spacer

EBI Dbfetch

ID   CH471134; SV 1; linear; genomic DNA; CON; HUM; 8495160 BP.
XX
AC   CH471134; AADB02000000;
XX
PR   Project:PRJNA1431;
XX
DT   30-JUL-2005 (Rel. 84, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens 211000035839713 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-8495160
RX   DOI; 10.1126/science.1058040.
RX   PUBMED; 11181995.
RA   Venter J.C., Adams M.D., Myers E.W., Li P.W., Mural R.J., Sutton G.G.,
RA   Smith H.O., Yandell M., Evans C.A., Holt R.A., Gocayne J.D., Amanatides P.,
RA   Ballew R.M., Huson D.H., Wortman J.R., Zhang Q., Kodira C.D., Zheng X.H.,
RA   Chen L., Skupski M., Subramanian G., Thomas P.D., Zhang J.,
RA   Gabor Miklos G.L., Nelson C., Broder S., Clark A.G., Nadeau J.,
RA   McKusick V.A., Zinder N., Levine A.J., Roberts R.J., Simon M., Slayman C.,
RA   Hunkapiller M., Bolanos R., Delcher A., Dew I., Fasulo D., Flanigan M.,
RA   Florea L., Halpern A., Hannenhalli S., Kravitz S., Levy S., Mobarry C.,
RA   Reinert K., Remington K., Abu-Threideh J., Beasley E., Biddick K.,
RA   Bonazzi V., Brandon R., Cargill M., Chandramouliswaran I., Charlab R.,
RA   Chaturvedi K., Deng Z., Di Francesco V., Dunn P., Eilbeck K.,
RA   Evangelista C., Gabrielian A.E., Gan W., Ge W., Gong F., Gu Z., Guan P.,
RA   Heiman T.J., Higgins M.E., Ji R.R., Ke Z., Ketchum K.A., Lai Z., Lei Y.,
RA   Li Z., Li J., Liang Y., Lin X., Lu F., Merkulov G.V., Milshina N.,
RA   Moore H.M., Naik A.K., Narayan V.A., Neelam B., Nusskern D., Rusch D.B.,
RA   Salzberg S., Shao W., Shue B., Sun J., Wang Z., Wang A., Wang X., Wang J.,
RA   Wei M., Wides R., Xiao C., Yan C., Yao A., Ye J., Zhan M., Zhang W.,
RA   Zhang H., Zhao Q., Zheng L., Zhong F., Zhong W., Zhu S., Zhao S.,
RA   Gilbert D., Baumhueter S., Spier G., Carter C., Cravchik A., Woodage T.,
RA   Ali F., An H., Awe A., Baldwin D., Baden H., Barnstead M., Barrow I.,
RA   Beeson K., Busam D., Carver A., Center A., Cheng M.L., Curry L.,
RA   Danaher S., Davenport L., Desilets R., Dietz S., Dodson K., Doup L.,
RA   Ferriera S., Garg N., Gluecksmann A., Hart B., Haynes J., Haynes C.,
RA   Heiner C., Hladun S., Hostin D., Houck J., Howland T., Ibegwam C.,
RA   Johnson J., Kalush F., Kline L., Koduru S., Love A., Mann F., May D.,
RA   McCawley S., McIntosh T., McMullen I., Moy M., Moy L., Murphy B.,
RA   Nelson K., Pfannkoch C., Pratts E., Puri V., Qureshi H., Reardon M.,
RA   Rodriguez R., Rogers Y.H., Romblad D., Ruhfel B., Scott R., Sitter C.,
RA   Smallwood M., Stewart E., Strong R., Suh E., Thomas R., Tint N.N., Tse S.,
RA   Vech C., Wang G., Wetter J., Williams S., Williams M., Windsor S.,
RA   Winn-Deen E., Wolfe K., Zaveri J., Zaveri K., Abril J.F., Guigo R.,
RA   Campbell M.J., Sjolander K.V., Karlak B., Kejariwal A., Mi H., Lazareva B.,
RA   Hatton T., Narechania A., Diemer K., Muruganujan A., Guo N., Sato S.,
RA   Bafna V., Istrail S., Lippert R., Schwartz R., Walenz B., Yooseph S.,
RA   Allen D., Basu A., Baxendale J., Blick L., Caminha M., Carnes-Stine J.,
RA   Caulk P., Chiang Y.H., Coyne M., Dahlke C., Mays A., Dombroski M.,
RA   Donnelly M., Ely D., Esparham S., Fosler C., Gire H., Glanowski S.,
RA   Glasser K., Glodek A., Gorokhov M., Graham K., Gropman B., Harris M.,
RA   Heil J., Henderson S., Hoover J., Jennings D., Jordan C., Jordan J.,
RA   Kasha J., Kagan L., Kraft C., Levitsky A., Lewis M., Liu X., Lopez J.,
RA   Ma D., Majoros W., McDaniel J., Murphy S., Newman M., Nguyen T., Nguyen N.,
RA   Nodell M., Pan S., Peck J., Peterson M., Rowe W., Sanders R., Scott J.,
RA   Simpson M., Smith T., Sprague A., Stockwell T., Turner R., Venter E.,
RA   Wang M., Wen M., Wu D., Wu M., Xia A., Zandieh A., Zhu X.;
RT   "The sequence of the human genome";
RL   Science 291(5507):1304-1351(2001).
XX
RN   [2]
RP   1-8495160
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; cb9e2113e1745e2b228d67b35f82e0bd.
DR   ENA; AADB020000000; SET.
DR   ENA; AADB000000000; SET.
DR   ENA-CON; CM000252.
DR   Ensembl-Gn; ENSG00000001461; homo_sapiens.
DR   Ensembl-Gn; ENSG00000009709; homo_sapiens.
DR   Ensembl-Gn; ENSG00000011007; homo_sapiens.
DR   Ensembl-Gn; ENSG00000020633; homo_sapiens.
DR   Ensembl-Gn; ENSG00000053372; homo_sapiens.
DR   Ensembl-Gn; ENSG00000057757; homo_sapiens.
DR   Ensembl-Gn; ENSG00000075151; homo_sapiens.
DR   Ensembl-Gn; ENSG00000076864; homo_sapiens.
DR   Ensembl-Gn; ENSG00000077549; homo_sapiens.
DR   Ensembl-Gn; ENSG00000088280; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117118; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117122; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117298; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117318; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117602; homo_sapiens.
DR   Ensembl-Gn; ENSG00000117616; homo_sapiens.
DR   Ensembl-Gn; ENSG00000125944; homo_sapiens.
DR   Ensembl-Gn; ENSG00000127463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000127483; homo_sapiens.
DR   Ensembl-Gn; ENSG00000142623; homo_sapiens.
DR   Ensembl-Gn; ENSG00000142661; homo_sapiens.
DR   Ensembl-Gn; ENSG00000142676; homo_sapiens.
DR   Ensembl-Gn; ENSG00000142677; homo_sapiens.
DR   Ensembl-Gn; ENSG00000158055; homo_sapiens.
DR   Ensembl-Gn; ENSG00000158747; homo_sapiens.
DR   Ensembl-Gn; ENSG00000158748; homo_sapiens.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Gn; ENSG00000159423; homo_sapiens.
DR   Ensembl-Gn; ENSG00000162543; homo_sapiens.
DR   Ensembl-Gn; ENSG00000162545; homo_sapiens.
DR   Ensembl-Gn; ENSG00000162551; homo_sapiens.
DR   Ensembl-Gn; ENSG00000169504; homo_sapiens.
DR   Ensembl-Gn; ENSG00000173372; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183726; homo_sapiens.
DR   Ensembl-Gn; ENSG00000185436; homo_sapiens.
DR   Ensembl-Gn; ENSG00000187942; homo_sapiens.
DR   Ensembl-Gn; ENSG00000188257; homo_sapiens.
DR   Ensembl-Gn; ENSG00000188822; homo_sapiens.
DR   Ensembl-Gn; ENSG00000189410; homo_sapiens.
DR   Ensembl-Gn; ENSG00000219073; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244038; homo_sapiens.
DR   Ensembl-Gn; ENSG00000249087; homo_sapiens.
DR   Ensembl-Gn; ENSG00000270136; homo_sapiens.
DR   Ensembl-Tr; ENST00000003912; homo_sapiens.
DR   Ensembl-Tr; ENST00000236255; homo_sapiens.
DR   Ensembl-Tr; ENST00000243189; homo_sapiens.
DR   Ensembl-Tr; ENST00000246151; homo_sapiens.
DR   Ensembl-Tr; ENST00000264202; homo_sapiens.
DR   Ensembl-Tr; ENST00000264205; homo_sapiens.
DR   Ensembl-Tr; ENST00000264211; homo_sapiens.
DR   Ensembl-Tr; ENST00000270800; homo_sapiens.
DR   Ensembl-Tr; ENST00000289749; homo_sapiens.
DR   Ensembl-Tr; ENST00000289753; homo_sapiens.
DR   Ensembl-Tr; ENST00000290101; homo_sapiens.
DR   Ensembl-Tr; ENST00000290597; homo_sapiens.
DR   Ensembl-Tr; ENST00000308873; homo_sapiens.
DR   Ensembl-Tr; ENST00000312239; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000327535; homo_sapiens.
DR   Ensembl-Tr; ENST00000327575; homo_sapiens.
DR   Ensembl-Tr; ENST00000330263; homo_sapiens.
DR   Ensembl-Tr; ENST00000335648; homo_sapiens.
DR   Ensembl-Tr; ENST00000336689; homo_sapiens.
DR   Ensembl-Tr; ENST00000337107; homo_sapiens.
DR   Ensembl-Tr; ENST00000338888; homo_sapiens.
DR   Ensembl-Tr; ENST00000338909; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000342072; homo_sapiens.
DR   Ensembl-Tr; ENST00000344642; homo_sapiens.
DR   Ensembl-Tr; ENST00000350501; homo_sapiens.
DR   Ensembl-Tr; ENST00000356046; homo_sapiens.
DR   Ensembl-Tr; ENST00000356916; homo_sapiens.
DR   Ensembl-Tr; ENST00000357071; homo_sapiens.
DR   Ensembl-Tr; ENST00000358028; homo_sapiens.
DR   Ensembl-Tr; ENST00000361548; homo_sapiens.
DR   Ensembl-Tr; ENST00000374358; homo_sapiens.
DR   Ensembl-Tr; ENST00000374379; homo_sapiens.
DR   Ensembl-Tr; ENST00000374395; homo_sapiens.
DR   Ensembl-Tr; ENST00000374399; homo_sapiens.
DR   Ensembl-Tr; ENST00000374418; homo_sapiens.
DR   Ensembl-Tr; ENST00000374421; homo_sapiens.
DR   Ensembl-Tr; ENST00000374434; homo_sapiens.
DR   Ensembl-Tr; ENST00000374472; homo_sapiens.
DR   Ensembl-Tr; ENST00000374483; homo_sapiens.
DR   Ensembl-Tr; ENST00000374490; homo_sapiens.
DR   Ensembl-Tr; ENST00000374550; homo_sapiens.
DR   Ensembl-Tr; ENST00000374561; homo_sapiens.
DR   Ensembl-Tr; ENST00000374642; homo_sapiens.
DR   Ensembl-Tr; ENST00000374761; homo_sapiens.
DR   Ensembl-Tr; ENST00000374765; homo_sapiens.
DR   Ensembl-Tr; ENST00000374832; homo_sapiens.
DR   Ensembl-Tr; ENST00000374840; homo_sapiens.
DR   Ensembl-Tr; ENST00000374893; homo_sapiens.
DR   Ensembl-Tr; ENST00000374937; homo_sapiens.
DR   Ensembl-Tr; ENST00000375000; homo_sapiens.
DR   Ensembl-Tr; ENST00000375003; homo_sapiens.
DR   Ensembl-Tr; ENST00000375031; homo_sapiens.
DR   Ensembl-Tr; ENST00000375048; homo_sapiens.
DR   Ensembl-Tr; ENST00000375078; homo_sapiens.
DR   Ensembl-Tr; ENST00000375099; homo_sapiens.
DR   Ensembl-Tr; ENST00000375111; homo_sapiens.
DR   Ensembl-Tr; ENST00000375136; homo_sapiens.
DR   Ensembl-Tr; ENST00000375142; homo_sapiens.
DR   Ensembl-Tr; ENST00000375144; homo_sapiens.
DR   Ensembl-Tr; ENST00000375199; homo_sapiens.
DR   Ensembl-Tr; ENST00000375208; homo_sapiens.
DR   Ensembl-Tr; ENST00000375341; homo_sapiens.
DR   Ensembl-Tr; ENST00000375375; homo_sapiens.
DR   Ensembl-Tr; ENST00000375471; homo_sapiens.
DR   Ensembl-Tr; ENST00000375499; homo_sapiens.
DR   Ensembl-Tr; ENST00000375534; homo_sapiens.
DR   Ensembl-Tr; ENST00000375535; homo_sapiens.
DR   Ensembl-Tr; ENST00000399916; homo_sapiens.
DR   Ensembl-Tr; ENST00000400422; homo_sapiens.
DR   Ensembl-Tr; ENST00000400520; homo_sapiens.
DR   Ensembl-Tr; ENST00000400661; homo_sapiens.
DR   Ensembl-Tr; ENST00000401084; homo_sapiens.
DR   Ensembl-Tr; ENST00000402322; homo_sapiens.
DR   Ensembl-Tr; ENST00000415912; homo_sapiens.
DR   Ensembl-Tr; ENST00000418390; homo_sapiens.
DR   Ensembl-Tr; ENST00000420770; homo_sapiens.
DR   Ensembl-Tr; ENST00000425315; homo_sapiens.
DR   Ensembl-Tr; ENST00000427764; homo_sapiens.
DR   Ensembl-Tr; ENST00000428131; homo_sapiens.
DR   Ensembl-Tr; ENST00000431849; homo_sapiens.
DR   Ensembl-Tr; ENST00000433834; homo_sapiens.
DR   Ensembl-Tr; ENST00000436439; homo_sapiens.
DR   Ensembl-Tr; ENST00000437606; homo_sapiens.
DR   Ensembl-Tr; ENST00000438542; homo_sapiens.
DR   Ensembl-Tr; ENST00000444387; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
DR   Ensembl-Tr; ENST00000473314; homo_sapiens.
DR   Ensembl-Tr; ENST00000477853; homo_sapiens.
DR   Ensembl-Tr; ENST00000488683; homo_sapiens.
DR   Ensembl-Tr; ENST00000495204; homo_sapiens.
DR   Ensembl-Tr; ENST00000495646; homo_sapiens.
DR   Ensembl-Tr; ENST00000536471; homo_sapiens.
DR   Ensembl-Tr; ENST00000538309; homo_sapiens.
DR   Ensembl-Tr; ENST00000538839; homo_sapiens.
DR   Ensembl-Tr; ENST00000539907; homo_sapiens.
DR   Ensembl-Tr; ENST00000540617; homo_sapiens.
DR   Ensembl-Tr; ENST00000542643; homo_sapiens.
DR   Ensembl-Tr; ENST00000543870; homo_sapiens.
DR   Ensembl-Tr; ENST00000548815; homo_sapiens.
DR   Ensembl-Tr; ENST00000599760; homo_sapiens.
DR   Ensembl-Tr; ENST00000602326; homo_sapiens.
DR   Ensembl-Tr; ENST00000602624; homo_sapiens.
DR   Ensembl-Tr; ENST00000602662; homo_sapiens.
DR   Ensembl-Tr; ENST00000606561; homo_sapiens.
XX
CC   This is the November 2001 combined whole genome shotgun assembly
CC   applied to the 27 million reads of Celera's whole genome shotgun
CC   data and 16 million  reads of shredded GenBank data from other
CC   human genome projects (Nature 2001. 409:860-921). It relied on
CC   Celera's paired reads and BAC end reads from TIGR for long range
CC   order and orientation. Its scaffolds were mapped to chromosomes
CC   using STS maps. For more detailed information about whole genome
CC   sequencing and Celera's assembly process, please refer to Venter,
CC   J.C. et al. Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was created in
CC   April 2002 from the whole-genome mapping of transcript and protein
CC   sequences on the Celera human genome assembly
CC   (http://www.ncbi.nlm.nih.gov/genome/guide/human/release_notes.html)
CC   by Celera Chromosome Team, Content Systems and Informatics
CC   Research. The data sets used by this annotation process were
CC   collected in 2001 and include RefSeq (NM_) sequences, manually
CC   annotated transcripts from previous Celera assemblies, GenBank mRNA
CC   and dbEST sequences, Celera internal EST and full-insert sequences
CC   of cDNA clones (unpublished), mammalian SwissProt sequences, NRAA
CC   sequences, and International Protein Index (IPI) sequences (all
CC   human unless noted otherwise).  The CDS of each transcript was
CC   computationally defined by either the longest ATG-to-Stop or the
CC   longest open reading frame. All CDSs corresponding to the longest
CC   open reading frames with no starting ATG were flagged as partial.
