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18,
FT                   transcript variant hCT2273125"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273125.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(5422848..5424248,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455559))
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18,
FT                   transcript variant hCT2273123"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273123.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(5424092..5424248,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455459))
FT                   /codon_start=1
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273123.0
FT                   protein_id=hCP1788006.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R857"
FT                   /protein_id="EAW87338.1"
FT                   /translation="MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPS
FT                   TDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGC
FT                   YWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLS
FT                   SECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQS
FT                   NVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKN
FT                   LLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGK
FT                   DLRSLASLNLSGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSE
FT                   GLGRHLCQLLARLRHLRSLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQS
FT                   CPSPFSGQACPQPSSVFWSLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQ
FT                   SVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVY
FT                   MPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLA
FT                   FMARCLQVVMCHLFTGESLATCKSLQQSLLRSFQAERPALNVVIFPLLHEGLTDVIRDV
FT                   PLVHLDEITLFKSRVAEEPPNLWW"
FT   CDS             complement(join(5424092..5424248,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455459))
FT                   /codon_start=1
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273125.0
FT                   protein_id=hCP1788010.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R857"
FT                   /protein_id="EAW87339.1"
FT                   /translation="MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPS
FT                   TDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGC
FT                   YWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLS
FT                   SECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQS
FT                   NVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKN
FT                   LLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGK
FT                   DLRSLASLNLSGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSE
FT                   GLGRHLCQLLARLRHLRSLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQS
FT                   CPSPFSGQACPQPSSVFWSLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQ
FT                   SVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVY
FT                   MPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLA
FT                   FMARCLQVVMCHLFTGESLATCKSLQQSLLRSFQAERPALNVVIFPLLHEGLTDVIRDV
FT                   PLVHLDEITLFKSRVAEEPPNLWW"
FT   mRNA            complement(join(<5432156..5432528,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455559))
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18,
FT                   transcript variant hCT2273122"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273122.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<5432156..5432528,5433547..5433765,
FT                   5442772..5444315,5447199..5447417,5455442..5455459))
FT                   /codon_start=1
FT                   /gene="FBXL18"
FT                   /locus_tag="hCG_1993852"
FT                   /product="F-box and leucine-rich repeat protein 18, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1993852.0 transcript_id=hCT2273122.0
FT                   protein_id=hCP1788007.0 isoform=CRA_a"
FT                   /protein_id="EAW87337.1"
FT                   /translation="MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPS
FT                   TDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGC
FT                   YWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLS
FT                   SECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQS
FT                   NVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKN
FT                   LLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGK
FT                   DLRSLASLNLSGCVHCLSPDSLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSE
FT                   GLGRHLCQLLARLRHLRSLSLPVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQS
FT                   CPSPFSGQACPQPSSVFWSLLKNLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQ
FT                   SVGDSEVAAIGQLAFLRHLTLAQLPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVY
FT                   MPALSDMLKHCKRLRDLRLEQPYFSANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLA
FT                   FMARCLQVVMCHLFTGESLATCKSLQQSLLRRWGEVTGRRPQLFTELREEPSARTSRAT
FT                   GRRQPCLPDSGVVCCPCGRPLAVSGIILVGVSPSLVVKTTCVYRVLFKNLDYASIFFLV
FT                   CLFETESHSVVQAGVQWRDLSSLQPLLSGLQPQPPEQL"
FT   gene            complement(5468945..5472422)
FT                   /locus_tag="hCG_15971"
FT                   /note="gene_id=hCG15971.2"
FT   mRNA            complement(join(5468945..5469700,5469813..5469994,
FT                   5470090..5470528,5470970..5471209,5471344..5471472,
FT                   5472329..5472422))
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, transcript variant hCT7001"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT7001.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 04-APR-2003"
FT   mRNA            complement(join(5468945..5469700,5469813..5469994,
FT                   5470090..5470528,5470828..5470868,5470970..5471209,
FT                   5471344..5471472,5472329..5472422))
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, transcript variant hCT2273115"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT2273115.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 04-APR-2003"
FT   mRNA            complement(join(5468945..5469700,5469813..5469994,
FT                   5470090..5470528,5470970..5471209,5471344..5471542,
FT                   5472329..5472405))
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, transcript variant hCT1950745"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT1950745.2;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 04-APR-2003"
FT   CDS             complement(join(5469557..5469700,5469813..5469994,
FT                   5470090..5470528,5470970..5471209,5471344..5471466))
FT                   /codon_start=1
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, isoform CRA_a"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT1950745.2
FT                   protein_id=hCP1762160.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q1KLZ0"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1KLZ0"
FT                   /protein_id="EAW87341.1"
FT                   /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD
FT                   FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS
FT                   IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW
FT                   IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   CDS             complement(join(5469557..5469700,5469813..5469994,
FT                   5470090..5470528,5470970..5471209,5471344..5471466))
FT                   /codon_start=1
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, isoform CRA_a"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT7001.2
FT                   protein_id=hCP35421.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q1KLZ0"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q1KLZ0"
FT                   /protein_id="EAW87343.1"
FT                   /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD
FT                   FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS
FT                   IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW
FT                   IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   CDS             complement(join(5470854..5470868,5470970..5471209,
FT                   5471344..5471466))
FT                   /codon_start=1
FT                   /locus_tag="hCG_15971"
FT                   /product="hCG15971, isoform CRA_b"
FT                   /note="gene_id=hCG15971.2 transcript_id=hCT2273115.1
FT                   protein_id=hCP1788009.1 isoform=CRA_b"
FT                   /db_xref="GOA:G5E9R0"
FT                   /db_xref="HGNC:HGNC:132"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:G5E9R0"
FT                   /protein_id="EAW87342.1"
FT                   /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQDSLL"
FT   gene            5534450..5548302
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /note="gene_id=hCG1992389.0"
FT   mRNA            join(5534450..5535413,5544903..5545059,5545142..5545263,
FT                   5545509..5545680,5546918..5548302)
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), transcript variant
FT                   hCT2270942"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270942.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5534450..5535413,5544903..5545059,5545142..5545263,
FT                   5545509..5545676,5546918..5548302)
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), transcript variant
FT                   hCT2270940"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270940.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5534450..5535413,5544903..5545059,5545142..5545263,
FT                   5546918..5548302)
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), transcript variant
FT                   hCT2270943"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270943.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(5534582..5535413,5544903..5545059,5545142..5545263,
FT                   5545509..5545676,5546918..5547120)
FT                   /codon_start=1
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), isoform CRA_c"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270940.0
FT                   protein_id=hCP1788045.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q16658"
FT                   /db_xref="HGNC:HGNC:11148"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010431"
FT                   /db_xref="InterPro:IPR022768"
FT                   /db_xref="InterPro:IPR024703"
FT                   /db_xref="InterPro:IPR030146"
FT                   /db_xref="PDB:1DFC"
FT                   /db_xref="PDB:3LLP"
FT                   /db_xref="PDB:3P53"
FT                   /db_xref="PDB:4GOV"
FT                   /db_xref="PDB:4GOY"
FT                   /db_xref="PDB:4GP0"
FT                   /db_xref="PDB:4GP3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16658"
FT                   /protein_id="EAW87346.1"
FT                   /translation="MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQI
FT                   WTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQ
FT                   SEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEI
FT                   AVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPATGYTLEFRSGKVA
FT                   FRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDL
FT                   SANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEW
FT                   RDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRK
FT                   VTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDY
FT                   NKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY"
FT   CDS             join(5534582..5535413,5544903..5545059,5545142..5545263,
FT                   5546918..5547120)
FT                   /codon_start=1
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), isoform CRA_b"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270943.0
FT                   protein_id=hCP1788047.0 isoform=CRA_b"
FT                   /protein_id="EAW87345.1"
FT                   /translation="MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQI
FT                   WTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQ
FT                   SEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEI
FT                   AVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPATGYTLEFRSGKVA
FT                   FRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDL
FT                   SANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEW
FT                   RDRRITLRASNGKFVTSKKNGQLAASVETADSTGKYWTVGSDSAVTSSGDTPVDFFFEF
FT                   CDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY"
FT   CDS             join(5534582..5535413,5544903..5545059,5545142..5545263,
FT                   5545509..5545680,5546918..5546951)
FT                   /codon_start=1
FT                   /gene="FSCN1"
FT                   /locus_tag="hCG_1992389"
FT                   /product="fascin homolog 1, actin-bundling protein
FT                   (Strongylocentrotus purpuratus), isoform CRA_a"
FT                   /note="gene_id=hCG1992389.0 transcript_id=hCT2270942.0
FT                   protein_id=hCP1788048.0 isoform=CRA_a"
FT                   /protein_id="EAW87344.1"
FT                   /translation="MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQI
FT                   WTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQ
FT                   SEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEI
FT                   AVDRDVPWGVDSLITLAFQDQRYSVQTADHRFLRHDGRLVARPEPATGYTLEFRSGKVA
FT                   FRDCEGRYLAPSGPSGTLKAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDL
FT                   SANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEW
FT                   RDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRK
FT                   VTGTLDANRSSYDVFQLEFNDGAYNIKGRLHRQILDGGQ"
FT   gene            complement(5562836..5723336)
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /note="gene_id=hCG1993840.0"
FT   mRNA            complement(join(5562836..5564824,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662802,5666954..5667068,5671062..5671226,
FT                   5672345..5672447,5702634..5702769,5723170..5723336))
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, transcript variant hCT2273101"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273101.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(5562836..5564822,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662802,5666954..5667068,5671062..5671226,
FT                   5672345..5672447,5680913..5680989,5682610..5683281,
FT                   5694470..5694603,5702634..5702769,5723170..5723336))