CC   In addition, some of the genes were manually curated between 2002
CC   and 2005. Coverage analysis of splice junction donor/acceptor pairs
CC   and single-exon transcripts was done by Applied Biosystems in
CC   August 2006, based on Dec 2005 versions of human cDNA (RefSeq,
CC   Genbank mRNA and dbEST, Celera internal EST and full insert
CC   sequences) and human SwissProt sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8495160
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            4184..98255
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /note="gene_id=hCG1980890.0"
FT   mRNA            join(4184..4611,22298..22441,55447..55547,55626..55687,
FT                   55769..55934,56631..56737,61913..62149,62917..63013,
FT                   63676..63759,64185..64418,65170..65369,69376..70882,
FT                   71535..71681,72037..72267,73607..73800,74075..74202,
FT                   76229..76398,78578..78757,79499..79633,80010..80153,
FT                   80588..80826,81273..81432,83859..84026,86034..86406,
FT                   90999..91168,91275..91395,91684..91847,93479..93694,
FT                   94392..94616,95061..95210,95529..95729,95912..96043,
FT                   96741..96902,97636..98255)
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin,
FT                   transcript variant hCT2253460"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253460.0;
FT                   splice donor-acceptor pairs covered / total pairs = 31/33;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4184..4611,22298..22441,55447..55547,55626..55687,
FT                   55769..55934,56631..56737,61913..62149,62917..63013,
FT                   64185..64418,65170..65369,69376..69558,70738..70882,
FT                   71535..71681,72037..72267,73607..73800,74075..74202,
FT                   76229..76398,78578..78757,79499..79633,80010..80153,
FT                   80588..80826,81273..81432,83859..84026,86034..86406,
FT                   90999..91168,91275..91395,91684..91847,93479..93694,
FT                   94392..94616,95061..95210,95529..95729,95912..96043,
FT                   96741..96902,97636..98255)
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin,
FT                   transcript variant hCT2253457"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253457.0;
FT                   splice donor-acceptor pairs covered / total pairs = 31/33;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4184..4611,22298..22441,55447..55547,55626..55687,
FT                   55769..55934,56631..56737,61913..62149,62917..63013,
FT                   63676..63759,64185..64418,65170..65369,69376..69558,
FT                   70738..70882,71535..71681,72037..72267,78356..78757,
FT                   79499..79633)
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin,
FT                   transcript variant hCT2253459"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253459.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4184..4611,22298..22441,55447..55547,55626..55687,
FT                   55769..55934,56631..56737,61913..62149,62917..63013,
FT                   63676..63759,64185..64418,65170..65369,69376..70882,
FT                   71535..71681,72037..72267,73607..73800,74075..74202,
FT                   76229..76614)
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin,
FT                   transcript variant hCT2253458"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253458.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/16;
FT                   created on 26-AUG-2002"
FT   CDS             join(55797..55934,56631..56737,61913..62149,62917..63013,
FT                   64185..64418,65170..65369,69376..69558,70738..70882,
FT                   71535..71681,72037..72267,73607..73800,74075..74202,
FT                   76229..76398,78578..78757,79499..79633,80010..80153,
FT                   80588..80826,81273..81432,83859..84026,86034..86406,
FT                   90999..91168,91275..91395,91684..91847,93479..93694,
FT                   94392..94616,95061..95210,95529..95729,95912..96043,
FT                   96741..96902,97636..97722)
FT                   /codon_start=1
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253457.0
FT                   protein_id=hCP1854964.0 isoform=CRA_a"
FT                   /protein_id="EAW94814.1"
FT                   /translation="MLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREE
FT                   ESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLG
FT                   LSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVT
FT                   ELGLAVKRLEKQNLEKDQVNKDLTEKLEALAVLSDSESGVQLSGSERTADASNGSLRGL
FT                   SGQRTPSPPRRSSPGRGRSPRRGSSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQ
FT                   DLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREK
FT                   SNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERS
FT                   HRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELS
FT                   MTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATV
FT                   AREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLSR
FT                   QLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEAT
FT                   RLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQ
FT                   EKASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQS
FT                   QLQREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEK
FT                   LMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVR
FT                   RLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQR
FT                   QEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEAR
FT                   TAVGKEAGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALG
FT                   ERAEKESRRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEE
FT                   ARGTEKQQLDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEA
FT                   QLGGLRSALRRGLGLGRAPSPAPRPVPGSPARDAPAEGSGEGLNSPSTLECSPGSQPPS
FT                   PGPATSPASPDLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSA
FT                   TSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERS
FT                   LQATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQR
FT                   SRLGLSDREAQAQALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRD
FT                   KVRGLTEALAQSSASLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSS
FT                   SLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQ
FT                   ERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEK
FT                   GRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLR
FT                   SAQAQTERTLEARERAHRQRVSTLKGQLQQELRRSSAPFSPPSGPPEK"
FT   CDS             join(55797..55934,56631..56737,61913..62149,62917..63013,
FT                   63676..63759,64185..64418,65170..65369,69376..69558,
FT                   70738..70882,71535..71681,72037..72267,78356..78433)
FT                   /codon_start=1
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253459.0
FT                   protein_id=hCP1854962.0 isoform=CRA_d"
FT                   /protein_id="EAW94817.1"
FT                   /translation="MLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREE
FT                   ESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLG
FT                   LSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVT
FT                   ELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETEDGEGLQQTLRDLAQA
FT                   VLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGSSPACSDS
FT                   STLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKT
FT                   DGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEEL
FT                   RRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQ
FT                   RDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLD
FT                   LNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQ
FT                   AQEALEQQLPTLRHERSQLQEQLAQGTMFGPPGQPTAAPWHFHGPGVSPS"
FT   CDS             join(55797..55934,56631..56737,61913..62149,62917..63013,
FT                   63676..63759,64185..64418,65170..65369,69376..69562)
FT                   /codon_start=1
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253458.0
FT                   protein_id=hCP1854963.0 isoform=CRA_c"
FT                   /protein_id="EAW94816.1"
FT                   /translation="MLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREE
FT                   ESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLG
FT                   LSTGLRLAESRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVT
FT                   ELGLAVKRLEKQNLEKDQVNKDLTEKLEALESLRLQEQAALETEDGEGLQQTLRDLAQA
FT                   VLSDSESGVQLSGSERTADASNGSLRGLSGQRTPSPPRRSSPGRGRSPRRGSSPACSDS
FT                   STLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKT
FT                   DGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEEL
FT                   RRQRDRLEEEQEDAVQDGARVRRELERR"
FT   CDS             join(70838..70882,71535..71681,72037..72267,73607..73800,
FT                   74075..74202,76229..76398,78578..78757,79499..79633,
FT                   80010..80153,80588..80826,81273..81432,83859..84026,
FT                   86034..86406,90999..91168,91275..91395,91684..91847,
FT                   93479..93694,94392..94616,95061..95210,95529..95729,
FT                   95912..96043,96741..96902,97636..97722)
FT                   /codon_start=1
FT                   /gene="CROCC"
FT                   /locus_tag="hCG_1980890"
FT                   /product="ciliary rootlet coiled-coil, rootletin, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1980890.0 transcript_id=hCT2253460.0
FT                   protein_id=hCP1854961.0 isoform=CRA_b"
FT                   /protein_id="EAW94815.1"
FT                   /translation="MLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLS
FT                   ALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEATVAREEQERLEELRLEQEVAR
FT                   QGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLSRQLSGREQELEQARREAQRQ
FT                   VEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALEGSLFEVQRQ
FT                   LAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAER
FT                   EAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEE
FT                   LSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQK
FT                   RDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLRE
FT                   AEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGELRRSLGEGAKEREA
FT                   LRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKEAGELRTGLQEVER
FT                   SRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQRLL
FT                   KGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKL
FT                   EAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAP
FT                   SPAPRPVPGSPARDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASPDLDPEAVRG
FT                   ALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAVAESEEARR
FT                   SVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQEKISKMK
FT                   ANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQALQDRV
FT                   DSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNST
FT                   RDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQ
FT                   RVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKRE
FT                   VERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEAQR
FT                   QIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHRQ
FT                   RVSTLKGQLQQELRRSSAPFSPPSGPPEK"
FT   gene            complement(99778..106862)
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /note="gene_id=hCG25122.2"
FT   mRNA            complement(join(99778..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103590,
FT                   106790..106862))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT16246"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT16246.0; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(99778..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103590,
FT                   105863..106384))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT1777265"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1777265.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(99782..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..103590,
FT                   105863..105897))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT2357801"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT2357801.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(100196..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103549))
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1777265.1
FT                   protein_id=hCP1713442.1 isoform=CRA_d"
FT                   /db_xref="GOA:P55001"
FT                   /db_xref="HGNC:HGNC:7033"
FT                   /db_xref="InterPro:IPR003582"
FT                   /db_xref="InterPro:IPR008673"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55001"
FT                   /protein_id="EAW94821.1"
FT                   /translation="MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNP
FT                   DYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPC
FT                   TRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVM
FT                   ASSGLCQSVAASCARSCGSC"
FT   CDS             complement(join(100196..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103549))
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT16246.0
FT                   protein_id=hCP42055.1 isoform=CRA_d"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA94"
FT                   /protein_id="EAW94822.1"
FT                   /translation="MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNP
FT                   DYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPC
FT                   TRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVM
FT                   ASSGLCQSVAASCARSCGSC"
FT   mRNA            complement(join(<100238..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102471,103513..103590,
FT                   105863..105939))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT2357802"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT2357802.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(<100238..100299,100545..100618,
FT                   100919..101006,101777..101821,101984..102070,
FT                   102173..102199,102385..102471,103513..103549))
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT2357802.0
FT                   protein_id=hCP1923054.0 isoform=CRA_c"
FT                   /protein_id="EAW94820.1"
FT                   /translation="MRAAYLFLLFLPGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPD
FT                   YYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCT
FT                   RLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMA
FT                   SSGLCQ"
FT   mRNA            complement(join(101447..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103590,
FT                   105863..106384))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT1813958"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1813958.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(101733..101821,101984..102070,
FT                   102173..102199,102385..102474,103513..103549))
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1813958.1
FT                   protein_id=hCP1768966.0 isoform=CRA_a"
FT                   /protein_id="EAW94818.1"
FT                   /translation="MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNP
FT                   DYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLGKGFLDSWK
FT                   NGGTP"
FT   mRNA            complement(join(101913..102199,102385..102474,
FT                   103513..103590,105863..106384))
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant hCT1813959"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1813959.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(102150..102199,102385..102474,
FT                   103513..103549))
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT1813959.1
FT                   protein_id=hCP1768968.0 isoform=CRA_e"
FT                   /protein_id="EAW94823.1"
FT                   /translation="MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNP
FT                   DYYDYQGNGLGVG"
FT   CDS             complement(102879..103214)
FT                   /codon_start=1
FT                   /gene="MFAP2"
FT                   /locus_tag="hCG_25122"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG25122.2 transcript_id=hCT2357801.0
FT                   protein_id=hCP1923053.0 isoform=CRA_b"
FT                   /protein_id="EAW94819.1"
FT                   /translation="MCRCRGTQGRESGCLSSRSIQGPSALYSPDLVGVPTGQMKRINED
FT                   HKSPSRANIHSFSSDVLSPYHVPSAGLGPGDSAMNQADTSLLLIMLPVQGRETNRKQAD
FT                   MRNSSMC"
FT   gene            complement(111234..137222)
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /note="gene_id=hCG25128.3"
FT   mRNA            complement(join(111234..111634,111739..111908,
FT                   112081..112232,112322..112545,113414..113510,
FT                   113598..113750,114967..115046,115163..115279,
FT                   115403..115563,117010..117134,117285..117405,
FT                   117519..117678,117762..117857,118905..119111,
FT                   121252..121440,121530..121576,121662..121772,
FT                   122296..122451,125286..125417,125521..125587,
FT                   125675..125809,127309..127378,127571..127648,
FT                   129607..129686,129982..130096,130289..130347,
FT                   130649..130831,130959..131053,137004..137222))
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, transcript variant hCT1961480"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT1961480.1;
FT                   splice donor-acceptor pairs covered / total pairs = 28/28;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(111234..111634,111739..111908,
FT                   112081..112232,112322..112545,113414..113510,
FT                   113598..113750,114967..115046,115163..115279,
FT                   115403..115563,117010..117134,117285..117405,
FT                   117519..117678,117762..117857,118905..119111,
FT                   121252..121440,121530..121576,121662..121772,
FT                   122296..122451,125286..125417,125521..125587,
FT                   125675..125809,127309..127378,127571..127648,
FT                   129607..129686,129967..130096,130289..130347,
FT                   130649..130831,130959..131053,137004..137222))
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, transcript variant hCT16252"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT16252.3; splice
FT                   donor-acceptor pairs covered / total pairs = 28/28; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(111234..111634,112081..112232,
FT                   112322..112545,113414..113510,113598..113750,
FT                   114967..115046,115403..115563,117010..117134,
FT                   117285..117405,117519..117678,117762..117857,
FT                   118905..119111,121252..121440,121530..121576,
FT                   121662..121772,122296..122451,125286..125417,
FT                   125521..125587,125675..125809,127309..127378,
FT                   127571..127648,129607..129686,129982..130096,
FT                   130289..130347,130649..130831,130959..131053,
FT                   137004..137190))
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, transcript variant hCT2357813"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT2357813.0;
FT                   splice donor-acceptor pairs covered / total pairs = 26/26;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(111261..111634,112081..112232,
FT                   112322..112545,113414..113510,113598..113750,
FT                   114967..115046,115403..115563,117010..117134,
FT                   117285..117405,117519..117678,117762..117857,
FT                   118905..119111,121252..121440,121530..121576,
FT                   121662..121772,122296..122451,125286..125417,
FT                   125521..125587,125675..125809,127309..127378,
FT                   127571..127648,129607..129686,129982..130096,
FT                   130289..130347,130649..130831,130959..131053,
FT                   137004..137013))
FT                   /codon_start=1
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, isoform CRA_b"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT2357813.0
FT                   protein_id=hCP1923055.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="EAW94825.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKVLVQGTVFARMAP
FT                   EQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIEC
FT                   VPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTV
FT                   AVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLN
FT                   RTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNERARPVPPRLPAPP
FT                   PAQAGLQEALQAAGTRAGRAALAAAARRPPEVVQAHGHPRHWNSLPLSHQLDPSPATPP
FT                   PPPPTSLRLATVYTPPPRPPPPWGSVDYCPLPWTIPRRGGSPQLPSVLLSV"
FT   mRNA            complement(join(<111278..111634,112081..112232,
FT                   112322..112545,113414..113510,113598..113750,
FT                   114967..115046,115163..115279,115403..115563,
FT                   117010..117134,117285..117405,117519..117678,
FT                   117762..117857,118905..119111,121252..121440,
FT                   121530..121576,121662..121772,122296..122451,
FT                   125286..125417,125521..125587,125675..125809,
FT                   127309..127378,127571..127648,129607..129686,
FT                   129982..130096,130289..130347,130649..130831,
FT                   130959..131053,137004..137222))
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, transcript variant hCT2255238"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT2255238.0;
FT                   splice donor-acceptor pairs covered / total pairs = 27/27;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<111278..111634,112081..112232,
FT                   112322..112545,113414..113510,113598..113750,
FT                   114967..115046,115163..115279,115403..115563,
FT                   117010..117134,117285..117405,117519..117678,
FT                   117762..117857,118905..119111,121252..121440,
FT                   121530..121576,121662..121772,122296..122451,
FT                   125286..125417,125521..125587,125675..125809,
FT                   127309..127378,127571..127648,129607..129686,
FT                   129982..130096,130289..130347,130649..130831,
FT                   130959..131053,137004..137013))
FT                   /codon_start=1
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, isoform CRA_a"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT2255238.0
FT                   protein_id=hCP1854946.0 isoform=CRA_a"
FT                   /protein_id="EAW94824.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPD
FT                   PRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMC
FT                   GDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFK
FT                   YMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPG
FT                   ALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSL
FT                   SSFQYLILAAAVSKGAPFRRPLYTNERARPVPPRLPAPPPAQAGLQEALQAAGTRAGRA
FT                   ALAAAARRPPEVVQAHGHPRHWNSLPLSHQLDPSPATPPPPPPTSLRLATVYTPPPRPP
FT                   PPWGSVDYCPLPWTIPRRGGSPQLPS"
FT   CDS             complement(join(111497..111634,111739..111908,
FT                   112081..112232,112322..112545,113414..113510,
FT                   113598..113750,114967..115046,115163..115279,
FT                   115403..115563,117010..117134,117285..117405,
FT                   117519..117678,117762..117857,118905..119111,
FT                   121252..121440,121530..121576,121662..121772,
FT                   122296..122451,125286..125417,125521..125587,
FT                   125675..125809,127309..127378,127571..127648,
FT                   129607..129686,129982..130096,130289..130347,
FT                   130649..130831,130959..131053,137004..137013))
FT                   /codon_start=1
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, isoform CRA_d"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT1961480.1
FT                   protein_id=hCP1774601.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="EAW94827.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPD
FT                   PRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMC
FT                   GDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFK
FT                   YMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPG
FT                   ALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSL
FT                   SSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQGPLALRNIT
FT                   DTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLERELAEQPW
FT                   PPLPAGPLR"
FT   CDS             complement(join(111497..111634,111739..111908,
FT                   112081..112232,112322..112545,113414..113510,
FT                   113598..113750,114967..115046,115163..115279,
FT                   115403..115563,117010..117134,117285..117405,
FT                   117519..117678,117762..117857,118905..119111,
FT                   121252..121440,121530..121576,121662..121772,
FT                   122296..122451,125286..125417,125521..125587,
FT                   125675..125809,127309..127378,127571..127648,
FT                   129607..129686,129967..130096,130289..130347,
FT                   130649..130831,130959..131053,137004..137013))
FT                   /codon_start=1
FT                   /gene="ATP13A2"
FT                   /locus_tag="hCG_25128"
FT                   /product="ATPase type 13A2, isoform CRA_c"
FT                   /note="gene_id=hCG25128.3 transcript_id=hCT16252.3
FT                   protein_id=hCP42051.2 isoform=CRA_c"
FT                   /protein_id="EAW94826.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVL
FT                   RYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVIS
FT                   IPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQ
FT                   SQTLRDMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMV
FT                   NESSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTG
FT                   FCTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIV
FT                   IRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGT
FT                   LTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLK
FT                   MVESTGWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQ
FT                   RMSVVVAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKP
FT                   LPTVPSLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDN
FT                   LQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASY
FT                   TVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQY
FT                   CVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTS
FT                   FSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGR
FT                   VRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENT
FT                   VVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQGPLA
FT                   LRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLEREL
FT                   AEQPWPPLPAGPLR"
FT   gene            complement(143999..179457)
FT                   /gene="SDHB"
FT                   /locus_tag="hCG_25123"
FT                   /note="gene_id=hCG25123.2"
FT   mRNA            complement(join(143999..144238,147888..148010,
FT                   149253..149354,153029..153145,153880..154016,
FT                   158338..158423,170045..170172,179234..179457))
FT                   /gene="SDHB"
FT                   /locus_tag="hCG_25123"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant hCT16247"
FT                   /note="gene_id=hCG25123.2 transcript_id=hCT16247.2; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(143999..144238,147888..148010,
FT                   149253..149354,153029..153145,153880..154016,
FT                   158338..158423,170045..170172,179238..179310))
FT                   /gene="SDHB"
FT                   /locus_tag="hCG_25123"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant hCT1955045"
FT                   /note="gene_id=hCG25123.2 transcript_id=hCT1955045.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(144161..144238,147888..148010,
FT                   149253..149354,153029..153145,153880..154016,
FT                   158338..158423,170045..170172,179234..179305))
FT                   /codon_start=1
FT                   /gene="SDHB"
FT                   /locus_tag="hCG_25123"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_a"
FT                   /note="gene_id=hCG25123.2 transcript_id=hCT16247.2
FT                   protein_id=hCP42056.2 isoform=CRA_a"
FT                   /db_xref="GOA:P21912"
FT                   /db_xref="HGNC:HGNC:10681"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21912"
FT                   /protein_id="EAW94828.1"
FT                   /translation="MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIY
FT                   RWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMN
FT                   INGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDES
FT                   QEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDS
FT                   RDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV"
FT   CDS             complement(join(144161..144238,147888..148010,
FT                   149253..149354,153029..153145,153880..154016,
FT                   158338..158423,170045..170073))
FT                   /codon_start=1
FT                   /gene="SDHB"
FT                   /locus_tag="hCG_25123"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_b"
FT                   /note="gene_id=hCG25123.2 transcript_id=hCT1955045.1
FT                   protein_id=hCP1765659.1 isoform=CRA_b"
FT                   /protein_id="EAW94829.1"
FT                   /translation="MQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
FT                   MNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKD
FT                   ESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI
FT                   DSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKAS
FT                   V"
FT   gene            complement(192045..244737)
FT                   /gene="PADI2"
FT                   /locus_tag="hCG_25130"
FT                   /note="gene_id=hCG25130.2"
FT   mRNA            complement(join(192045..194560,195371..195499,
FT                   196689..196774,200138..200231,200961..201105,
FT                   204546..204697,207828..207935,209008..209119,
FT                   209881..209984,211803..211981,217699..217824,
FT                   218858..218975,221200..221261,228284..228356,
FT                   230179..230362,244573..244737))
FT                   /gene="PADI2"
FT                   /locus_tag="hCG_25130"
FT                   /product="peptidyl arginine deiminase, type II, transcript
FT                   variant hCT16254"
FT                   /note="gene_id=hCG25130.2 transcript_id=hCT16254.3; splice
FT                   donor-acceptor pairs covered / total pairs = 15/15; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(192222..192292,192485..194560,
FT                   195371..195499,196689..196774,200138..200231,
FT                   200961..201105,204546..204697,207828..207935,
FT                   209008..209119,209881..209984,211803..211981,
FT                   217699..217824,218858..218975,221200..221261,
FT                   228284..228356,230179..230362,244573..244737))
FT                   /gene="PADI2"
FT                   /locus_tag="hCG_25130"
FT                   /product="peptidyl arginine deiminase, type II, transcript
FT                   variant hCT2255233"
FT                   /note="gene_id=hCG25130.2 transcript_id=hCT2255233.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/16;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(194327..194560,195371..195499,
FT                   196689..196774,200138..200231,200961..201105,
FT                   204546..204697,207828..207935,209008..209119,
FT                   209881..209984,211803..211981,217699..217824,
FT                   218858..218975,221200..221261,228284..228356,
FT                   230179..230362,244573..244664))
FT                   /codon_start=1
FT                   /gene="PADI2"
FT                   /locus_tag="hCG_25130"
FT                   /product="peptidyl arginine deiminase, type II, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25130.2 transcript_id=hCT2255233.0
FT                   protein_id=hCP1854937.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA98"
FT                   /protein_id="EAW94830.1"
FT                   /translation="MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHS
FT                   EHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSI
FT                   PIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLP
FT                   KEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFF
FT                   GQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIP
FT                   LTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQ
FT                   YLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLF
FT                   ESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQA
FT                   PVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKG
FT                   LGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMD
FT                   EDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDI
FT                   SAYHKFLGEVHCGTNVRRKPFTFKWWHMVP"
FT   CDS             complement(join(194327..194560,195371..195499,
FT                   196689..196774,200138..200231,200961..201105,
FT                   204546..204697,207828..207935,209008..209119,
FT                   209881..209984,211803..211981,217699..217824,
FT                   218858..218975,221200..221261,228284..228356,
FT                   230179..230362,244573..244664))
FT                   /codon_start=1
FT                   /gene="PADI2"
FT                   /locus_tag="hCG_25130"
FT                   /product="peptidyl arginine deiminase, type II, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25130.2 transcript_id=hCT16254.3
FT                   protein_id=hCP42053.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA98"
FT                   /protein_id="EAW94831.1"
FT                   /translation="MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHS
FT                   EHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSI
FT                   PIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLP
FT                   KEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFF
FT                   GQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIP
FT                   LTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQ
FT                   YLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLF
FT                   ESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQA
FT                   PVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKG
FT                   LGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMD
FT                   EDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDI
FT                   SAYHKFLGEVHCGTNVRRKPFTFKWWHMVP"
FT   gene            315706..323540
FT                   /locus_tag="hCG_2045606"
FT                   /note="gene_id=hCG2045606.0"
FT   mRNA            join(315706..315853,318888..319088,319214..319902,
FT                   319977..323540)
FT                   /locus_tag="hCG_2045606"
FT                   /product="hCG2045606"
FT                   /note="gene_id=hCG2045606.0 transcript_id=hCT2360441.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             320249..320821
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045606"
FT                   /product="hCG2045606"
FT                   /note="gene_id=hCG2045606.0 transcript_id=hCT2360441.0
FT                   protein_id=hCP1925671.0"
FT                   /protein_id="EAW94832.1"
FT                   /translation="MWKVEREHMGSGASGLLGSVLPVWELSPALPCSVSVSLRSVPPSV
FT                   LQFFPLHLSLWLSQSLFAPHCLCLSLHLSSFPGLSLSLSSLFWAFSVSVSLFFSLLLSV
FT                   SVHFSVCLCPLHSHSPPMLSSLGAPLASLGHRPRLGCEEAGAPPSDDARCPSQGSGGQT
FT                   KSSARGGKILFPGKGMWGLLASCGMGG"
FT   gene            331060..370900
FT                   /gene="PADI1"
FT                   /locus_tag="hCG_1641304"
FT                   /note="gene_id=hCG1641304.2"
FT   mRNA            join(331060..331234,348287..348467,349618..349690,
FT                   350364..350425,351808..351925,352030..352155,
FT                   354618..354790,354941..355044,356078..356201,
FT                   356565..356672,358812..358963,363307..363451,
FT                   364609..364702,365697..365776,366628..366753,
FT                   369641..370900)
FT                   /gene="PADI1"
FT                   /locus_tag="hCG_1641304"
FT                   /product="peptidyl arginine deiminase, type I"
FT                   /note="gene_id=hCG1641304.2 transcript_id=hCT1641431.2;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   CDS             join(331143..331234,348287..348467,349618..349690,
FT                   350364..350425,351808..351925,352030..352155,
FT                   354618..354790,354941..355044,356078..356201,
FT                   356565..356672,358812..358963,363307..363451,
FT                   364609..364702,365697..365776,366628..366753,
FT                   369641..369874)
FT                   /codon_start=1
FT                   /gene="PADI1"
FT                   /locus_tag="hCG_1641304"
FT                   /product="peptidyl arginine deiminase, type I"
FT                   /note="gene_id=hCG1641304.2 transcript_id=hCT1641431.2
FT                   protein_id=hCP1613321.2"
FT                   /db_xref="GOA:Q9ULC6"
FT                   /db_xref="HGNC:HGNC:18367"
FT                   /db_xref="InterPro:IPR004303"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR013530"
FT                   /db_xref="InterPro:IPR013732"
FT                   /db_xref="InterPro:IPR013733"
FT                   /db_xref="InterPro:IPR016296"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ULC6"
FT                   /protein_id="EAW94833.1"
FT                   /translation="MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGS
FT                   SGVEVFMVYNRTRVKEPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQA
FT                   LGRSVLYLTGVDISLEVDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSAE
FT                   PDLTHSWLMSLADLQDMSPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSL
FT                   SDYKQVLGPQCLSYEVERQPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVT
FT                   LFTDTVGFRMAPWIMTPNTQPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICP
FT                   QVENRNDRWIQDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIP
FT                   LPGPSSLDSFGNLDVSPPVTVGGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQ
FT                   APVELYSDWLSVGHVDEFLTFVPTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFD
FT                   GLKHQAKRSINEMLADRHLQRDNLHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKN
FT                   FYAEAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLS
FT                   YHELQGEIHCGTNVRRKPFPFKWWNMVP"
FT   gene            374728..409857
FT                   /gene="PADI3"
FT                   /locus_tag="hCG_25124"
FT                   /note="gene_id=hCG25124.2"
FT   mRNA            join(374728..374861,385210..385390,387765..387837,
FT                   391293..391354,392353..392470,393471..393596,
FT                   395864..396042,396511..396614,396699..396810,
FT                   398972..399079,400261..400412,402145..402289,
FT                   402400..402502,405976..406055,406297..406422,
FT                   408473..409857)
FT                   /gene="PADI3"
FT                   /locus_tag="hCG_25124"
FT                   /product="peptidyl arginine deiminase, type III"
FT                   /note="gene_id=hCG25124.2 transcript_id=hCT16248.2; splice
FT                   donor-acceptor pairs covered / total pairs = 15/15; created
FT                   on 26-AUG-2002"
FT   CDS             join(374770..374861,385210..385390,387765..387837,
FT                   391293..391354,392353..392470,393471..393596,
FT                   395864..396042,396511..396614,396699..396810,
FT                   398972..399079,400261..400412,402145..402289,
FT                   402400..402502,405976..406055,406297..406422,
FT                   408473..408706)
FT                   /codon_start=1
FT                   /gene="PADI3"
FT                   /locus_tag="hCG_25124"
FT                   /product="peptidyl arginine deiminase, type III"
FT                   /note="gene_id=hCG25124.2 transcript_id=hCT16248.2
FT                   protein_id=hCP42047.2"
FT                   /protein_id="EAW94834.1"
FT                   /translation="MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGT
FT                   PGVDIYISPNMERGRERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLP
FT                   LAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDV
FT                   QDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDV
FT                   CEAYRHVLGQDKVSYEVPRLHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSA
FT                   SPIFTDTVVFRVAPWIMTPSTLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQA
FT                   ENRNDRWIQDEMELGYVQAPHKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDR
FT                   SVSGLDSFGNLEVSPPVVANGKEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPP
FT                   VELFVDWLAVGHVDEFLSFVPAPDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGV
FT                   VDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTE
FT                   RKKATAFFPDLVNMLVLGKHLGIPKPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFT
FT                   PYHMLHGEVHCGTNVCRKPFSFKWWNMVP"
FT   gene            436507..491993
FT                   /gene="PADI4"
FT                   /locus_tag="hCG_25125"
FT                   /note="gene_id=hCG25125.2"
FT   mRNA            join(436507..436626,459283..459463,462257..462323,
FT                   464474..464541,466357..466474,468007..468132,
FT                   470260..470438,470616..470719,474345..474456,
FT                   476258..476365,482846..483000,484295..484439,
FT                   484669..484771,486831..486901,487273..487401,
FT                   491515..491993)
FT                   /gene="PADI4"
FT                   /locus_tag="hCG_25125"
FT                   /product="peptidyl arginine deiminase, type IV, transcript
FT                   variant hCT16249"
FT                   /note="gene_id=hCG25125.2 transcript_id=hCT16249.2; splice
FT                   donor-acceptor pairs covered / total pairs = 15/15; created
FT                   on 26-AUG-2002"
FT   mRNA            join(436507..436626,459283..459463,462257..462323,
FT                   464474..464541,466357..466474,468007..468132,
FT                   470260..470438,470616..470719,474345..474456,
FT                   476258..476946)
FT                   /gene="PADI4"
FT                   /locus_tag="hCG_25125"
FT                   /product="peptidyl arginine deiminase, type IV, transcript
FT                   variant hCT2253466"
FT                   /note="gene_id=hCG25125.2 transcript_id=hCT2253466.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             join(436535..436626,459283..459463,462257..462323,
FT                   464474..464541,466357..466474,468007..468132,
FT                   470260..470438,470616..470719,474345..474456,
FT                   476258..476365,482846..483000,484295..484439,
FT                   484669..484771,486831..486901,487273..487401,
FT                   491515..491748)
FT                   /codon_start=1
FT                   /gene="PADI4"
FT                   /locus_tag="hCG_25125"
FT                   /product="peptidyl arginine deiminase, type IV, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25125.2 transcript_id=hCT16249.2
FT                   protein_id=hCP42048.2 isoform=CRA_a"
FT                   /protein_id="EAW94835.1"
FT                   /translation="MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINAS
FT                   PGVVVDIAHGPPAKKKSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPV
FT                   KALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSA
FT                   MDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLS
FT                   SKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPE
FT                   AVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEE
FT                   ENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTG
FT                   GISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQA
FT                   PVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEG
FT                   IKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEF
FT                   SKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFT
FT                   YHIRHGEVHCGTNVRRKPFSFKWWNMVP"
FT   CDS             join(436535..436626,459283..459463,462257..462323,
FT                   464474..464541,466357..466474,468007..468132,
FT                   470260..470438,470616..470719,474345..474456,
FT                   476258..476434)
FT                   /codon_start=1
FT                   /gene="PADI4"
FT                   /locus_tag="hCG_25125"
FT                   /product="peptidyl arginine deiminase, type IV, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG25125.2 transcript_id=hCT2253466.0
FT                   protein_id=hCP1854958.0 isoform=CRA_b"
FT                   /protein_id="EAW94836.1"
FT                   /translation="MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINAS
FT                   PGVVVDIAHGPPAKKKSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPV
FT                   KALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSA
FT                   MDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLS
FT                   SKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPE
FT                   AVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEE
FT                   ENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMVPAWGGEGAQLPKP
FT                   SCLETPSF"
FT   gene            521525..534249
FT                   /gene="PADI6"
FT                   /locus_tag="hCG_1811857"
FT                   /note="gene_id=hCG1811857.1"
FT   mRNA            join(521525..522146,522364..522516,523013..523169,
FT                   523603..523726,525134..525204,526784..526912,
FT                   529270..529494,533690..534249)
FT                   /gene="PADI6"
FT                   /locus_tag="hCG_1811857"
FT                   /product="peptidyl arginine deiminase, type VI"
FT                   /note="gene_id=hCG1811857.1 transcript_id=hCT1955030.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(522043..522146,522364..522516,523013..523169,
FT                   523603..523726,525134..525204,526784..526912,
FT                   529270..529494,533690..533737)
FT                   /codon_start=1
FT                   /gene="PADI6"
FT                   /locus_tag="hCG_1811857"
FT                   /product="peptidyl arginine deiminase, type VI"
FT                   /note="gene_id=hCG1811857.1 transcript_id=hCT1955030.1
FT                   protein_id=hCP1765700.0"
FT                   /protein_id="EAW94837.1"
FT                   /translation="MAFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLVPGIGYMIQDT
FT                   EDHKVASMDSIGNLMVSPPVKVQGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQ
FT                   VQAPVELYSDWLMTGHVDEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYG
FT                   DALLFDELRADQLLSNGREAKTIDQLLADESLKKQNEYVETELGLVEQDIIEIPQLFCL
FT                   EKLTNIPSDQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLE
FT                   PLGFKCTFINDFDCYLTEVGDICACANIRRVPFAFKWWKMEFGTSLDNMVKPHLY"
FT   gene            complement(534843..567789)
FT                   /gene="RCC2"
FT                   /locus_tag="hCG_25129"
FT                   /note="gene_id=hCG25129.3"
FT   mRNA            complement(join(534843..537254,538034..538111,
FT                   540182..540254,541133..541238,541597..541777,
FT                   544540..544706,548774..548888,550263..550351,
FT                   550765..550896,553604..553747,557169..557262,
FT                   566295..566587,567610..567789))
FT                   /gene="RCC2"
FT                   /locus_tag="hCG_25129"
FT                   /product="regulator of chromosome condensation 2,
FT                   transcript variant hCT16253"
FT                   /note="gene_id=hCG25129.3 transcript_id=hCT16253.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 16-OCT-2003"
FT   mRNA            complement(join(534843..537254,538034..538111,
FT                   540182..540254,541133..541238,541597..541777,
FT                   544540..544706,548774..548888,550263..550351,
FT                   550765..550896,553604..553747,557169..557262,
FT                   566295..566685))
FT                   /gene="RCC2"
FT                   /locus_tag="hCG_25129"
FT                   /product="regulator of chromosome condensation 2,
FT                   transcript variant hCT2255232"
FT                   /note="gene_id=hCG25129.3 transcript_id=hCT2255232.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 16-OCT-2003"
FT   CDS             complement(join(537150..537254,538034..538111,
FT                   540182..540254,541133..541238,541597..541777,
FT                   544540..544706,548774..548888,550263..550351,
FT                   550765..550896,553604..553747,557169..557262,
FT                   566295..566579))
FT                   /codon_start=1
FT                   /gene="RCC2"
FT                   /locus_tag="hCG_25129"
FT                   /product="regulator of chromosome condensation 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25129.3 transcript_id=hCT2255232.1
FT                   protein_id=hCP1854944.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC5"
FT                   /protein_id="EAW94838.1"
FT                   /translation="MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSS
FT                   SGGGSSGDEDGLELDGAPGGGKRAARPATAGKAGGAAVVITEPEHTKERVKLEGSKCKG
FT                   QLLIFGATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLAGVRVRTVVSGSCAAHSL
FT                   LITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEGLSHEVIVSAACGRNHTLALTETGS
FT                   VFAFGENKMGQLGLGNQTDAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGCP
FT                   EYGQLGHNSDGKFIARAQRIEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGAN
FT                   HTLVLDSQKRVFSWGFGGYGRLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAV
FT                   SEVGGLFFWGATNTSRESTMYPKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPT
FT                   FGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEY
FT                   NPRTL"
FT   CDS             complement(join(537150..537254,538034..538111,
FT                   540182..540254,541133..541238,541597..541777,
FT                   544540..544706,548774..548888,550263..550351,
FT                   550765..550896,553604..553747,557169..557262,
FT                   566295..566579))
FT                   /codon_start=1
FT                   /gene="RCC2"
FT                   /locus_tag="hCG_25129"
FT                   /product="regulator of chromosome condensation 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25129.3 transcript_id=hCT16253.3
FT                   protein_id=hCP42052.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC5"
FT                   /protein_id="EAW94839.1"
FT                   /translation="MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSS
FT                   SGGGSSGDEDGLELDGAPGGGKRAARPATAGKAGGAAVVITEPEHTKERVKLEGSKCKG
FT                   QLLIFGATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLAGVRVRTVVSGSCAAHSL
FT                   LITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEGLSHEVIVSAACGRNHTLALTETGS
FT                   VFAFGENKMGQLGLGNQTDAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGCP
FT                   EYGQLGHNSDGKFIARAQRIEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGAN
FT                   HTLVLDSQKRVFSWGFGGYGRLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAV
FT                   SEVGGLFFWGATNTSRESTMYPKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPT
FT                   FGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEY
FT                   NPRTL"
FT   gene            667960..826855
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /note="gene_id=hCG1811869.1"
FT   mRNA            join(667960..667990,708553..708632,715463..715648,
FT                   716449..716482,730128..730219,731509..731592,
FT                   735803..735978,741059..741175,744095..744203,
FT                   747340..747446,749865..749942,750997..751176,
FT                   752388..752520,753979..754049,755331..755504,
FT                   760322..760467,762836..763017,765889..766004,
FT                   766563..766690,768203..768303,776556..776677,
FT                   782638..782724,783881..784104,784556..784710,
FT                   792449..792597,815575..815749,820104..820176,
FT                   824142..824264,825833..826855)
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, transcript variant hCT2253475"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253475.0;
FT                   splice donor-acceptor pairs covered / total pairs = 27/28;
FT                   created on 26-AUG-2002"
FT   mRNA            join(667960..667990,708553..708632,715463..715648,
FT                   716449..716482,730128..730219,731509..731592,
FT                   735803..735978,741059..741175,744095..744203,
FT                   747340..747446,749865..749942,750997..751176,