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, transcript variant hCT2273102"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273102.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(5562836..5564822,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662787,5666954..5667068,5671062..5671226,
FT                   5672341..5672447,5680913..5680989,5682610..5683281,
FT                   5694470..5694603,5702634..5702769,5723170..5723336))
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, transcript variant hCT2273104"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273104.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/16;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(5564405..5564822,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662802,5666954..5667068,5671062..5671226,
FT                   5672345..5672447,5680913..5680989,5682610..5683281,
FT                   5694470..5694603,5702634..5702700))
FT                   /codon_start=1
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, isoform CRA_c"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273102.0
FT                   protein_id=hCP1787998.0 isoform=CRA_c"
FT                   /protein_id="EAW87349.1"
FT                   /translation="MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPM
FT                   LVTPAPQQHEEEDLDDDVILTEDDSEDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPS
FT                   HNQAANDIVNPRSEQKVIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALAD
FT                   DQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFPRPEP
FT                   QQGGISGPSSPQPAHPLGEFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVDQ
FT                   ELVELLVKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPS
FT                   SSLLASQDETKLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKG
FT                   HYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLEN
FT                   KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRC
FT                   CYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKV
FT                   LPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRK
FT                   CQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCR
FT                   CGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEE
FT                   EQKRKNGGKTPSNALDPRWRSLWRRCRGWRPSRGPFRRTCHSHRCHPMPSRTHPSPCLP
FT                   CGLCSTTSHSTWGLSQPRTCPLCPTCGSTMTSVPSTCPWSTTCPCTLAPSRGIASDGPE
FT                   SPLSSTKPVWGRSVDGEPSPKAGVCTIAS"
FT   CDS             complement(join(5564405..5564822,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662787,5666954..5667068,5671062..5671226,
FT                   5672341..5672355))
FT                   /codon_start=1
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, isoform CRA_b"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273104.0
FT                   protein_id=hCP1787999.0 isoform=CRA_b"
FT                   /protein_id="EAW87348.1"
FT                   /translation="MRQRQLPKIDFFDYSKLTPLDQRCFIQAADLLMADFKVLSSQDIK
FT                   WALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQEKRMFF
FT                   LENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIE
FT                   CRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSEL
FT                   EKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKET
FT                   CRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRM
FT                   SCRCGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKE
FT                   AEEEQKRKNGGKTPSNALDPRWRSLWRRCRGWRPSRGPFRRTCHSHRCHPMPSRTHPSP
FT                   CLPCGLCSTTSHSTWGLSQPRTCPLCPTCGSTMTSVPSTCPWSTTCPCTLAPSRGIASD
FT                   GPESPLSSTKPVWGRSVDGEPSPKAGVCTIAS"
FT   CDS             complement(join(5564581..5564824,5565697..5565770,
FT                   5582799..5583021,5594055..5594152,5653399..5653477,
FT                   5654353..5654501,5656691..5656828,5658349..5658399,
FT                   5662663..5662802,5666954..5667068,5671062..5671145))
FT                   /codon_start=1
FT                   /gene="TRIAD3"
FT                   /locus_tag="hCG_1993840"
FT                   /product="TRIAD3 protein, isoform CRA_a"
FT                   /note="gene_id=hCG1993840.0 transcript_id=hCT2273101.0
FT                   protein_id=hCP1788001.0 isoform=CRA_a"
FT                   /protein_id="EAW87347.1"
FT                   /translation="MADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSPETS
FT                   GKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFY
FT                   EQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECL
FT                   IRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYAD
FT                   ELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKY
FT                   RTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPR
FT                   SPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGGKEHLQTHWTPAGEACG
FT                   EGAEGGGPPEARSAEPATATDATLCLRAPTLPPASRAACVQQLPTQHGAYPSPVRAPSA
FT                   QRAGQL"
FT   gene            <5764737..5789483
FT                   /locus_tag="hCG_1992395"
FT                   /note="gene_id=hCG1992395.0"
FT   mRNA            join(<5764737..5765147,5765368..>5765400)
FT                   /locus_tag="hCG_1992395"
FT                   /product="hCG1992395, transcript variant hCT2270949"
FT                   /note="gene_id=hCG1992395.0 transcript_id=hCT2270949.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(5764737..5765147,5765368..>5765400)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992395"
FT                   /product="hCG1992395, isoform CRA_b"
FT                   /note="gene_id=hCG1992395.0 transcript_id=hCT2270949.0
FT                   protein_id=hCP1788017.0 isoform=CRA_b"
FT                   /protein_id="EAW87351.1"
FT                   /translation="MASWGVLGVVVPGGAAFTQCFEVQDCNARTSGPQTLPTATDTSDT
FT                   RCGGRRSGSGAVPSASVAGTHLLQSRHCTGVLGGGSSRRLCGLSGAAELGWGTLQVVGP
FT                   EQRLAPHLTALPRTPPSSGSLCRAPATVTTWTQTPDRSQWWALS"
FT   mRNA            join(5764806..5765147,5781542..5781668,5782283..5782449,
FT                   5788673..5789483)
FT                   /locus_tag="hCG_1992395"
FT                   /product="hCG1992395, transcript variant hCT2270948"
FT                   /note="gene_id=hCG1992395.0 transcript_id=hCT2270948.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(5782413..5782449,5788673..5789229)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992395"
FT                   /product="hCG1992395, isoform CRA_a"
FT                   /note="gene_id=hCG1992395.0 transcript_id=hCT2270948.0
FT                   protein_id=hCP1788016.0 isoform=CRA_a"
FT                   /protein_id="EAW87350.1"
FT                   /translation="MEEEEIRTWSFPGANPRGGHQCGSALSCDEGVPAAQGASSEKPHE
FT                   CTKCGKALCCRSDLRVHHGVHAGEKSSACSERGSGFREKLCPDKQGTHTKEKPARDSRS
FT                   GKTIFRKTRLCVPGTVHAGAKPYKCWECEKTSHKSRLIEHLRSHTGEKPCGCRECGKAF
FT                   FQKSHLILRQRTHTGEKPCGCAECGKAAPRTPAS"
FT   gene            <5822485..5827951
FT                   /locus_tag="hCG_18255"
FT                   /note="gene_id=hCG18255.2"
FT   mRNA            join(<5822485..5822545,5824084..5824216,5825485..5825594,
FT                   5827661..5827951)
FT                   /locus_tag="hCG_18255"
FT                   /product="hCG18255"
FT                   /note="gene_id=hCG18255.2 transcript_id=hCT9313.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             join(5822485..5822545,5824084..5824216,5825485..5825594,
FT                   5827661..5827686)
FT                   /codon_start=1
FT                   /locus_tag="hCG_18255"
FT                   /product="hCG18255"
FT                   /note="gene_id=hCG18255.2 transcript_id=hCT9313.2
FT                   protein_id=hCP36152.2"
FT                   /db_xref="GOA:P0CE72"
FT                   /db_xref="HGNC:HGNC:8105"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008080"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="PDB:1TTX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CE72"
FT                   /protein_id="EAW87352.1"
FT                   /translation="MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVK
FT                   DVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQ
FT                   EMVHS"
FT   gene            5840349..5843646
FT                   /locus_tag="hCG_1992397"
FT                   /note="gene_id=hCG1992397.0"
FT   mRNA            join(5840349..5840541,5841877..5841974,5842066..5842159,
FT                   5842448..5842525,5843250..5843646)
FT                   /locus_tag="hCG_1992397"
FT                   /product="hCG1992397, transcript variant hCT2270952"
FT                   /note="gene_id=hCG1992397.0 transcript_id=hCT2270952.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5840354..5840521,5841880..5841974,5842066..5842882)
FT                   /locus_tag="hCG_1992397"
FT                   /product="hCG1992397, transcript variant hCT2270951"
FT                   /note="gene_id=hCG1992397.0 transcript_id=hCT2270951.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/2;
FT                   created on 26-AUG-2002"
FT   CDS             join(5840402..5840521,5841880..5841974,5842066..5842201)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992397"
FT                   /product="hCG1992397, isoform CRA_a"
FT                   /note="gene_id=hCG1992397.0 transcript_id=hCT2270951.0
FT                   protein_id=hCP1788042.0 isoform=CRA_a"
FT                   /protein_id="EAW87353.1"
FT                   /translation="MAAAAAGAGSGPWAAQEKQFPPALLSFFIYNPRFGPREGQENKIL
FT                   FYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMV
FT                   FTHTVYLSEIVW"
FT   CDS             join(5840524..5840541,5841877..5841974,5842066..5842159,