FT                   752388..752504,753957..754049,755331..755504,
FT                   760322..760467,762549..762563,762836..763017,
FT                   765889..766004,766563..766690,768203..768303,
FT                   776556..776677,782638..782724,783881..784104,
FT                   784556..784710,792449..792597,815575..815749,
FT                   820104..820176,824142..824264,825833..826855)
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, transcript variant hCT2253470"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253470.0;
FT                   splice donor-acceptor pairs covered / total pairs = 28/29;
FT                   created on 26-AUG-2002"
FT   mRNA            join(667960..667990,708553..708632,715463..715648,
FT                   716449..716482,730128..730219,731509..731592,
FT                   735803..735978,741059..741175,744095..744203,
FT                   747340..747446,749865..749942,750997..751176,
FT                   752388..752504,753957..754049,755331..755504,
FT                   760322..760467,762549..762563,762836..763017,
FT                   765889..766004,766563..766690,768203..768303,
FT                   776556..776677,782638..782724,783881..784104,
FT                   784556..784710,792449..792597,815575..815749,
FT                   824142..824264,825833..826855)
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, transcript variant hCT2253471"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253471.0;
FT                   splice donor-acceptor pairs covered / total pairs = 27/28;
FT                   created on 26-AUG-2002"
FT   mRNA            join(667960..667990,708553..708632,715463..715648,
FT                   716449..716482,730128..730219,731509..731592,
FT                   735803..735978,741059..741175,744095..744203,
FT                   747340..747446,749865..749942,750997..751176,
FT                   752388..752504,753957..754049,755331..755504,
FT                   760322..760467,762827..763017,765889..766004,
FT                   766563..766690,768203..768303,776556..776677,
FT                   782638..782724,783881..784104,784556..784710,
FT                   792449..792597,815575..815749,824142..824264,
FT                   825833..826855)
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, transcript variant hCT1955046"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT1955046.1;
FT                   splice donor-acceptor pairs covered / total pairs = 27/27;
FT                   created on 26-AUG-2002"
FT   mRNA            join(667960..667990,708553..708632,715463..715648,
FT                   716449..716482,730128..730219,731509..731592,
FT                   735803..735978,741059..741175,744095..744203,
FT                   747340..747446,749865..749942,750997..751176,
FT                   752388..752504,753957..754049,755331..755504,
FT                   760322..760467,762836..763017,765889..766004,
FT                   766563..766690,768203..768303,776556..776677,
FT                   782638..782724,783881..784104,784556..784710,
FT                   792449..792597,815575..815749,820104..820176,
FT                   824142..824264,825833..826855)
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, transcript variant hCT2253474"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253474.0;
FT                   splice donor-acceptor pairs covered / total pairs = 28/28;
FT                   created on 26-AUG-2002"
FT   CDS             join(708596..708632,715463..715648,716449..716482,
FT                   730128..730219,731509..731592,735803..735978,
FT                   741059..741175,744095..744203,747340..747446,
FT                   749865..749942,750997..751176,752388..752504,
FT                   753957..754049,755331..755504,760322..760467,
FT                   762549..762563,762836..763017,765889..766004,
FT                   766563..766690,768203..768303,776556..776677,
FT                   782638..782724,783881..784104,784556..784710,
FT                   792449..792597,815575..815749,824142..824264,
FT                   825833..826365)
FT                   /codon_start=1
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, isoform CRA_c"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253471.0
FT                   protein_id=hCP1854974.0 isoform=CRA_c"
FT                   /protein_id="EAW94842.1"
FT                   /translation="MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEED
FT                   TSAALGVPSLAPERDTDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGA
FT                   RHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQ
FT                   AEDLGWSSSEFESYSEDSGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDI
FT                   LALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDS
FT                   EEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQ
FT                   DYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVA
FT                   SFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKP
FT                   IQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLT
FT                   KSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINF
FT                   KPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKA
FT                   SASGQAQNKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLA
FT                   LQRLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLA
FT                   KIGLREENQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLL
FT                   GFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELE
FT                   EEAESRDESPTVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCL
FT                   RHSPFHLLAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCG
FT                   PRVTVLEATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQ
FT                   EINIATRTTFLLPGQKHLCVTSLLICQGLLWVGTDQGVIVLLPVPRLEGIPKITGKGMV
FT                   SLNGHCGPVAFLAVATSILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELT
FT                   RKKGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRP
FT                   CARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDSTLLIWQVPLML"
FT   CDS             join(708596..708632,715463..715648,716449..716482,
FT                   730128..730219,731509..731592,735803..735978,
FT                   741059..741175,744095..744203,747340..747446,
FT                   749865..749942,750997..751176,752388..752504,
FT                   753957..754049,755331..755504,760322..760467,
FT                   762827..763017,765889..766004,766563..766690,
FT                   768203..768303,776556..776677,782638..782724,
FT                   783881..784104,784556..784710,792449..792597,
FT                   815575..815749,824142..824264,825833..826365)
FT                   /codon_start=1
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, isoform CRA_d"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT1955046.1
FT                   protein_id=hCP1765660.1 isoform=CRA_d"
FT                   /protein_id="EAW94843.1"
FT                   /translation="MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEED
FT                   TSAALGVPSLAPERDTDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGA
FT                   RHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQ
FT                   AEDLGWSSSEFESYSEDSGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDI
FT                   LALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDS
FT                   EEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQ
FT                   DYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVA
FT                   SFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKP
FT                   IQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLT
FT                   KSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINF
FT                   NSNRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASA
FT                   SGQAQNKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQ
FT                   RLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKI
FT                   GLREENQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLLGF
FT                   SAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEE
FT                   AESRDESPTVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCLRH
FT                   SPFHLLAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCGPR
FT                   VTVLEATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQEI
FT                   NIATRTTFLLPGQKHLCVTSLLICQGLLWVGTDQGVIVLLPVPRLEGIPKITGKGMVSL
FT                   NGHCGPVAFLAVATSILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRK
FT                   KGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRPCA
FT                   RDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDSTLLIWQVPLML"
FT   CDS             join(708596..708632,715463..715648,716449..716482,
FT                   730128..730219,731509..731592,735803..735978,
FT                   741059..741175,744095..744203,747340..747446,
FT                   749865..749942,750997..751176,752388..752520,
FT                   753979..754049,755331..755504,760322..760467,
FT                   762836..763017,765889..766004,766563..766690,
FT                   768203..768303,776556..776677,782638..782724,
FT                   783881..784104,784556..784710,792449..792597,
FT                   815575..815749,820104..820138)
FT                   /codon_start=1
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, isoform CRA_e"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253475.0
FT                   protein_id=hCP1854972.0 isoform=CRA_e"
FT                   /protein_id="EAW94844.1"
FT                   /translation="MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEED
FT                   TSAALGVPSLAPERDTDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGA
FT                   RHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQ
FT                   AEDLGWSSSEFESYSEDSGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDI
FT                   LALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDS
FT                   EEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQ
FT                   DYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVA
FT                   SFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKVGLHGDRVTLYGLMVKPIQ
FT                   RFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKS
FT                   VSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKG
FT                   QLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQ
FT                   NKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRV
FT                   KEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREE
FT                   NQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLLGFSAVST
FT                   SLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEEAESRD
FT                   ESPTVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCLRHSPFHL
FT                   LAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLE
FT                   ATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQEINIATR
FT                   TTFLLPDRSLIKCSPRA"
FT   CDS             join(708596..708632,715463..715648,716449..716482,
FT                   730128..730219,731509..731592,735803..735978,
FT                   741059..741175,744095..744203,747340..747446,
FT                   749865..749942,750997..751176,752388..752504,
FT                   753957..754049,755331..755504,760322..760467,
FT                   762549..762563,762836..763017,765889..766004,
FT                   766563..766690,768203..768303,776556..776677,
FT                   782638..782724,783881..784104,784556..784710,
FT                   792449..792597,815575..815749,820104..820138)
FT                   /codon_start=1
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, isoform CRA_a"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253470.0
FT                   protein_id=hCP1854976.0 isoform=CRA_a"
FT                   /protein_id="EAW94840.1"
FT                   /translation="MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEED
FT                   TSAALGVPSLAPERDTDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGA
FT                   RHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQ
FT                   AEDLGWSSSEFESYSEDSGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDI
FT                   LALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDS
FT                   EEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQ
FT                   DYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVA
FT                   SFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKP
FT                   IQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLT
FT                   KSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINF
FT                   KPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKA
FT                   SASGQAQNKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLA
FT                   LQRLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLA
FT                   KIGLREENQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLL
FT                   GFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELE
FT                   EEAESRDESPTVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCL
FT                   RHSPFHLLAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCG
FT                   PRVTVLEATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQ
FT                   EINIATRTTFLLPDRSLIKCSPRA"
FT   CDS             join(708596..708632,715463..715648,716449..716482,
FT                   730128..730219,731509..731592,735803..735978,
FT                   741059..741175,744095..744203,747340..747446,
FT                   749865..749942,750997..751176,752388..752504,
FT                   753957..754049,755331..755504,760322..760467,
FT                   762836..763017,765889..766004,766563..766690,
FT                   768203..768303,776556..776677,782638..782724,
FT                   783881..784104,784556..784710,792449..792597,
FT                   815575..815749,820104..820138)
FT                   /codon_start=1
FT                   /gene="ARHGEF10L"
FT                   /locus_tag="hCG_1811869"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like, isoform CRA_b"
FT                   /note="gene_id=hCG1811869.1 transcript_id=hCT2253474.0
FT                   protein_id=hCP1854975.0 isoform=CRA_b"
FT                   /protein_id="EAW94841.1"
FT                   /translation="MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEED
FT                   TSAALGVPSLAPERDTDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGA
FT                   RHSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQ
FT                   AEDLGWSSSEFESYSEDSGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDI
FT                   LALRVGGRDMQELKHKYDCKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDS
FT                   EEEDMGLLEVSVSDIKPPAPELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQ
FT                   DYRNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVA
FT                   SFSKSMVLDVYSDYVNNFTSAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKP
FT                   IQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLT
FT                   KSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINF
FT                   KGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQ
FT                   AQNKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLM
FT                   RVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLR
FT                   EENQPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLLGFSAV
FT                   STSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEEAES
FT                   RDESPTVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCLRHSPF
FT                   HLLAGLQDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTV
FT                   LEATTLQPQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQEINIA
FT                   TRTTFLLPDRSLIKCSPRA"
FT   gene            <847641..878968
FT                   /locus_tag="hCG_2041906"
FT                   /note="gene_id=hCG2041906.0"
FT   mRNA            join(<847641..847706,850658..850746,878666..878968)
FT                   /locus_tag="hCG_2041906"
FT                   /product="hCG2041906"
FT                   /note="gene_id=hCG2041906.0 transcript_id=hCT2347137.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-JUN-2003"
FT   CDS             join(<847691..847706,850658..850746,878666..878839)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041906"
FT                   /product="hCG2041906"
FT                   /note="gene_id=hCG2041906.0 transcript_id=hCT2347137.0
FT                   protein_id=hCP1912688.0"
FT                   /protein_id="EAW94845.1"
FT                   /translation="PGPGGGSASSVSASFTAGMSLLPPRESPAASSSTSVLSLSLAIHC
FT                   GGSQFHALSPFRQLVKRPTWPIASEELRPAVTTWMSLEARPPAPVKS"
FT   gene            884318..956060
FT                   /gene="ACTL8"
FT                   /locus_tag="hCG_25127"
FT                   /note="gene_id=hCG25127.3"
FT   mRNA            join(884318..884494,951980..952351,954762..956060)
FT                   /gene="ACTL8"
FT                   /locus_tag="hCG_25127"
FT                   /product="actin-like 8"
FT                   /note="gene_id=hCG25127.3 transcript_id=hCT16251.3; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 26-AUG-2002"
FT   CDS             join(952004..952351,954762..955514)
FT                   /codon_start=1
FT                   /gene="ACTL8"
FT                   /locus_tag="hCG_25127"
FT                   /product="actin-like 8"
FT                   /note="gene_id=hCG25127.3 transcript_id=hCT16251.3
FT                   protein_id=hCP42050.2"
FT                   /protein_id="EAW94846.1"
FT                   /translation="MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPS
FT                   YARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETP
FT                   LREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQG
FT                   RPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEAL
FT                   DFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVE
FT                   SCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLG
FT                   ASVVAHLSTYQSEWMSREEYGEHMRM"
FT   gene            1198449..1205345
FT                   /locus_tag="hCG_1980510"
FT                   /note="gene_id=hCG1980510.0"
FT   mRNA            join(1198449..1198644,1200989..1201075,1205017..1205345)
FT                   /locus_tag="hCG_1980510"
FT                   /product="hCG1980510"
FT                   /note="gene_id=hCG1980510.0 transcript_id=hCT2252864.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             1205122..1205280
FT                   /codon_start=1
FT                   /locus_tag="hCG_1980510"
FT                   /product="hCG1980510"
FT                   /note="gene_id=hCG1980510.0 transcript_id=hCT2252864.0
FT                   protein_id=hCP1855001.0"
FT                   /protein_id="EAW94847.1"
FT                   /translation="MHTPRYGDLWSSLQICCCLTQSKQSMDAAVLVIVKSSLSSFALAN
FT                   SWCLLSS"
FT   gene            1240514..1511184
FT                   /gene="IGSF21"
FT                   /locus_tag="hCG_25111"
FT                   /note="gene_id=hCG25111.2"
FT   mRNA            join(1240514..1240986,1360685..1360797,1424665..1424786,
FT                   1467605..1467723,1494812..1494927,1497920..1498394,
FT                   1509007..1509092,1509497..1509689,1510090..1510128,
FT                   1510953..1511184)
FT                   /gene="IGSF21"
FT                   /locus_tag="hCG_25111"
FT                   /product="immunoglobin superfamily, member 21"
FT                   /note="gene_id=hCG25111.2 transcript_id=hCT16235.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   CDS             join(1240917..1240986,1360685..1360797,1424665..1424786,
FT                   1467605..1467723,1494812..1494927,1497920..1498394,
FT                   1509007..1509092,1509497..1509689,1510090..1510128,
FT                   1510953..1511023)
FT                   /codon_start=1
FT                   /gene="IGSF21"
FT                   /locus_tag="hCG_25111"
FT                   /product="immunoglobin superfamily, member 21"
FT                   /note="gene_id=hCG25111.2 transcript_id=hCT16235.3
FT                   protein_id=hCP42035.2"
FT                   /protein_id="EAW94848.1"
FT                   /translation="MRTAPSLRRCVCLLLAAILDLARGYLTVNIEPLPPVVAGDAVTLK
FT                   CNFKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLP
FT                   EVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMAPPTSIEVVAADTPAPFSRYQA
FT                   QNFTLVCIVSGGKPAPMVYFKRDGEPIDAVPLSEPPAASSGPLQDSRPFRSLLHRDLDD
FT                   TKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSA
FT                   EPTYFLRHSRTPSSDGTVEVRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVA
FT                   PKGPKIVMTPSRARVGDTVRILVHGFQNEVFPEPMFTWTRVGSRLLDGSAEFDGKELVL
FT                   ERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDSNGSIGPTGARLTLVL
FT                   ALTVILELT"
FT   gene            complement(1299720..1312137)
FT                   /locus_tag="hCG_2045607"
FT                   /note="gene_id=hCG2045607.0"
FT   mRNA            complement(join(1299720..1299813,1300536..1300546,
FT                   1308936..1308963,1311841..1312137))
FT                   /locus_tag="hCG_2045607"
FT                   /product="hCG2045607"
FT                   /note="gene_id=hCG2045607.0 transcript_id=hCT2360442.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             complement(1311914..1312132)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045607"
FT                   /product="hCG2045607"
FT                   /note="gene_id=hCG2045607.0 transcript_id=hCT2360442.0
FT                   protein_id=hCP1925672.0"
FT                   /protein_id="EAW94849.1"
FT                   /translation="MGVGVCSMLWAALRWSLSPSKTAAWEGWSSNEHLLSCRELLGCCL
FT                   CHLPASLMDRVPSRLGQERGDQWSVAP"
FT   gene            <1518526..1521211
FT                   /locus_tag="hCG_2041908"
FT                   /note="gene_id=hCG2041908.0"
FT   mRNA            join(<1518526..1518917,1521113..1521211)
FT                   /locus_tag="hCG_2041908"
FT                   /product="hCG2041908"
FT                   /note="gene_id=hCG2041908.0 transcript_id=hCT2347139.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             <1518574..1518828
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041908"
FT                   /product="hCG2041908"
FT                   /note="gene_id=hCG2041908.0 transcript_id=hCT2347139.0
FT                   protein_id=hCP1912690.0"
FT                   /protein_id="EAW94850.1"
FT                   /translation="TASPFQLPKFDLLQGPSFSDHRKSPSLNPLKPRLRGLGSCFKRSM
FT                   AERSSTGTQPASEVTVSSVTHYFHGFGTLLTSLCLYFLF"
FT   gene            1614149..1616582
FT                   /gene="KLHDC7A"
FT                   /locus_tag="hCG_1645519"
FT                   /note="gene_id=hCG1645519.4"
FT   mRNA            1614149..1616582
FT                   /gene="KLHDC7A"
FT                   /locus_tag="hCG_1645519"
FT                   /product="kelch domain containing 7A"
FT                   /note="gene_id=hCG1645519.4 transcript_id=hCT1645646.3;
FT                   overlap evidence=yes; created on 15-AUG-2003"
FT   CDS             1614413..1616092
FT                   /codon_start=1
FT                   /gene="KLHDC7A"
FT                   /locus_tag="hCG_1645519"
FT                   /product="kelch domain containing 7A"
FT                   /note="gene_id=hCG1645519.4 transcript_id=hCT1645646.3
FT                   protein_id=hCP1613339.3"
FT                   /protein_id="EAW94851.1"
FT                   /translation="MNQSWVFTRVIGVSREEAGALEAASDVDLTLHQQEGAPNSSYTFS
FT                   SIARVRMEENFIQKAEGVEPRLKGKVYDYYVESTSQAIFQGRLAPRTAALTEVPSPRPP
FT                   PGSLGTGAASGGQAGDTKGAAERAASPQPGPWPSTRGFSRKESLLQIAENPELQLQPDG
FT                   FRLPAPPCPDPGALPGLGRSSREPHVQPVAGTNFFHIPLTPASAPQVRLDLGNCYEVLT
FT                   LAKRQNLEALKEAAYKVMSENYLQVLRSPDIYGCLSGAERELILQRRLRGRQYLVVADV
FT                   CPKEDSGGLCCYDDEQDVWRPLARMPPEAVSRGCAICSLFNYLFVVSGCQGPGHQPSSR
FT                   VFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLNSVERYDPRLDRWDFAPP
FT                   LPSDTFALAHTATVRAKEIFVTGGSLRFLLFRFSAQEQRWWAGPTGGSKDRTAEMVAVN
FT                   GFLYRFDLNRSLGIAVYRCSASTRLWYECATYRTPYPDAFQCAVVDNLIYCVGRRSTLC
FT                   FLADSVSPRFVPKELRSFPAPQGTLLPTVLTLPTPDLPQTRV"
FT   gene            1616595..1618761
FT                   /locus_tag="hCG_27944"
FT                   /note="gene_id=hCG27944.4"
FT   mRNA            1616595..1618761
FT                   /locus_tag="hCG_27944"
FT                   /product="hCG27944"
FT                   /note="gene_id=hCG27944.4 transcript_id=hCT19089.4; overlap
FT                   evidence=yes; created on 04-FEB-2004"
FT   CDS             1617133..1617321
FT                   /codon_start=1
FT                   /locus_tag="hCG_27944"
FT                   /product="hCG27944"
FT                   /note="gene_id=hCG27944.4 transcript_id=hCT19089.4
FT                   protein_id=hCP43479.4"
FT                   /protein_id="EAW94852.1"
FT                   /translation="MKETPSLRKAPVLPGGTGESLTQCITTALVPPLRETVTDGKAVML
FT                   LVPARSQGRWEVHQSRA"
FT   gene            1645903..1646172
FT                   /pseudo
FT                   /locus_tag="hCG_1643706"
FT                   /note="gene_id=hCG1643706.4"
FT   mRNA            1645903..1646172
FT                   /pseudo
FT                   /locus_tag="hCG_1643706"
FT                   /note="gene_id=hCG1643706.4 transcript_id=hCT1643833.2;
FT                   overlap evidence=yes; created on 30-JAN-2004"
FT   gene            1763634..>1877663
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /note="gene_id=hCG23504.3"
FT   mRNA            join(1763634..1764316,1766931..1767166,1767739..1767868,
FT                   1768871..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868528,1877548..>1877663)
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, transcript variant hCT2252879"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT2252879.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1763634..1764316,1766931..1767166,1767742..1767868,
FT                   1768865..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868528,1877548..>1877663)
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, transcript variant hCT1686496"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT1686496.2;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1763634..1764316,1766931..1767166,1767739..1767868,
FT                   1768865..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868793)
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, transcript variant hCT1955042"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT1955042.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1763634..1764316,1766931..1767166,1767739..1767868,
FT                   1768871..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868793)
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, transcript variant hCT2252881"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT2252881.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(1764232..1764316,1766931..1767166,1767739..1767868,
FT                   1768871..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868528,1877548..1877663)
FT                   /codon_start=1
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, isoform CRA_d"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT2252879.0
FT                   protein_id=hCP1854998.0 isoform=CRA_d"
FT                   /protein_id="EAW94856.1"
FT                   /translation="MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVF
FT                   INGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS
FT                   KPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSVSSISRVLRIKFG
FT                   KKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTF
FT                   TAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAA
FT                   FNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAA
FT                   AAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQ
FT                   ADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGY
FT                   QYGQYGQTAVDYLAKNVSLSTQRRMKLGEHSAVLGLLPVETGQAY"
FT   CDS             join(1764232..1764316,1766931..1767166,1767742..1767868,
FT                   1768865..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868528,1877548..1877663)
FT                   /codon_start=1
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, isoform CRA_b"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT1686496.2
FT                   protein_id=hCP1689892.2 isoform=CRA_b"
FT                   /protein_id="EAW94854.1"
FT                   /translation="MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVF
FT                   INGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS
FT                   KPRVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIKF
FT                   GKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTT
FT                   FTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLA
FT                   AFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAA
FT                   AAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQP
FT                   QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAG
FT                   YQYGQYGQTAVDYLAKNVSLSTQRRMKLGEHSAVLGLLPVETGQAY"
FT   CDS             join(1764232..1764316,1766931..1767166,1767739..1767868,
FT                   1768865..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868689)
FT                   /codon_start=1
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, isoform CRA_c"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT1955042.0
FT                   protein_id=hCP1765647.0 isoform=CRA_c"
FT                   /protein_id="EAW94855.1"
FT                   /translation="MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVF
FT                   INGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS
FT                   KPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLRIK
FT                   FGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRT
FT                   TFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQL
FT                   AAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLA
FT                   AAAAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQ
FT                   PQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVA
FT                   GYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQME
FT                   QFT"
FT   CDS             join(1764232..1764316,1766931..1767166,1767739..1767868,
FT                   1768871..1768999,1824384..1824583,1833283..1833448,
FT                   1835725..1835927,1868282..1868689)
FT                   /codon_start=1
FT                   /gene="PAX7"
FT                   /locus_tag="hCG_23504"
FT                   /product="paired box gene 7, isoform CRA_a"
FT                   /note="gene_id=hCG23504.3 transcript_id=hCT2252881.0
FT                   protein_id=hCP1854995.0 isoform=CRA_a"
FT                   /db_xref="GOA:P23759"
FT                   /db_xref="HGNC:HGNC:8621"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR022106"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23759"
FT                   /protein_id="EAW94853.1"
FT                   /translation="MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVF
FT                   INGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS
FT                   KPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSVSSISRVLRIKFG
FT                   KKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTF
FT                   TAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAA
FT                   FNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAA
FT                   AAAADTSSAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQ
FT                   ADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGY
FT                   QYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQF
FT                   T"
FT   gene            complement(<1970026..>1989895)
FT                   /gene="TAS1R2"
FT                   /locus_tag="hCG_25109"
FT                   /note="gene_id=hCG25109.2"
FT   mRNA            complement(join(<1970026..1970951,1972153..1972276,
FT                   1979761..1979970,1984633..1985409,1989713..>1989895))
FT                   /gene="TAS1R2"
FT                   /locus_tag="hCG_25109"
FT                   /product="taste receptor, type 1, member 2"
FT                   /note="gene_id=hCG25109.2 transcript_id=hCT16233.1; splice
FT                   donor-acceptor pairs covered / total pairs = 3/4; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(<1970026..1970951,1972153..1972276,
FT                   1979761..1979970,1984633..1985409,1989713..1989895))
FT                   /codon_start=1
FT                   /gene="TAS1R2"
FT                   /locus_tag="hCG_25109"
FT                   /product="taste receptor, type 1, member 2"
FT                   /note="gene_id=hCG25109.2 transcript_id=hCT16233.1
FT                   protein_id=hCP42034.1"
FT                   /protein_id="EAW94857.1"
FT                   /translation="MGPRAKTICSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANM
FT                   KGIVHLNFLQVPMCKEQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRW
FT                   NWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVD
FT                   KLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIASESWAIDPVLHNLTELRHLGT
FT                   FLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCNQECDNCLNATLSFNTILRLS
FT                   GERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQLLEEIWKVNFTLLDHQIFFD
FT                   PQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKR
FT                   CQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETSCFKRQLV
FT                   FLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYM
FT                   VVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRY
FT                   QGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSL
FT                   DLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFMSAYSGVLVTIVDL
FT                   LVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD"
FT   gene            complement(2001658..2033020)
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /note="gene_id=hCG25108.2"
FT   mRNA            complement(join(2001658..2001851,2001879..2003190,
FT                   2004696..2004814,2005616..2005737,2006549..2006701,
FT                   2007454..2007501,2007662..2007858,2009546..2009619,
FT                   2011953..2012140,2013377..2013451,2013532..2013681,
FT                   2015726..2015881,2016717..2016764,2019615..2019707,
FT                   2020265..2020358,2032715..2033020))
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant hCT2252965"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT2252965.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2001663..2003190,2004696..2004814,
FT                   2005616..2005737,2006549..2006701,2007454..2007501,
FT                   2007662..2007858,2009546..2009619,2011953..2012140,
FT                   2013377..2013451,2013532..2013681,2015726..2015881,
FT                   2016717..2016764,2019615..2019707,2020265..2020358,
FT                   2032715..2033020))
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant hCT16232"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT16232.3; splice
FT                   donor-acceptor pairs covered / total pairs = 14/14; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2001665..2002023,2003037..2003190,
FT                   2004696..2004814,2005616..2005737,2006549..2006701,
FT                   2007454..2007501,2007662..2007858,2009546..2009619,
FT                   2011953..2012140,2013377..2013451,2013532..2013681,
FT                   2015726..2015881,2016717..2016764,2019615..2019707,
FT                   2020265..2020358,2032715..2033020))
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant hCT1955043"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT1955043.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2003078..2003190,2004696..2004814,
FT                   2005616..2005737,2006549..2006701,2007454..2007501,
FT                   2007662..2007858,2009546..2009619,2011953..2012140,
FT                   2013377..2013451,2013532..2013681,2015726..2015881,
FT                   2016717..2016764,2019615..2019707,2020265..2020358,
FT                   2032715..2032776))
FT                   /codon_start=1
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT16232.3
FT                   protein_id=hCP42032.3 isoform=CRA_a"
FT                   /db_xref="GOA:P30038"
FT                   /db_xref="HGNC:HGNC:406"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:3V9G"
FT                   /db_xref="PDB:3V9H"
FT                   /db_xref="PDB:3V9I"
FT                   /db_xref="PDB:4OE5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30038"
FT                   /protein_id="EAW94858.1"
FT                   /translation="MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSP
FT                   ERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNK
FT                   AIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAA
FT                   AELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGA
FT                   PALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCG
FT                   INFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSA
FT                   FEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFAR
FT                   IKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVY
FT                   PDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQ
FT                   QPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ"
FT   CDS             complement(join(2003078..2003190,2004696..2004814,
FT                   2005616..2005737,2006549..2006701,2007454..2007501,
FT                   2007662..2007858,2009546..2009619,2011953..2012140,
FT                   2013377..2013451,2013532..2013681,2015726..2015881,
FT                   2016717..2016764,2019615..2019707,2020265..2020358,
FT                   2032715..2032776))
FT                   /codon_start=1
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT2252965.0
FT                   protein_id=hCP1854991.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAD8"
FT                   /protein_id="EAW94859.1"
FT                   /translation="MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSP
FT                   ERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNK
FT                   AIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAA
FT                   AELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGA
FT                   PALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCG
FT                   INFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSA
FT                   FEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFAR
FT                   IKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVY
FT                   PDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQ
FT                   QPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ"
FT   CDS             complement(join(2003078..2003190,2004696..2004814,
FT                   2005616..2005737,2006549..2006701,2007454..2007501,
FT                   2007662..2007858,2009546..2009619,2011953..2012140,
FT                   2013377..2013451,2013532..2013681,2015726..2015881,
FT                   2016717..2016764,2019615..2019707,2020265..2020358,
FT                   2032715..2032776))
FT                   /codon_start=1
FT                   /gene="ALDH4A1"
FT                   /locus_tag="hCG_25108"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG25108.2 transcript_id=hCT1955043.1
FT                   protein_id=hCP1765636.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAD8"
FT                   /protein_id="EAW94860.1"
FT                   /translation="MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSP
FT                   ERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNK
FT                   AIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAA
FT                   AELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGA
FT                   PALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCG
FT                   INFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSA
FT                   FEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFAR
FT                   IKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVY
FT                   PDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQ
FT                   QPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ"
FT   gene            complement(2034404..2035848)
FT                   /locus_tag="hCG_1817774"
FT                   /note="gene_id=hCG1817774.1"
FT   mRNA            complement(join(2034404..2035739,2035790..2035848))
FT                   /locus_tag="hCG_1817774"
FT                   /product="hCG1817774"
FT                   /note="gene_id=hCG1817774.1 transcript_id=hCT1960230.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(2034751..2035242)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1817774"
FT                   /product="hCG1817774"
FT                   /note="gene_id=hCG1817774.1 transcript_id=hCT1960230.1
FT                   protein_id=hCP1772450.1"
FT                   /protein_id="EAW94861.1"
FT                   /translation="MGDSGSTRLPWSLGLCGSQVVRQLEQKWKWLKMLIAQPRLCLLQA
FT                   KPGLQSLLCSPQGPGGRDQGAGGFLGQGSSPLRHQALALEELSPGVGSLEGTGWVQVKP
FT                   DSLWKGIFYEWMISRLRVGCVLVLSKSLTKTLPSQALKEMRQSPSLQDPLWMFLHLPDF
FT                   "
FT   gene            complement(2038085..2086534)
FT                   /locus_tag="hCG_25110"
FT                   /note="gene_id=hCG25110.3"
FT   mRNA            complement(join(2038085..2038919,2040595..2040725,
FT                   2041637..2041729,2042216..2042336,2047160..2047299,
FT                   2048619..2048759,2049935..2050030,2051318..2051378,
FT                   2085609..2086534))
FT                   /locus_tag="hCG_25110"
FT                   /product="hCG25110"
FT                   /note="gene_id=hCG25110.3 transcript_id=hCT16234.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(2038814..2038919,2040595..2040725,
FT                   2041637..2041729,2042216..2042336,2047160..2047299,
FT                   2048619..2048759,2049935..2050030,2051318..2051378,
FT                   2085609..2086273))
FT                   /codon_start=1
FT                   /locus_tag="hCG_25110"
FT                   /product="hCG25110"
FT                   /note="gene_id=hCG25110.3 transcript_id=hCT16234.3
FT                   protein_id=hCP42033.3"
FT                   /protein_id="EAW94862.1"
FT                   /translation="MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAA
FT                   LRDDLGSNIHLLKGLNVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSRE
FT                   QAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWS
FT                   YTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRR
FT                   WEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDT
FT                   KIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQ
FT                   DGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNC
FT                   NPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYME
FT                   MCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS
FT                   "
FT   gene            complement(2202939..2204007)
FT                   /locus_tag="hCG_1984464"
FT                   /note="gene_id=hCG1984464.0"
FT   mRNA            complement(2202939..2204007)
FT                   /locus_tag="hCG_1984464"
FT                   /product="hCG1984464"
FT                   /note="gene_id=hCG1984464.0 transcript_id=hCT2258797.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2203228..2203959)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1984464"
FT                   /product="hCG1984464"
FT                   /note="gene_id=hCG1984464.0 transcript_id=hCT2258797.0
FT                   protein_id=hCP1855040.0"
FT                   /protein_id="EAW94863.1"
FT                   /translation="MSQSRLPKGSQPGAVELSGLCLRSCVLTTVAAAPGGLRPAPLHTW
FT                   AAGLPRASPQTSGEGSPRGREGSLMPISFRSLRATRPTDVGLSCLDVQFLWLTPQARSS
FT                   GTEGGLWAPVDFHSQDFTSLPRASDRTATSSHECRAWTKLERQRRLWQGPSWKPWQARA
FT                   CMCWLARAYFGVCVGDTGLLRDWRGSRVGSSLVEARPGTHSVVQIPAPLPAVSTVSSPV
FT                   KWEYLCGGRVLRFPRANLPAV"
FT   gene            complement(2204469..2340176)
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /note="gene_id=hCG1984462.0"
FT   mRNA            complement(join(2204469..2204864,2204958..2205137,
FT                   2206708..2206870,2207944..2208034,2211317..2211541,
FT                   2214472..2214666,2216113..2216238,2216647..2216789,
FT                   2217784..2217897,2218727..2218945,2222786..2222885,
FT                   2223280..2223453,2223916..2224106,2224873..2224992,
FT                   2225512..2225619,2226490..2226617,2227159..2227246,
FT                   2229563..2229643,2230342..2230539,2231486..2231607,
FT                   2234050..2234223,2234551..2234632,2235014..2235155,
FT                   2235699..2235808,2236535..2236692,2236803..2236932,
FT                   2240062..2240189,2240346..2240430,2240708..2240798,
FT                   2242490..2242833,2243665..2243793,2243911..2244036,
FT                   2244777..2244915,2245364..2245603,2247187..2247380,
FT                   2247789..2247876,2248838..2248923,2249523..2249667,
FT                   2250146..2250314,2251155..2251400,2251900..2251978,
FT                   2252799..2253026,2254508..2254657,2256413..2256622,
FT                   2257590..2257706,2258178..2258263,2267975..2268149,
FT                   2269051..2269188,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274888,
FT                   2276777..2276951,2277944..2278073,2278250..2278318,
FT                   2280528..2280744,2281594..2281810,2282264..2282469,
FT                   2283228..2283453,2283719..2283890,2284869..2285026,
FT                   2285392..2285619,2286222..2286374,2286718..2286876,
FT                   2287766..2287948,2290062..2290232,2290868..2291098,
FT                   2291540..2291687,2291778..2291848,2292371..2292562,
FT                   2293715..2293778,2294204..2294392,2294750..2294948,
FT                   2295200..2295300,2295607..2295708,2296948..2297157,
FT                   2297953..2298110,2299361..2299458,2300688..2300809,
FT                   2302789..2303018,2303106..2303231,2303364..2303546,
FT                   2304244..2304372,2304879..2304958,2306517..2306652,
FT                   2307386..2307668,2308976..2309145,2313736..2313821,
FT                   2313941..2314100,2315024..2315211,2316464..2316581,
FT                   2317086..2317223,2317363..2317462,2322114..2322304,
FT                   2322407..2322466,2323359..2323483,2327065..2327189,
FT                   2327594..2327735,2327871..2327973,2328465..2328604,
FT                   2328723..2328852,2329575..2329678,2331642..2331739,
FT                   2339997..2340176))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2258795"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258795.0;
FT                   splice donor-acceptor pairs covered / total pairs = 97/104;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2204474..2204864,2206708..2206870,
FT                   2207944..2208034,2211317..2211541,2214472..2214666,
FT                   2216113..2216238,2216647..2216789,2217784..2217897,
FT                   2218727..2218945,2222786..2222885,2223280..2223453,
FT                   2223916..2224106,2224873..2224992,2225512..2225619,
FT                   2226490..2226617,2227159..2227246,2229563..2229643,
FT                   2230342..2230539,2231486..2231607,2234050..2234223,
FT                   2234551..2234632,2235014..2235155,2235699..2235808,
FT                   2236535..2236692,2236803..2236932,2240062..2240189,
FT                   2240346..2240430,2240708..2240798,2242490..2242833,
FT                   2243665..2243793,2243911..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269188,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276951,2277944..2278078,
FT                   2278510..2278577,2280528..2280744,2281594..2281810,
FT                   2282264..2282427,2283252..2283453,2283719..2283890,
FT                   2284869..2285026,2285392..2285619,2286222..2286374,
FT                   2286718..2286876,2287766..2287948,2290062..2290232,
FT                   2290868..2291098,2291540..2291687,2291778..2291848,
FT                   2292371..2292562,2293715..2293778,2294204..2294392,
FT                   2294750..2294948,2295200..2295300,2295607..2295708,
FT                   2296948..2297157,2297953..2298110,2299361..2299458,
FT                   2300688..2300809,2302789..2303018,2303106..2303231,
FT                   2303364..2303546,2304244..2304372,2304879..2304958,
FT                   2306517..2306652,2307386..2307668,2308976..2309145,
FT                   2313736..2313821,2313941..2314100,2315024..2315211,
FT                   2316464..2316581,2317086..2317223,2317363..2317462,
FT                   2322114..2322304,2322407..2322466,2323359..2323483,
FT                   2327065..2327189,2327594..2327735,2327871..2327973,
FT                   2328465..2328604,2328723..2328852,2329575..2329678,
FT                   2331642..2331739,2339997..2340176))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2258794"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258794.0;
FT                   splice donor-acceptor pairs covered / total pairs =
FT                   104/105; created on 26-AUG-2002"
FT   mRNA            complement(join(<2204800..2204864,2206708..2206870,
FT                   2207944..2208034,2211317..2211541,2214472..2214666,
FT                   2216113..2216238,2216647..2216789,2217784..2217897,
FT                   2218727..2218945,2222786..2222885,2223280..2223453,
FT                   2223916..2224106,2224873..2224992,2225512..2225619,
FT                   2226490..2226617,2227159..2227246,2229563..2229643,
FT                   2230342..2230539,2231486..2231607,2234050..2234223,
FT                   2234551..2234632,2235014..2235155,2235699..2235808,
FT                   2236535..2236692,2236803..2236932,2240062..2240189,
FT                   2240346..2240430,2240708..2240798,2242490..2242833,
FT                   2243665..2243793,2243911..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269188,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276951,2277944..2278075,
FT                   2278510..2278577,2280528..2280744,2281594..2281810,
FT                   2282264..2282427,2283252..2283453,2283719..2283890,
FT                   2284869..2285026,2285392..2285619,2286222..2286374,
FT                   2286718..2286876,2287766..2287948,2290062..2290232,
FT                   2290868..2291098,2291540..2291687,2291778..2291848,
FT                   2292371..2292562,2293715..2293778,2294204..2294392,
FT                   2294750..2294948,2295200..2295300,2295607..2295708,
FT                   2296948..2297157,2297953..2298110,2299361..2299458,
FT                   2300688..2300809,2302789..2303018,2303106..2303231,
FT                   2303364..2303546,2304244..2304372,2304879..2304958,
FT                   2306517..2306652,2307386..2307668,2308976..2309145,
FT                   2313736..2313821,2313941..2314100,2315024..2315211,
FT                   2316464..2316581,2317086..2317223,2317363..2317462,
FT                   2322114..2322304,2322407..2322466,2323359..2323483,
FT                   2327065..2327189,2327594..2327735,2327871..2327973,
FT                   2328465..2328604,2328723..2328852,2329575..2329678,
FT                   2331642..2331739,2339997..2340172))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2357800"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2357800.0;
FT                   splice donor-acceptor pairs covered / total pairs =
FT                   105/105; created on 15-JUL-2004"
FT   CDS             complement(join(2204800..2204864,2206708..2206870,
FT                   2207944..2208034,2211317..2211541,2214472..2214666,
FT                   2216113..2216238,2216647..2216789,2217784..2217897,
FT                   2218727..2218945,2222786..2222885,2223280..2223453,
FT                   2223916..2224106,2224873..2224992,2225512..2225619,
FT                   2226490..2226617,2227159..2227246,2229563..2229643,
FT                   2230342..2230539,2231486..2231607,2234050..2234223,
FT                   2234551..2234632,2235014..2235155,2235699..2235808,
FT                   2236535..2236692,2236803..2236932,2240062..2240189,
FT                   2240346..2240430,2240708..2240798,2242490..2242833,
FT                   2243665..2243793,2243911..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269188,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276834))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_c"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258794.0
FT                   protein_id=hCP1855031.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC9"
FT                   /protein_id="EAW94866.1"
FT                   /translation="MRPNNLVHFTESKLPQMETEGMDEGKEPQKQLEGDCCSFITQLVN
FT                   HFWKLHASKPKNAFLAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQML
FT                   LCPDPAVSFSCKQALIRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSG
FT                   IPNGGHIRQESQEQSEVDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPML
FT                   DIPPDADDETMVELAIALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTA
FT                   SAPASDDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDAT
FT                   AEGHPAGPGSVSSSTGAISTTTGHQEGDGSEGEGEGETEGDVHTSNRLHMVRLMLLERL
FT                   LQTLPQLRNVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVS
FT                   KKNERSALNEVHLVVMRLLSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCL
FT                   HVLKSLLEYWKSQQNDEEPVATSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQ
FT                   LLTEMVLRLPYQIKKITDTNSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFI
FT                   CGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHL
FT                   KACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAA
FT                   LAASSGSSSASSSSAPVAASSGQATTQSKSSTKKSKKEEKEKEKDGETSGSQEDQLCTA
FT                   LVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWS
FT                   IWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNI
FT                   YNTLSGLVEFDGYYLESDPCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTI
FT                   SKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKID
FT                   LPLPIVASNLMIEFADFYENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRS
FT                   INYDEKDPFLCNACGFCKYARFDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADR
FT                   VYHQLMGHRPQLENLLCKVNEAAPEKPQDDSGTAGGISSTSASVNRYILQLAQEYCGDC
FT                   KNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGH
FT                   TSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIRELFDYNLRRGAAAMREEV
FT                   RQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDS
FT                   CWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQKLIKPPAPTSKKNKDVPVEALT
FT                   TVKPYCNEIHAQAQLWLKRDPKASYDAWKKCLPIRGIDGNGKAPSKSELRHLYLTEKYV
FT                   WRWKQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIPSRKQQ
FT                   VLDLLTSYLDELSIAGECAAEYLALYQKLITSAHWKVYLAARGVLPYVGNLITKEIARL
FT                   LALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKSRLVGTVLNGYLCLRKLVVQ
FT                   RTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSI
FT                   IYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLV
FT                   ALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEPMRIVYRMRGLLGDATEEFI
FT                   ESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQGRHLLTVLLKLFSYC
FT                   VKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESN
FT                   AEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPYLSFGEVEKMQI
FT                   LVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNAL
FT                   DYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPGTQVLIGTDSIPNLHKL
FT                   EQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMT
FT                   TNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEELEN
FT                   KPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVP
FT                   ESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNI
FT                   HLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAFEVDGPYYFTVLALHIL
FT                   PPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVKDYSAYRSSLLFWALVDLIYN
FT                   MFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVAGL
FT                   LSEITDPESFLKDLLNSVP"
FT   CDS             complement(join(2204800..2204864,2206708..2206870,
FT                   2207944..2208034,2211317..2211541,2214472..2214666,
FT                   2216113..2216238,2216647..2216789,2217784..2217897,
FT                   2218727..2218945,2222786..2222885,2223280..2223453,
FT                   2223916..2224106,2224873..2224992,2225512..2225619,
FT                   2226490..2226617,2227159..2227246,2229563..2229643,
FT                   2230342..2230539,2231486..2231607,2234050..2234223,
FT                   2234551..2234632,2235014..2235155,2235699..2235808,
FT                   2236535..2236692,2236803..2236932,2240062..2240189,
FT                   2240346..2240430,2240708..2240798,2242490..2242833,
FT                   2243665..2243793,2243911..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269188,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276834))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_c"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2357800.0
FT                   protein_id=hCP1923047.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC9"
FT                   /protein_id="EAW94869.1"
FT                   /translation="MRPNNLVHFTESKLPQMETEGMDEGKEPQKQLEGDCCSFITQLVN
FT                   HFWKLHASKPKNAFLAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQML
FT                   LCPDPAVSFSCKQALIRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSG
FT                   IPNGGHIRQESQEQSEVDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPML
FT                   DIPPDADDETMVELAIALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTA
FT                   SAPASDDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDAT
FT                   AEGHPAGPGSVSSSTGAISTTTGHQEGDGSEGEGEGETEGDVHTSNRLHMVRLMLLERL
FT                   LQTLPQLRNVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVS
FT                   KKNERSALNEVHLVVMRLLSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCL
FT                   HVLKSLLEYWKSQQNDEEPVATSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQ
FT                   LLTEMVLRLPYQIKKITDTNSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFI
FT                   CGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHL
FT                   KACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAA
FT                   LAASSGSSSASSSSAPVAASSGQATTQSKSSTKKSKKEEKEKEKDGETSGSQEDQLCTA
FT                   LVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWS
FT                   IWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNI
FT                   YNTLSGLVEFDGYYLESDPCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTI
FT                   SKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKID
FT                   LPLPIVASNLMIEFADFYENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRS
FT                   INYDEKDPFLCNACGFCKYARFDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADR
FT                   VYHQLMGHRPQLENLLCKVNEAAPEKPQDDSGTAGGISSTSASVNRYILQLAQEYCGDC
FT                   KNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGH
FT                   TSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIRELFDYNLRRGAAAMREEV
FT                   RQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDS
FT                   CWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQKLIKPPAPTSKKNKDVPVEALT
FT                   TVKPYCNEIHAQAQLWLKRDPKASYDAWKKCLPIRGIDGNGKAPSKSELRHLYLTEKYV
FT                   WRWKQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIPSRKQQ
FT                   VLDLLTSYLDELSIAGECAAEYLALYQKLITSAHWKVYLAARGVLPYVGNLITKEIARL
FT                   LALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKSRLVGTVLNGYLCLRKLVVQ
FT                   RTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSI
FT                   IYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLV
FT                   ALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEPMRIVYRMRGLLGDATEEFI
FT                   ESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQGRHLLTVLLKLFSYC
FT                   VKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESN
FT                   AEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPYLSFGEVEKMQI
FT                   LVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNAL
FT                   DYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPGTQVLIGTDSIPNLHKL
FT                   EQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMT
FT                   TNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEELEN
FT                   KPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVP
FT                   ESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNI
FT                   HLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAFEVDGPYYFTVLALHIL
FT                   PPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVKDYSAYRSSLLFWALVDLIYN
FT                   MFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVAGL
FT                   LSEITDPESFLKDLLNSVP"
FT   CDS             complement(join(2204800..2204864,2204958..2205137,
FT                   2206708..2206870,2207944..2208034,2211317..2211541,
FT                   2214472..2214666,2216113..2216238,2216647..2216789,
FT                   2217784..2217897,2218727..2218945,2222786..2222885,
FT                   2223280..2223453,2223916..2224106,2224873..2224992,
FT                   2225512..2225619,2226490..2226617,2227159..2227246,
FT                   2229563..2229643,2230342..2230539,2231486..2231607,
FT                   2234050..2234223,2234551..2234632,2235014..2235155,
FT                   2235699..2235808,2236535..2236692,2236803..2236932,
FT                   2240062..2240189,2240346..2240430,2240708..2240798,
FT                   2242490..2242833,2243665..2243793,2243911..2244036,
FT                   2244777..2244915,2245364..2245603,2247187..2247380,
FT                   2247789..2247876,2248838..2248923,2249523..2249667,
FT                   2250146..2250314,2251155..2251400,2251900..2251978,
FT                   2252799..2253026,2254508..2254657,2256413..2256622,
FT                   2257590..2257706,2258178..2258263,2267975..2268149,
FT                   2269051..2269149))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_a"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258795.0
FT                   protein_id=hCP1855028.0 isoform=CRA_a"
FT                   /protein_id="EAW94864.1"
FT                   /translation="MVLPFGPLLLTTVVVWARRAGAVQWTQWLASTVYLAGAVLMAMLQ
FT                   LRGIRLDQEVSAQALEPSAPPLGTRREMAPREKEKEKLKEMSTLATDLDGEDEKDKGAL
FT                   DNLLSQLIAELGMDKKDVSKKNERSALNEVHLVVMRLLSVFMSRTKSGSKSSICESSSL
FT                   ISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQNDEEPVATSQLLKPHTTSSPPDMSPF
FT                   FLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKITDTNSRIPPPVFDHSWFYFLSEYL
FT                   MIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVT
FT                   ASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGVS
FT                   PVLLQLLSCALCGSKVLAALAASSGSSSASSSSAPVAASSGQATTQSKSSTKKSKKEEK
FT                   EKEKDGETSGSQEDQLCTALVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLH
FT                   IYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKA
FT                   VEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPEVPFCYIKLSSIKV
FT                   DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPAR
FT                   WHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRCSASVPAN
FT                   PGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCAVDPIENE
FT                   EDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQDDSGTAGGISST
FT                   SASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSV
FT                   QPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLI
FT                   RELFDYNLRRGAAAMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLA
FT                   SSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQKLI
FT                   KPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYDAWKKCLPIRGIDGN
FT                   GKAPSKSELRHLYLTEKYVWRWKQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAAR
FT                   QAACTIVEALATIPSRKQQVLDLLTSYLDELSIAGECAAEYLALYQKLITSAHWKVYLA
FT                   ARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKS
FT                   RLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKR
FT                   YNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPG
FT                   IGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEP
FT                   MRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIR
FT                   DFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGG
FT                   AAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQ
FT                   GLLRIIPYLSFGEVEKMQILVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNS
FT                   NGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQ
FT                   HPGTQVLIGTDSIPNLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAE
FT                   KKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPT
FT                   KVLGIYTFTKRVALEELENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAAL
FT                   QNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRF
FT                   AMEQSFSADTGGGGRESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVE
FT                   SAFEVDGPYYFTVLALHILPPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVKD
FT                   YSAYRSSLLFWALVDLIYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTF
FT                   QEEFMPVETFSEFLDVAAVRKFQNIRHTLFKCENKNTFQQCLLLEQDSSCGTGFCSMTT
FT                   SPVMLLSSEQPGQSLSDRSLLSEITDPESFLKDLLNSVP"
FT   mRNA            complement(join(<2243848..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269182,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276815))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2258791"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258791.0;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<2243848..2244036,2244777..2244915,
FT                   2245364..2245603,2247187..2247380,2247789..2247876,
FT                   2248838..2248923,2249523..2249667,2250146..2250314,
FT                   2251155..2251400,2251900..2251978,2252799..2253026,
FT                   2254508..2254657,2256413..2256622,2257590..2257706,
FT                   2258178..2258285,2258945..2259041,2267975..2268149,
FT                   2269051..2269182,2270755..2270859,2271314..2271491,
FT                   2271614..2271744,2273931..2274042,2274737..2274858,
FT                   2275744..2275884,2276777..2276786))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_b"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258791.0
FT                   protein_id=hCP1855030.0 isoform=CRA_b"
FT                   /protein_id="EAW94865.1"
FT                   /translation="METEGMDEGKEPQKQLEGDCCSFITQLVNHFWKLHASKPKNAFLA
FT                   PACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQALI
FT                   RVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPNGGHIRQESQEQSE
FT                   VDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAI
FT                   ALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASASDDEGSTAATDGST
FT                   LRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPAGPGSVSSSTGAI
FT                   STTTGHQEGDGSEGEGEGETEGDVHTSNRLHMVRLMLLERLLQTLPQLRNVGGVRAIPY
FT                   MQVILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVSKKNERSALNEVHLVVMRL
FT                   LSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQNDEE
FT                   PVATSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKITD
FT                   TNSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDS
FT                   HVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFC
FT                   IKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASSGSSSASSSSAPVA
FT                   ASSGQATTQSKSSTKKSKKEEKEKEKDGETSGSQEDQLCTALVNQLNKFADKETLIQFL
FT                   RCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDL
FT                   LGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESD
FT                   PCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRT
FT                   INLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFY
FT                   ENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCK
FT                   YARFDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCK
FT                   VNEAAPEKPQVVPRCKGHLDKGLGLDQKTAS"
FT   mRNA            complement(join(2271154..2271491,2271614..2271744,
FT                   2273931..2274042,2274737..2274858,2275744..2275884,
FT                   2276777..2276951,2277944..2278078,2278510..2278577,
FT                   2280528..2280744,2281594..2281810,2282264..2282469,
FT                   2283228..2283453,2283719..2283890,2284869..2285026,
FT                   2285392..2285619,2286222..2286374,2286718..2286876,
FT                   2287766..2287948,2290062..2290232,2290868..2291098,
FT                   2291540..2291687,2291778..2291848,2292371..2292562,
FT                   2293715..2293778,2294204..2294392,2294750..2294948,
FT                   2295200..2295300,2295607..2295708,2296948..2297157,
FT                   2297953..2298110,2299361..2299458,2300688..2300809,
FT                   2302789..2303018,2303106..2303231,2303364..2303546,
FT                   2304244..2304372,2304879..2304958,2306517..2306652,
FT                   2307386..2307668,2308976..2309145,2313736..2313821,
FT                   2313941..2314100,2315024..2315211,2316464..2316581,
FT                   2317086..2317223,2317363..2317462,2322114..2322304,
FT                   2322407..2322466,2323359..2323483,2327065..2327189,
FT                   2327594..2327735,2327871..2327973,2328465..2328604,
FT                   2328723..2328852,2329575..2329678,2331642..2331739,
FT                   2339997..2340176))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2258792"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258792.0;
FT                   splice donor-acceptor pairs covered / total pairs = 54/56;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(<2281442..2281810,2282264..2282427,
FT                   2283252..2283453,2283719..2283890,2284869..2285029,
FT                   2285392..2285619,2286222..2286374,2286718..2286876,
FT                   2287766..2287948,2290062..2290232,2290868..2291098,
FT                   2291540..2291687,2291778..2291848,2292371..2292562,
FT                   2293715..2293778,2294204..2294392,2294750..2294948,
FT                   2295200..2295300,2295607..2295708,2296948..2297157,
FT                   2297953..2298110,2299361..2299458,2300688..2300809,
FT                   2302789..2303018,2303106..2303231,2303364..2303546,
FT                   2304244..2304372,2304879..2304958,2306517..2306652,
FT                   2307386..2307668,2308976..2309145,2313736..2313810))
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, transcript variant
FT                   hCT2258793"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258793.0;
FT                   splice donor-acceptor pairs covered / total pairs = 31/31;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<2281442..2281810,2282264..2282427,
FT                   2283252..2283453,2283719..2283890,2284869..2285029,
FT                   2285392..2285619,2286222..2286374,2286718..2286876,
FT                   2287766..2287948,2290062..2290232,2290868..2291098,
FT                   2291540..2291687,2291778..2291848,2292371..2292562,
FT                   2293715..2293778,2294204..2294392,2294750..2294948,
FT                   2295200..2295300,2295607..2295708,2296948..2297157,
FT                   2297953..2298110,2299361..2299458,2300688..2300809,
FT                   2302789..2303018,2303106..2303231,2303364..2303546,
FT                   2304244..2304372,2304879..2304958,2306517..2306652,
FT                   2307386..2307655))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_e"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258793.0
FT                   protein_id=hCP1855029.0 isoform=CRA_e"
FT                   /protein_id="EAW94868.1"
FT                   /translation="MKQNALQGVVPSETEDLNVEHLQMLLLIFHNFTETGRRAILSLFV
FT                   QIIQELSVNMDAQMRFVPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWAS
FT                   GSQDSNSRRATTPLYHGFKEVEENWSKHFSSDAVPHPRFYCVLSPEASEDDLNRLDSVA
FT                   CDVLFSKLVKYDELYAALTALLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILG
FT                   ILPPSKTYINQLSMNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHASS
FT                   LLELASTTKCSSVKYDVEIVEEYFARQISSFCSIDCTTILQLHEIPSLQSIYTLDAAIS
FT                   KVQVSLDEHFSKMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNFNEEGTTE
FT                   KPSKEKLQGFAAVLAIGSSRCKANTLGPTLVQNLPSSVQTVCESWNNINTNEFPNIGSW
FT                   RNAFANDTIPSESYISAVQAAHLGTLCSQSLPLAASLKHTLLSLVRLTGDLIVWSDEMN
FT                   PPQVIRTLLPLLLESSTESVAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANH
FT                   ADPNSGLDESILEECLQYLEKQLESSQARKAMEEFFSDSGELVQIMMATANENLSAKFC
FT                   NRVLKFFTKLFQLTEKSPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLD
FT                   VIQENRQLLQLLTTYIVRENSQVGEGVCAVLLGTLTPMATEMLANGDGTGFPELMVVMA
FT                   TLASAGQGAGHLQLHNAAVDWLSRCKKYLSQKNVVEKLNANVMHGKHVMILECTCHIMS
FT                   YLADVTNALSQSNGQGPSHLSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNK
FT                   LCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAK
FT                   EDGSCLALVKRTPSSGMSSTMKESAFQSEPRISESLVRHASTSSPADKAKVTISDGKVA
FT                   DEEKPKKSSLCRTVEGCREELQNQANFSFAPLVLDMLNFLMDAIQTNFQQASAVGSSSR
FT                   AQQALSELHTVEKAVEMTDQLMVPTLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRR
FT                   VAMCVLSSPHGRRQHLAVSHEKGKITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVL
FT                   SLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTE
FT                   LAIVTADFVKIYDLCVDALSPTFYFLLPSSKIRDVTFLFNEEGKNIIVIMSSAGYIYTQ
FT                   LMEEASSAQQGPFYVTNVLEINHEDLKQDSNSQVAGGGVSVYYSHVLQMLFFSYCQGKS
FT                   FAATISRTTLEVLQLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVV
FT                   MVKPDTFLIQEIKTLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENT
FT                   SYWLQPSLQPSSVISIMKPVRKRKTATITTRTSSQVTFPIDFFEHNQQLTDVEFGGNDL
FT                   LQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSY
FT                   IEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFSESPTPGADSVLIVTAKLGATG
FT                   LWLSNILGSLHSADFSVLSSGNFELHLMY"
FT   CDS             complement(join(2282468..2282469,2283228..2283453,
FT                   2283719..2283890,2284869..2285026,2285392..2285619,
FT                   2286222..2286374,2286718..2286876,2287766..2287948,
FT                   2290062..2290232,2290868..2291098,2291540..2291687,
FT                   2291778..2291848,2292371..2292562,2293715..2293778,
FT                   2294204..2294392,2294750..2294948,2295200..2295300,
FT                   2295607..2295708,2296948..2297157,2297953..2298110,
FT                   2299361..2299458,2300688..2300809,2302789..2303018,
FT                   2303106..2303231,2303364..2303546,2304244..2304372,
FT                   2304879..2304958,2306517..2306652,2307386..2307668,
FT                   2308976..2309145,2313736..2313821,2313941..2314100,
FT                   2315024..2315211,2316464..2316581,2317086..2317223,
FT                   2317363..2317462,2322114..2322304,2322407..2322466,
FT                   2323359..2323483,2327065..2327189,2327594..2327735,
FT                   2327871..2327973,2328465..2328604,2328723..2328852,
FT                   2329575..2329678,2331642..2331739,2339997..2340172))
FT                   /codon_start=1
FT                   /gene="ZUBR1"
FT                   /locus_tag="hCG_1984462"
FT                   /product="zinc finger, UBR1 type 1, isoform CRA_d"
FT                   /note="gene_id=hCG1984462.0 transcript_id=hCT2258792.0
FT                   protein_id=hCP1855027.0 isoform=CRA_d"
FT                   /protein_id="EAW94867.1"
FT                   /translation="MATSGGEEAAAAAPAPGTPATGADTTPGWEVAVRPLLSASYSAFE
FT                   MKELPQLVASVIESESEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAAC
FT                   KVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQT
FT                   VKTLSDVEDQKELASPVSPELRQKEVQMNFLNQLTSVFNPRTVASQPISTQTLVEGEND
FT                   EQSSTDQASAIKTKNVFIAQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANS
FT                   FFIMPATVADATAVRNGFHSLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAG
FT                   VSVATCMAILHVGSAQQVRTGSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAG
FT                   GEHYQNFQLLGAWCLLNSLFLILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSP
FT                   KLGPGKGHQGFGVLSVILANHAIKLLTSLFQDLQVEALHKGWETDGPPAALSIMAQSTS
FT                   IQRIQRLIDSVPLMNLLLTLLSTSYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSS
FT                   TEEDSSQDDDSEPILGQWFEETISPSKEKAAPPPPPPPPPLESSPRVKSPSKQAPGEKG
FT                   NILASRKDPELFLGLASNILNFITSSMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVD
FT                   KDGLKGSSDEEFAAALYHFNHSLVTSDLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQS
FT                   LSVLSRLLLIWQHKASAQGDPDVPECLKVWDRFLSTMKQNALQGVVPSETEDLNVEHLQ
FT                   MLLLIFHNFTETGRRAILSLFVQIIQELSVNMDAQMRFVPLILARLLLIFDYLLHQYSK
FT                   APVYLFEQVQHNLLSPPFGWASGSQDSNSRRATTPLYHGFKEVEENWSKHFSSDAVPHP
FT                   RFYCVLSPEASEDDLNRLDSVACDVLFSKLVKYDELYAALTALLAAGSQLDTVRRKENK
FT                   NVTALEACALQYYFLILWRILGILPPSKTYINQLSMNSPEMSECDILHTLRWSSRLRIS
FT                   SYVNWIKDHLIKQGMKAEHASSLLELASTTKCSSVKYDVEIVEEYFARQISSFCSIDCT
FT                   TILQLHEIPSLQSIYTLDAAISKVQVSLDEHFSKMAAETDPHKSSEITKNLLPATLQLI
FT                   DTYASFTRAYLLQNFNEEGTTEKPSKEKLQGFAAVLAIGSSRCKANTLGPTLVQNLPSS
FT                   VQTVCESWNNINTNEFPNIGSWRNAFANDTIPSESYISAVQAAHLGTLCSQSLPLAASL
FT                   KHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLLESSTESVAEISSNSLERILGPAES
FT                   DEFLARVYEKLITGCYNILANHADPNSGLDESILEECLQYLEKQLESSQARKAMEEFFS
FT                   DSGELVQIMMATANENLSAKFCNRVLKFFTKLFQLTEKSPNPSLLHLCGSLAQLACVEP
FT                   VRLQAWLTRMTTSPPKDSDQLDVIQENRQLLQLLTTYIVRENSQVGEGVCAVLLGTLTP
FT                   MATEMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAAVDWLSRCKKYLSQKNVVEK
FT                   LNANVMHGKHVMILECTCHIMSYLADVTNALSQSNGQGPSHLSVDGEERAIEVDSDWVE
FT                   ELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKV
FT                   CHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQSEPRISESLV
FT                   RHASTSSPADKAKVTISDGKVADEEKPKKSSLCRTVEGCREELQNQANFSFAPLVLDML
FT                   NFLMDAIQTNFQQASAVGSSSRAQQALSELHTVEKAVEMTDQLMVPTLGSQEGAFENVR
FT                   MNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKITVLQLSALLKQA
FT                   DSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVL
FT                   HPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLCVDALSPTFYFLLPSSKIRDVTF
FT                   LFNEEGKNIIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDLKDSNSQVAGGG
FT                   VSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVLQLFPINIKSSNGGSKTSPALCQWSE
FT                   VMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHTACNEQQRT
FT                   TMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATISKAPSQMT"
FT   gene            complement(2347385..2381459)
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /note="gene_id=hCG41083.3"
FT   mRNA            complement(join(2347385..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361253,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369061..2369225,2369741..2369908,2370939..2371065,