FT                   5842448..5842525,5843250..5843369)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1992397"
FT                   /product="hCG1992397, isoform CRA_b"
FT                   /note="gene_id=hCG1992397.0 transcript_id=hCT2270952.0
FT                   protein_id=hCP1788041.0 isoform=CRA_b"
FT                   /protein_id="EAW87354.1"
FT                   /translation="MRRGRREENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSK
FT                   PAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVL
FT                   RQCYSMYKVSVAFFLNSESSHLPLSLGSRVV"
XX
CO   join(AADB02010298.1:1..94443,gap(117),AADB02010299.1:1..32702,gap(3761),
CO   complement(AADB02010300.1:1..22046),gap(120),AADB02010301.1:1..13242,
CO   gap(2037),AADB02010302.1:1..10019,gap(68),AADB02010303.1:1..9000,gap(547),
CO   AADB02010304.1:1..1192,gap(143),complement(AADB02010305.1:1..5970),gap(20),
CO   complement(AADB02010306.1:1..2295),gap(1204),AADB02010307.1:1..1030,
CO   gap(20),AADB02010308.1:1..9162,gap(306),AADB02010309.1:1..26014,gap(252),
CO   AADB02010310.1:1..10864,gap(20),complement(AADB02010311.1:1..1466),gap(20),
CO   AADB02010312.1:1..14831,gap(340),AADB02010313.1:1..2254,gap(20),
CO   AADB02010314.1:1..14357,gap(86),AADB02010315.1:1..2489,gap(64),
CO   complement(AADB02010316.1:1..872),gap(133),AADB02010317.1:1..3497,gap(20),
CO   AADB02010318.1:1..11287,gap(116),complement(AADB02010319.1:1..1060),
CO   gap(1456),AADB02010320.1:1..5410,gap(1835),AADB02010321.1:1..5160,gap(142),
CO   AADB02010322.1:1..11071,gap(20),complement(AADB02010323.1:1..1409),gap(84),
CO   complement(AADB02010324.1:1..3108),gap(194),AADB02010325.1:1..3345,gap(58),
CO   AADB02010326.1:1..19405,gap(256),AADB02010327.1:1..7523,gap(112),
CO   complement(AADB02010328.1:1..2278),gap(563),
CO   complement(AADB02010329.1:1..2540),gap(932),AADB02010330.1:1..10899,
CO   gap(396),complement(AADB02010331.1:1..6301),gap(138),
CO   AADB02010332.1:1..1486,gap(250),AADB02010333.1:1..8447,gap(3238),
CO   AADB02010334.1:1..19909,gap(1406),complement(AADB02010335.1:1..2649),
CO   gap(2572),complement(AADB02010336.1:1..4235),gap(20),
CO   AADB02010337.1:1..1637,gap(635),AADB02010338.1:1..2047,gap(642),
CO   AADB02010339.1:1..1353,gap(689),AADB02010340.1:1..7776,gap(59),
CO   AADB02010341.1:1..2447,gap(20),AADB02010342.1:1..8716,gap(289),
CO   AADB02010343.1:1..6890,gap(299),AADB02010344.1:1..8409,gap(1095),
CO   AADB02010345.1:1..19692,gap(98),AADB02010346.1:1..1550,gap(165),
CO   AADB02010347.1:1..10200,gap(2577),AADB02010348.1:1..6354,gap(67),
CO   AADB02010349.1:1..7430,gap(20),complement(AADB02010350.1:1..6456),gap(821),
CO   AADB02010351.1:1..5917,gap(571),AADB02010352.1:1..2632,gap(80),
CO   complement(AADB02010353.1:1..5238),gap(20),
CO   complement(AADB02010354.1:1..17247),gap(102),AADB02010355.1:1..1975,
CO   gap(2102),AADB02010356.1:1..43166,gap(20),
CO   complement(AADB02010357.1:1..3619),gap(349),AADB02010358.1:1..12372,
CO   gap(20),complement(AADB02010359.1:1..17260),gap(21),
CO   complement(AADB02010360.1:1..8189),gap(20),
CO   complement(AADB02010361.1:1..9069),gap(81),AADB02010362.1:1..5056,gap(289),
CO   AADB02010363.1:1..14742,gap(498),AADB02010364.1:1..25392,gap(20),
CO   complement(AADB02010365.1:1..10541),gap(72),AADB02010366.1:1..46940,
CO   gap(20),complement(AADB02010367.1:1..6753),gap(1065),
CO   complement(AADB02010368.1:1..59567),gap(20),AADB02010369.1:1..383546,
CO   gap(149),AADB02010370.1:1..6081,gap(2616),AADB02010371.1:1..22203,gap(20),
CO   AADB02010372.1:1..38005,gap(375),complement(AADB02010373.1:1..45143),
CO   gap(1094),AADB02010374.1:1..10367,gap(20),AADB02010375.1:1..14881,gap(33),
CO   complement(AADB02010376.1:1..10862),gap(950),AADB02010377.1:1..4289,
CO   gap(20),AADB02010378.1:1..26118,gap(1326),AADB02010379.1:1..1552,gap(218),
CO   complement(AADB02010380.1:1..1253),gap(20),AADB02010381.1:1..163306,
CO   gap(106),AADB02010382.1:1..46043,gap(592),AADB02010383.1:1..4662,gap(1076),
CO   AADB02010384.1:1..5268,gap(20),AADB02010385.1:1..89022,gap(271),
CO   complement(AADB02010386.1:1..46684),gap(229),AADB02010387.1:1..9017,
CO   gap(373),AADB02010388.1:1..5111,gap(397),
CO   complement(AADB02010389.1:1..2307),gap(452),AADB02010390.1:1..8950,
CO   gap(291),AADB02010391.1:1..4609,gap(1262),AADB02010392.1:1..40206,gap(20),
CO   AADB02010393.1:1..53475,gap(20),AADB02010394.1:1..65535,gap(20),
CO   AADB02010395.1:1..1977991,gap(2423),AADB02010396.1:1..607147,gap(6708),
CO   complement(AADB02010397.1:1..80227),gap(1307),
CO   complement(AADB02010398.1:1..276381),gap(1184),
CO   complement(AADB02010399.1:1..160877),gap(20),AADB02010400.1:1..113873,
CO   gap(20),complement(AADB02010401.1:1..3685),gap(20),
CO   complement(AADB02010402.1:1..21013),gap(20),
CO   complement(AADB02010403.1:1..23941),gap(429),
CO   complement(AADB02010404.1:1..29621),gap(288),AADB02010405.1:1..101201,
CO   gap(198),complement(AADB02010406.1:1..1102),gap(292),
CO   AADB02010407.1:1..58934,gap(340),complement(AADB02010408.1:1..426190))
//