FT                   2372268..2372396,2373537..2373630,2373873..2373938,
FT                   2374829..2374953,2381337..2381459))
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, transcript variant hCT32353"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT32353.3; splice
FT                   donor-acceptor pairs covered / total pairs = 18/21; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2347385..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361346,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369154..2369225,2369741..2369908,2370220..2370369,
FT                   2370939..2371065,2372268..2372396,2373537..2373630,
FT                   2373873..2373938,2374829..2374953,2381337..2381459))
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, transcript variant hCT1955051"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT1955051.1;
FT                   splice donor-acceptor pairs covered / total pairs = 22/22;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2348015..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361346,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369154..2369225,2369741..2369908,2370220..2370369,
FT                   2370939..2371065,2372268..2372396,2373537..2373630,
FT                   2374829..2374953,2381337..2381444))
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, transcript variant hCT2357806"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT2357806.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(2349227..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361346,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369154..2369225,2369741..2369908,2370220..2370369,
FT                   2370939..2371065,2372268..2372396,2373537..2373630,
FT                   2374829..2374953,2381337..2381431))
FT                   /codon_start=1
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, isoform CRA_b"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT2357806.0
FT                   protein_id=hCP1923069.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8N766"
FT                   /db_xref="HGNC:HGNC:28957"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="InterPro:IPR027295"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N766"
FT                   /protein_id="EAW94871.1"
FT                   /translation="MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASL
FT                   EFSPGSKKLVVATEKNVIAALNSRTGEIYVITVSNGGRIMRSWETNIGGLNWEITLDSG
FT                   SFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGV
FT                   VWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRS
FT                   LQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALL
FT                   QYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKSSS
FT                   KDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRA
FT                   LVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
FT                   LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMV
FT                   TASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGM
FT                   SSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRN
FT                   VLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSS
FT                   EHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQ
FT                   KKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVL
FT                   QQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREE
FT                   NLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQ
FT                   FDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR"
FT   CDS             complement(join(2349227..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361253,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369061..2369225,2369741..2369908,2370939..2371065,
FT                   2372268..2372396,2373537..2373630,2373873..2373938,
FT                   2374829..2374953,2381337..2381431))
FT                   /codon_start=1
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, isoform CRA_a"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT32353.3
FT                   protein_id=hCP50912.2 isoform=CRA_a"
FT                   /protein_id="EAW94870.1"
FT                   /translation="MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASL
FT                   EFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGG
FT                   RIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKW
FT                   VEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQSLDLEFGSGF
FT                   QPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKT
FT                   VAAVMACRNEVVSIENNSQHLGFSFLVSTRNPENQKSGHIDLQKSSSSEDGSMGSFSEK
FT                   SSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVG
FT                   YRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKA
FT                   DGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMM
FT                   VMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKS
FT                   LLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYR
FT                   LRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVV
FT                   TESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRN
FT                   EFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLL
FT                   IGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRG
FT                   IYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITK
FT                   RLAQVKLLNRAWR"
FT   CDS             complement(join(2349227..2349406,2349493..2349622,
FT                   2350688..2350772,2352548..2352758,2353320..2353493,
FT                   2357237..2357374,2360768..2360887,2361185..2361346,
FT                   2362548..2362697,2362860..2363059,2365054..2365176,
FT                   2367065..2367161,2367940..2368062,2368718..2368780,
FT                   2369154..2369225,2369741..2369908,2370220..2370369,
FT                   2370939..2371065,2372268..2372396,2373537..2373630,
FT                   2373873..2373938,2374829..2374953,2381337..2381431))
FT                   /codon_start=1
FT                   /gene="KIAA0090"
FT                   /locus_tag="hCG_41083"
FT                   /product="KIAA0090, isoform CRA_c"
FT                   /note="gene_id=hCG41083.3 transcript_id=hCT1955051.1
FT                   protein_id=hCP1765602.1 isoform=CRA_c"
FT                   /protein_id="EAW94872.1"
FT                   /translation="MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASL
FT                   EFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGG
FT                   RIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKW
FT                   VEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQH
FT                   LSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQP
FT                   NPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRN
FT                   EVQKSSSSEDGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSG
FT                   TRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMV
FT                   DLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIK
FT                   NEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQR
FT                   TTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQD
FT                   YAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTEL
FT                   SWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHE
FT                   RTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYE
FT                   GTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAIL
FT                   SLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLE
FT                   STCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLN
FT                   RAWR"
FT   gene            <2381430..2390047
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /note="gene_id=hCG41080.3"
FT   mRNA            join(<2381430..2382015,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2388895,2388984..2389337)
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, transcript
FT                   variant hCT1966273"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT1966273.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/8;
FT                   created on 26-AUG-2002"
FT   CDS             join(2381430..2382015,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2388751)
FT                   /codon_start=1
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT1966273.1
FT                   protein_id=hCP1780768.1 isoform=CRA_b"
FT                   /protein_id="EAW94874.1"
FT                   /translation="MMRAHAPPTAVPACTAPRAPPPRDHRAGIAREALGRTGRSGFRDC
FT                   LGTREVALQAREKAQAAAWQGEAGCSAHWVRHTRGAAPEGRPRVPRAAGVLTGCTVFRR
FT                   TWIQRDAQIQARQERWAKGESGPWGELRGLATQPAVRASGRRGRRLERQDILEVFRCLA
FT                   ASWNGGFGAVKPPEVADARSGLGSGDSFCLVSVSLTKTAKKGLELKQNLIEELRKCVDT
FT                   YKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKR
FT                   LRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLR
FT                   QLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSG
FT                   RFQQMGDDLPESASESTEESDSEDDD"
FT   mRNA            join(2381511..2381785,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2388898,2389963..2390047)
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, transcript
FT                   variant hCT1955050"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT1955050.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2381511..2381785,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2389367)
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, transcript
FT                   variant hCT32350"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT32350.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   CDS             join(2381758..2381785,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2388751)
FT                   /codon_start=1
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT1955050.1
FT                   protein_id=hCP1765604.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9UKD2"
FT                   /db_xref="HGNC:HGNC:18477"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UKD2"
FT                   /protein_id="EAW94873.1"
FT                   /translation="MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSV
FT                   ANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLF
FT                   TNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALK
FT                   RGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDL
FT                   PESASESTEESDSEDDD"
FT   CDS             join(2381758..2381785,2384704..2384762,2385869..2385972,
FT                   2386985..2387066,2387375..2387442,2387754..2387905,
FT                   2388398..2388474,2388602..2388751)
FT                   /codon_start=1
FT                   /gene="C1orf33"
FT                   /locus_tag="hCG_41080"
FT                   /product="chromosome 1 open reading frame 33, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG41080.3 transcript_id=hCT32350.3
FT                   protein_id=hCP50921.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE1"
FT                   /protein_id="EAW94875.1"
FT                   /translation="MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSV
FT                   ANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLF
FT                   TNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALK
FT                   RGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDL
FT                   PESASESTEESDSEDDD"
FT   gene            complement(2395905..2404555)
FT                   /gene="AFAR3"
FT                   /locus_tag="hCG_41082"
FT                   /note="gene_id=hCG41082.4"
FT   mRNA            complement(join(2395905..2397382,2398493..2398622,
FT                   2400372..2400476,2400669..2400856,2403782..2403862))
FT                   /gene="AFAR3"
FT                   /locus_tag="hCG_41082"
FT                   /product="aflatoxin B1 aldehyde reductase 3, transcript
FT                   variant hCT2357804"
FT                   /note="gene_id=hCG41082.4 transcript_id=hCT2357804.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(2396625..2397382,2398493..2398622,
FT                   2399193..2399292,2399504..2399600,2400372..2400476,
FT                   2400669..2400856,2403782..2404555))
FT                   /gene="AFAR3"
FT                   /locus_tag="hCG_41082"
FT                   /product="aflatoxin B1 aldehyde reductase 3, transcript
FT                   variant hCT32352"
FT                   /note="gene_id=hCG41082.4 transcript_id=hCT32352.3; splice
FT                   donor-acceptor pairs covered / total pairs = 6/6; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(2397221..2397382,2398493..2398622,
FT                   2400372..2400476,2400669..2400733))
FT                   /codon_start=1
FT                   /gene="AFAR3"
FT                   /locus_tag="hCG_41082"
FT                   /product="aflatoxin B1 aldehyde reductase 3, isoform CRA_b"
FT                   /note="gene_id=hCG41082.4 transcript_id=hCT2357804.0
FT                   protein_id=hCP1923068.0 isoform=CRA_b"
FT                   /protein_id="EAW94877.1"
FT                   /translation="MHLTTAPRWKRHCVPATSCTRRASSWSLASPTMPPGKWPRSVPSA
FT                   RATAGSCPLCTSFWKEHHFEGIALVEKALQATYGASAPSMTSAALRWMYHHSQLQGAHG
FT                   DAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLFAHECPNYFI"
FT   CDS             complement(join(2397221..2397382,2398493..2398622,
FT                   2399193..2399292,2399504..2399597))
FT                   /codon_start=1
FT                   /gene="AFAR3"
FT                   /locus_tag="hCG_41082"
FT                   /product="aflatoxin B1 aldehyde reductase 3, isoform CRA_a"
FT                   /note="gene_id=hCG41082.4 transcript_id=hCT32352.3
FT                   protein_id=hCP50911.3 isoform=CRA_a"
FT                   /protein_id="EAW94876.1"
FT                   /translation="MYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKD
FT                   GKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVEKALQATYGASAPSMTSAALRWMYHH
FT                   SQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLFAHECPNYFI"
FT   gene            complement(2412151..2419163)
FT                   /gene="AKR7A3"
FT                   /locus_tag="hCG_41079"
FT                   /note="gene_id=hCG41079.2"
FT   mRNA            complement(join(2412151..2412820,2413924..2414053,
FT                   2414614..2414713,2414946..2415042,2415816..2415920,
FT                   2416113..2416300,2418424..2419163))
FT                   /gene="AKR7A3"
FT                   /locus_tag="hCG_41079"
FT                   /product="aldo-keto reductase family 7, member A3
FT                   (aflatoxin aldehyde reductase), transcript variant
FT                   hCT32349"
FT                   /note="gene_id=hCG41079.2 transcript_id=hCT32349.3; splice
FT                   donor-acceptor pairs covered / total pairs = 6/6; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2412151..2412820,2413924..2414053,
FT                   2414614..2414785,2414946..2415042,2415816..2415920,
FT                   2416113..2416300,2418424..2419163))
FT                   /gene="AKR7A3"
FT                   /locus_tag="hCG_41079"
FT                   /product="aldo-keto reductase family 7, member A3
FT                   (aflatoxin aldehyde reductase), transcript variant
FT                   hCT2258778"
FT                   /note="gene_id=hCG41079.2 transcript_id=hCT2258778.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2412659..2412820,2413924..2414053,
FT                   2414614..2414713,2414946..2415042,2415816..2415920,
FT                   2416113..2416300,2418424..2418637))
FT                   /codon_start=1
FT                   /gene="AKR7A3"
FT                   /locus_tag="hCG_41079"
FT                   /product="aldo-keto reductase family 7, member A3
FT                   (aflatoxin aldehyde reductase), isoform CRA_a"
FT                   /note="gene_id=hCG41079.2 transcript_id=hCT32349.3
FT                   protein_id=hCP50919.2 isoform=CRA_a"
FT                   /protein_id="EAW94878.1"
FT                   /translation="MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDT
FT                   AFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQC
FT                   PRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWI
FT                   LPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGR
FT                   FFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAH
FT                   GDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFR"
FT   CDS             complement(join(2412659..2412820,2413924..2414053,
FT                   2414614..2414785,2414946..2415042,2415816..2415920,
FT                   2416113..2416300,2418424..2418637))
FT                   /codon_start=1
FT                   /gene="AKR7A3"
FT                   /locus_tag="hCG_41079"
FT                   /product="aldo-keto reductase family 7, member A3
FT                   (aflatoxin aldehyde reductase), isoform CRA_b"
FT                   /note="gene_id=hCG41079.2 transcript_id=hCT2258778.0
FT                   protein_id=hCP1855020.0 isoform=CRA_b"
FT                   /protein_id="EAW94879.1"
FT                   /translation="MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDT
FT                   AFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQC
FT                   PRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWI
FT                   LPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLADQSPEGCGSFWGTLGPGADCC
FT                   FPSGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYG
FT                   ASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFN
FT                   QAWHLVAHECPNYFR"
FT   gene            complement(2427146..>2430119)
FT                   /locus_tag="hCG_2039078"
FT                   /note="gene_id=hCG2039078.0"
FT   mRNA            complement(join(2427146..2429109,2429817..>2430119))
FT                   /locus_tag="hCG_2039078"
FT                   /product="hCG2039078"
FT                   /note="gene_id=hCG2039078.0 transcript_id=hCT2343568.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 09-APR-2003"
FT   CDS             complement(2428090..>2428341)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2039078"
FT                   /product="hCG2039078"
FT                   /note="gene_id=hCG2039078.0 transcript_id=hCT2343568.0
FT                   protein_id=hCP1908953.0"
FT                   /protein_id="EAW94880.1"
FT                   /translation="LTHTFTRSSPMIGRPQVEEQGSQWWISLSPKTSKVGKPTVQPSVC
FT                   GQRPESPRQTNGVSPRVQKLKNLEFHVQGQEASSTGEK"
FT   gene            complement(2432475..2442055)
FT                   /gene="AKR7A2"
FT                   /locus_tag="hCG_40469"
FT                   /note="gene_id=hCG40469.2"
FT   mRNA            complement(join(2432475..2434306,2435938..2436067,
FT                   2436923..2437022,2437235..2437331,2438079..2438183,
FT                   2438376..2438563,2441748..2442055))
FT                   /gene="AKR7A2"
FT                   /locus_tag="hCG_40469"
FT                   /product="aldo-keto reductase family 7, member A2
FT                   (aflatoxin aldehyde reductase)"
FT                   /note="gene_id=hCG40469.2 transcript_id=hCT31728.2; splice
FT                   donor-acceptor pairs covered / total pairs = 6/6; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(2434145..2434306,2435938..2436067,
FT                   2436923..2437022,2437235..2437331,2438079..2438183,
FT                   2438376..2438563,2441748..2442045))
FT                   /codon_start=1
FT                   /gene="AKR7A2"
FT                   /locus_tag="hCG_40469"
FT                   /product="aldo-keto reductase family 7, member A2
FT                   (aflatoxin aldehyde reductase)"
FT                   /note="gene_id=hCG40469.2 transcript_id=hCT31728.2
FT                   protein_id=hCP50920.3"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:V9HWA2"
FT                   /protein_id="EAW94881.1"
FT                   /translation="MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTM
FT                   EMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIAT
FT                   KANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEG
FT                   KFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRF
FT                   YAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQ
FT                   AAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVV
FT                   DAFNQAWHLVAHECPNYFR"
FT   gene            2442155..2462378
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /note="gene_id=hCG41084.3"
FT   mRNA            join(2442155..2442296,2442667..2442827,2447537..2447778,
FT                   2454572..2454701,2455434..2455521,2456184..2456326,
FT                   2456470..2456562,2457166..2457351,2458523..2458879,
FT                   2461174..2462378)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT32354"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT32354.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   mRNA            join(2442266..2442296,2442667..2442827,2447537..2447778,
FT                   2454572..2454701,2455434..2455521,2456184..2456326,
FT                   2456470..2456562,2457166..2457351,2458523..2459250)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT2357810"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357810.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 15-JUL-2004"
FT   mRNA            join(2442266..2442296,2442667..2442827,2454572..2454701,
FT                   2455465..2455521,2456184..2456326,2456470..2456562,
FT                   2457166..2457351,2458523..2459232)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT2357807"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357807.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   mRNA            join(2442266..2442827,2447537..2447778,2454572..2454701,
FT                   2455434..2455521,2456184..2456326,2456470..2456562,
FT                   2457166..2457351,2458523..2459231)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT2357809"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357809.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   mRNA            join(2442279..2442296,2442667..2442827,2454572..2454701,
FT                   2455434..2455521,2456184..2456326,2456470..2456562,
FT                   2457166..2457351,2458523..2459250)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT2357808"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357808.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   mRNA            join(2442663..2442827,2454572..2454701,2455434..2455521,
FT                   2456184..2456326,2456470..2456562,2457166..2457351,
FT                   2458523..2458879,2461174..2462378)
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   hCT1955052"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT1955052.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(2447615..2447778,2454572..2454701,2455434..2455521,
FT                   2456184..2456326,2456470..2456562,2457166..2457351,
FT                   2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_c"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357810.0
FT                   protein_id=hCP1923073.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA97"
FT                   /protein_id="EAW94884.1"
FT                   /translation="MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLIS
FT                   ILCFAASTFPQFIKAYKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVY
FT                   YVLADLVMLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFR
FT                   GRALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFAL
FT                   VMLGNTLYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTA
FT                   ASELEPLLPS"
FT   CDS             join(2447615..2447778,2454572..2454701,2455434..2455521,
FT                   2456184..2456326,2456470..2456562,2457166..2457351,
FT                   2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_c"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT32354.3
FT                   protein_id=hCP50913.2 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA97"
FT                   /protein_id="EAW94885.1"
FT                   /translation="MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLIS
FT                   ILCFAASTFPQFIKAYKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVY
FT                   YVLADLVMLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFR
FT                   GRALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFAL
FT                   VMLGNTLYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTA
FT                   ASELEPLLPS"
FT   CDS             join(2447615..2447778,2454572..2454701,2455434..2455521,
FT                   2456184..2456326,2456470..2456562,2457166..2457351,
FT                   2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_c"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357809.0
FT                   protein_id=hCP1923072.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA97"
FT                   /protein_id="EAW94887.1"
FT                   /translation="MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLIS
FT                   ILCFAASTFPQFIKAYKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVY
FT                   YVLADLVMLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFR
FT                   GRALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFAL
FT                   VMLGNTLYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTA
FT                   ASELEPLLPS"
FT   CDS             join(2454603..2454701,2455434..2455521,2456184..2456326,
FT                   2456470..2456562,2457166..2457351,2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_b"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357808.0
FT                   protein_id=hCP1923071.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA1"
FT                   /protein_id="EAW94883.1"
FT                   /translation="MDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADL
FT                   VMLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLS
FT                   VESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNT
FT                   LYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEP
FT                   LLPS"
FT   CDS             join(2454603..2454701,2455434..2455521,2456184..2456326,
FT                   2456470..2456562,2457166..2457351,2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_b"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT1955052.1
FT                   protein_id=hCP1765618.1 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA1"
FT                   /protein_id="EAW94886.1"
FT                   /translation="MDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADL
FT                   VMLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLS
FT                   VESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNT
FT                   LYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEP
FT                   LLPS"
FT   CDS             join(2455473..2455521,2456184..2456326,2456470..2456562,
FT                   2457166..2457351,2458523..2458594)
FT                   /codon_start=1
FT                   /gene="PQLC2"
FT                   /locus_tag="hCG_41084"
FT                   /product="PQ loop repeat containing 2, isoform CRA_a"
FT                   /note="gene_id=hCG41084.3 transcript_id=hCT2357807.0
FT                   protein_id=hCP1923070.0 isoform=CRA_a"
FT                   /protein_id="EAW94882.1"
FT                   /translation="MLTLYFYYKFRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVA
FT                   APREAFRGRALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGI
FT                   SYSLFALVMLGNTLYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFL
FT                   VYRRSTAASELEPLLPS"
FT   gene            complement(2468735..2615483)
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /note="gene_id=hCG41078.3"
FT   mRNA            complement(join(2468735..2469577,2474318..2474394,
FT                   2475147..2475212,2486599..2486715,2487391..2487532,
FT                   2508512..2508625,2515477..2515598,2549583..2549672,
FT                   2615287..2615483))
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant hCT1955049"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT1955049.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2468735..2469228,2469411..2469577,
FT                   2472712..2472824,2474318..2474394,2475147..2475212,
FT                   2486599..2486715,2487391..2487532,2508512..2508625,
FT                   2515477..2515598,2549583..2549680,2615296..2615370))
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant hCT2258773"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258773.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2469052..2469172,2469278..2469577,
FT                   2474318..2474394,2475147..2475212,2486599..2486715,
FT                   2487391..2487532,2508512..2508625,2515477..2515598,
FT                   2549583..2549680,2615296..2615370))
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant hCT2258760"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258760.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2469052..2469172,2469278..2469577,
FT                   2474318..2474394,2475147..2475212,2486599..2486715,
FT                   2487391..2487532,2508512..2508625,2515477..2515598,
FT                   2549583..2549672,2614041..2614466))
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant hCT2258766"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258766.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2469490..2469577,2474318..2474394,
FT                   2475147..2475212,2486599..2486715,2487391..2487532,
FT                   2508512..2508625,2515477..2515598,2549583..2549672,
FT                   2615287..2615289))
FT                   /codon_start=1
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_c"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT1955049.1
FT                   protein_id=hCP1765701.0 isoform=CRA_c"
FT                   /db_xref="GOA:P47756"
FT                   /db_xref="HGNC:HGNC:1491"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47756"
FT                   /protein_id="EAW94890.1"
FT                   /translation="MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQ
FT                   PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAF
FT                   DQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGR
FT                   TAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMEN
FT                   KIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC"
FT   CDS             complement(join(2469490..2469577,2474318..2474394,
FT                   2475147..2475212,2486599..2486715,2487391..2487532,
FT                   2508512..2508625,2515477..2515598,2549583..2549672,
FT                   2614041..2614130))
FT                   /codon_start=1
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_d"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258766.0
FT                   protein_id=hCP1855039.0 isoform=CRA_d"
FT                   /db_xref="GOA:B1AK88"
FT                   /db_xref="HGNC:HGNC:1491"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniProtKB/TrEMBL:B1AK88"
FT                   /protein_id="EAW94891.1"
FT                   /translation="MHPSRRSLPFPLNCQLARVGTADYGSPSDQSDQQLDCALDLMRRL
FT                   PPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPW
FT                   SNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILI
FT                   KKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSL
FT                   TRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADK
FT                   SKQEALKNDLVEALKRKQQC"
FT   CDS             complement(join(2469490..2469577,2474318..2474394,
FT                   2475147..2475212,2486599..2486715,2487391..2487532,
FT                   2508512..2508625,2515477..2515598,2549583..2549639))
FT                   /codon_start=1
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258760.0
FT                   protein_id=hCP1855037.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AK87"
FT                   /db_xref="HGNC:HGNC:1491"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="UniProtKB/TrEMBL:B1AK87"
FT                   /protein_id="EAW94888.1"
FT                   /translation="MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGK
FT                   DYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGV
FT                   SSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML
FT                   WLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFG
FT                   KTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC"
FT   CDS             complement(join(2472722..2472824,2474318..2474394,
FT                   2475147..2475212,2486599..2486715,2487391..2487532,
FT                   2508512..2508625,2515477..2515598,2549583..2549639))
FT                   /codon_start=1
FT                   /gene="CAPZB"
FT                   /locus_tag="hCG_41078"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=hCG41078.3 transcript_id=hCT2258773.0
FT                   protein_id=hCP1855036.0 isoform=CRA_b"
FT                   /protein_id="EAW94889.1"
FT                   /translation="MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGK
FT                   DYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGV
FT                   SSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML
FT                   WLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFG
FT                   KTKDIVNGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN"
FT   gene            complement(2721644..>2726671)
FT                   /locus_tag="hCG_2041571"
FT                   /note="gene_id=hCG2041571.0"
FT   mRNA            complement(join(2721644..2721727,2726552..>2726671))
FT                   /locus_tag="hCG_2041571"
FT                   /product="hCG2041571"
FT                   /note="gene_id=hCG2041571.0 transcript_id=hCT2346802.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(2721693..2721727,2726552..>2726669))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041571"
FT                   /product="hCG2041571"
FT                   /note="gene_id=hCG2041571.0 transcript_id=hCT2346802.0
FT                   protein_id=hCP1912671.0"
FT                   /protein_id="EAW94892.1"
FT                   /translation="LRLWVCEADSFLGVTPSRDQAFPPHQSATLALEIPRAREGCKFSF
FT                   LNVAD"
FT   gene            2726843..2756464
FT                   /gene="C1orf151"
FT                   /locus_tag="hCG_2040001"
FT                   /note="gene_id=hCG2040001.0"
FT   mRNA            join(2726843..2726951,2747104..2747182,2751946..2751993,
FT                   2753320..2753429,2756233..2756464)
FT                   /gene="C1orf151"
FT                   /locus_tag="hCG_2040001"
FT                   /product="chromosome 1 open reading frame 151"
FT                   /note="gene_id=hCG2040001.0 transcript_id=hCT2344965.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-MAY-2003"
FT   gene            2737928..2738455
FT                   /pseudo
FT                   /locus_tag="hCG_1640289"
FT                   /note="gene_id=hCG1640289.5"
FT   mRNA            2737928..2738455
FT                   /pseudo
FT                   /locus_tag="hCG_1640289"
FT                   /note="gene_id=hCG1640289.5 transcript_id=hCT1640416.5;
FT                   overlap evidence=yes; created on 22-JAN-2004"
FT   CDS             join(2747143..2747182,2751946..2751993,2753320..2753429,
FT                   2756233..2756247)
FT                   /codon_start=1
FT                   /gene="C1orf151"
FT                   /locus_tag="hCG_2040001"
FT                   /product="chromosome 1 open reading frame 151"
FT                   /note="gene_id=hCG2040001.0 transcript_id=hCT2344965.0
FT                   protein_id=hCP1910250.0"
FT                   /protein_id="EAW94893.1"
FT                   /translation="MFQPLSSPDSHRKGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGM
FT                   AYSNCQHDFQAPYLLHGKYVKEQEQ"
FT   gene            2772951..2788160
FT                   /gene="NBL1"
FT                   /locus_tag="hCG_1983779"
FT                   /note="gene_id=hCG1983779.1"
FT   mRNA            join(2772951..2773100,2784717..2784905,2785029..2785140,
FT                   2786571..2788160)
FT                   /gene="NBL1"
FT                   /locus_tag="hCG_1983779"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1,
FT                   transcript variant hCT2257724"
FT                   /note="gene_id=hCG1983779.1 transcript_id=hCT2257724.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(2773015..2773100,2784717..2784905,2785029..2785140,
FT                   2786571..2786834)
FT                   /codon_start=1
FT                   /gene="NBL1"
FT                   /locus_tag="hCG_1983779"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1983779.1 transcript_id=hCT2257724.1
FT                   protein_id=hCP1855047.1 isoform=CRA_b"
FT                   /db_xref="GOA:P41271"
FT                   /db_xref="HGNC:HGNC:7650"
FT                   /db_xref="InterPro:IPR004133"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR016728"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41271"
FT                   /protein_id="EAW94895.1"
FT                   /translation="MPGNLMSQTSRAVSIWKFPAKLGKTHGHRALEATGMMLRVLVGAV
FT                   LPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVP
FT                   NTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPS
FT                   HEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED"
FT   mRNA            join(2773975..2774148,2784717..2784905,2785029..2785140,
FT                   2786571..2788160)
FT                   /gene="NBL1"
FT                   /locus_tag="hCG_1983779"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1,
FT                   transcript variant hCT2257722"
FT                   /note="gene_id=hCG1983779.1 transcript_id=hCT2257722.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(2784736..2784905,2785029..2785140,2786571..2786834)
FT                   /codon_start=1
FT                   /gene="NBL1"
FT                   /locus_tag="hCG_1983779"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1983779.1 transcript_id=hCT2257722.0
FT                   protein_id=hCP1855045.0 isoform=CRA_a"
FT                   /db_xref="GOA:P41271"
FT                   /db_xref="HGNC:HGNC:7650"
FT                   /db_xref="InterPro:IPR004133"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR016728"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41271"
FT                   /protein_id="EAW94894.1"
FT                   /translation="MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVG
FT                   HSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEE
FT                   VPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTP
FT                   EPEDPPGAPHTEEEGAED"
FT   gene            2794994..2810672
FT                   /gene="HTR6"
FT                   /locus_tag="hCG_37781"
FT                   /note="gene_id=hCG37781.2"
FT   mRNA            join(2794994..2796174,2808273..2808431,2808625..2810672)
FT                   /gene="HTR6"
FT                   /locus_tag="hCG_37781"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 6"
FT                   /note="gene_id=hCG37781.2 transcript_id=hCT29015.2; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 26-AUG-2002"
FT   CDS             join(2795461..2796174,2808273..2808431,2808625..2809074)
FT                   /codon_start=1
FT                   /gene="HTR6"
FT                   /locus_tag="hCG_37781"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 6"
FT                   /note="gene_id=hCG37781.2 transcript_id=hCT29015.2
FT                   protein_id=hCP47727.2"
FT                   /db_xref="GOA:P50406"
FT                   /db_xref="HGNC:HGNC:5301"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50406"
FT                   /protein_id="EAW94896.1"
FT                   /translation="MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANS
FT                   LLIALICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTA
FT                   FDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLL
FT                   LGWHELGHARPPVPGQCRLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQV
FT                   ASLTTGMASQASETLQVPRTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTW
FT                   LPFFVANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRC
FT                   PRERQASLASPSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLL
FT                   LPGEATQDPPLPTRAAAAVNFFNIDPAEPELRPHPLGIPTN"
FT   gene            complement(2811921..2929715)
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /note="gene_id=hCG37782.3"
FT   mRNA            complement(join(2811921..2813037,2875375..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910530,
FT                   2916791..2916882,2927903..2927984))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT2258749"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2258749.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2811921..2813151,2824137..2824254,
FT                   2830468..2830585,2867144..2867228,2869596..2869732,
FT                   2870549..2870713,2875304..2875423,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910530,2916791..2916882,
FT                   2917098..2917237,2919694..2919814,2927903..2927972))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT29016"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT29016.3; splice
FT                   donor-acceptor pairs covered / total pairs = 16/16; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2811949..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910530,2916791..2916882,
FT                   2929621..2929715))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT2258747"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2258747.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2811949..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2875304..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910530,
FT                   2916791..2916882,2929621..2929715))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT1955765"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT1955765.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2811949..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910530,2916791..2916882,
FT                   2928940..2929110))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT2357819"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357819.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(2811949..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2875304..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910530,
FT                   2916791..2916882,2928940..2929110))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT2357818"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357818.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(2811955..2813151,2824137..2824254,
FT                   2830468..2830585,2867144..2867228,2869596..2869732,
FT                   2870549..2870713,2875304..2875423,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910530,2916791..2916882,
FT                   2927903..2927981,2929621..2929685))
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant hCT2357820"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357820.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(2812336..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2258747.0
FT                   protein_id=hCP1855017.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA3"
FT                   /protein_id="EAW94897.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGTFSAPWAALAHSREQYCLAWEAKYLMEL
FT                   GNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEV
FT                   GKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEG
FT                   EAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLT
FT                   SVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSALESG
FT                   CPSGGPEGSLGPEAPTPALPWPQ"
FT   CDS             complement(join(2812336..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357819.0
FT                   protein_id=hCP1923060.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA3"
FT                   /protein_id="EAW94901.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGTFSAPWAALAHSREQYCLAWEAKYLMEL
FT                   GNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEV
FT                   GKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEG
FT                   EAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLT
FT                   SVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSALESG
FT                   CPSGGPEGSLGPEAPTPALPWPQ"
FT   CDS             complement(join(2812336..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2875304..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357818.0
FT                   protein_id=hCP1923059.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAD2"
FT                   /protein_id="EAW94898.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHITI
FT                   AVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEA
FT                   LKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVT
FT                   LIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIING
FT                   YCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKA
FT                   VGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSALESGCPSGGPEGSLGPEAPTPAL
FT                   PWPQ"
FT   CDS             complement(join(2812336..2812421,2812995..2813151,
FT                   2824137..2824254,2830468..2830585,2867144..2867228,
FT                   2869596..2869732,2870549..2870713,2875304..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT1955765.1
FT                   protein_id=hCP1765628.1 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAD2"
FT                   /protein_id="EAW94899.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHITI
FT                   AVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEA
FT                   LKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVT
FT                   LIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIING
FT                   YCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKA
FT                   VGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSALESGCPSGGPEGSLGPEAPTPAL
FT                   PWPQ"
FT   CDS             complement(join(2812747..2813151,2824137..2824254,
FT                   2830468..2830585,2867144..2867228,2869596..2869732,
FT                   2870549..2870713,2875304..2875423,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2357820.0
FT                   protein_id=hCP1923061.0 isoform=CRA_d"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA95"
FT                   /protein_id="EAW94902.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHITI
FT                   AVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEA
FT                   LKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVT
FT                   LIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIING
FT                   YCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKA
FT                   VGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVGQTQGPISGDTSKLAMS
FT                   TDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPSTGLD"
FT   CDS             complement(join(2812747..2813151,2824137..2824254,
FT                   2830468..2830585,2867144..2867228,2869596..2869732,
FT                   2870549..2870713,2875304..2875423,2876228..2876371,
FT                   2876935..2877032,2885406..2885538,2900306..2900333,
FT                   2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT29016.3
FT                   protein_id=hCP47728.2 isoform=CRA_d"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA95"
FT                   /protein_id="EAW94903.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHITI
FT                   AVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEA
FT                   LKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVT
FT                   LIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIING
FT                   YCRGDWLLSFVYRTSSVQLHVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKA
FT                   VGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVGQTQGPISGDTSKLAMS
FT                   TDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPSTGLD"
FT   CDS             complement(join(2812893..2813037,2875375..2875423,
FT                   2876228..2876371,2876935..2877032,2885406..2885538,
FT                   2900306..2900333,2901072..2901246,2910344..2910522))
FT                   /codon_start=1
FT                   /gene="TMCO4"
FT                   /locus_tag="hCG_37782"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG37782.3 transcript_id=hCT2258749.0
FT                   protein_id=hCP1855013.0 isoform=CRA_c"
FT                   /protein_id="EAW94900.1"
FT                   /translation="MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAAL
FT                   CGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILL
FT                   KDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESL
FT                   KEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATI
FT                   IGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPPRSLARQQLPP
FT                   HQARPPTRLGKPRVPYLETPPNWPCPQTPAKPRCQ"
FT   gene            complement(2943794..2945044)
FT                   /gene="RNF186"
FT                   /locus_tag="hCG_1643622"
FT                   /note="gene_id=hCG1643622.2"
FT   mRNA            complement(2943794..2945044)
FT                   /gene="RNF186"
FT                   /locus_tag="hCG_1643622"
FT                   /product="ring finger protein 186"
FT                   /note="gene_id=hCG1643622.2 transcript_id=hCT1643749.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2944184..2944867)
FT                   /codon_start=1
FT                   /gene="RNF186"
FT                   /locus_tag="hCG_1643622"
FT                   /product="ring finger protein 186"
FT                   /note="gene_id=hCG1643622.2 transcript_id=hCT1643749.1
FT                   protein_id=hCP1637034.2"
FT                   /protein_id="EAW94904.1"
FT                   /translation="MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCRE
FT                   PYSCPRLPKLLACQHAFCAICLKLLLCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEA
FT                   VVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHVAARRLAAHLLLLA
FT                   LLIILIGPFIYPGVLRWVLTFIIALALLMSTLFCCLPSTRGSCWPSSRTLFCREQKHSH
FT                   ISSIA"
FT   gene            3012176..3042718
FT                   /locus_tag="hCG_38178"
FT                   /note="gene_id=hCG38178.3"
FT   mRNA            join(3012176..3012509,3020160..3020308,3024143..3024255,
FT                   3027313..3027435,3034040..3034171,3034664..3034760,
FT                   3036205..3036389,3037343..3042718)
FT                   /locus_tag="hCG_38178"
FT                   /product="hCG38178"
FT                   /note="gene_id=hCG38178.3 transcript_id=hCT29417.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   CDS             join(3012289..3012509,3020160..3020308,3024143..3024255,
FT                   3027313..3027435,3034040..3034171,3034664..3034760,
FT                   3036205..3036389,3037343..3037519)
FT                   /codon_start=1
FT                   /locus_tag="hCG_38178"
FT                   /product="hCG38178"
FT                   /note="gene_id=hCG38178.3 transcript_id=hCT29417.3
FT                   protein_id=hCP48100.3"
FT                   /protein_id="EAW94905.1"
FT                   /translation="MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGG
FT                   GGGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMI
FT                   KQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIR
FT                   GTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDESNKREKIKTKGM
FT                   DSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAE
FT                   ENLEPSGRVLKQCGPLWEEGGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAK
FT                   VTNKQRREQQWMEKKKRQEERHRHKALESRGSHRDNNRSEAEANTQVTLVKTFAALNI"
FT   gene            complement(<3050079..3053389)
FT                   /gene="PLA2G2E"
FT                   /locus_tag="hCG_38176"
FT                   /note="gene_id=hCG38176.2"
FT   mRNA            complement(join(<3050079..3050221,3052070..3052176,
FT                   3052389..3052527,3053292..3053389))
FT                   /gene="PLA2G2E"
FT                   /locus_tag="hCG_38176"
FT                   /product="phospholipase A2, group IIE"
FT                   /note="gene_id=hCG38176.2 transcript_id=hCT29415.1; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(3050079..3050221,3052070..3052176,
FT                   3052389..3052527,3053292..3053367))
FT                   /codon_start=1
FT                   /gene="PLA2G2E"
FT                   /locus_tag="hCG_38176"
FT                   /product="phospholipase A2, group IIE"
FT                   /note="gene_id=hCG38176.2 transcript_id=hCT29415.1
FT                   protein_id=hCP48098.2"
FT                   /protein_id="EAW94906.1"
FT                   /translation="MLLVHLPSPQPGMKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTG
FT                   KSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERG
FT                   IFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC"
FT   gene            complement(3105182..3110213)
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /note="gene_id=hCG1738998.2"
FT   mRNA            complement(join(3105182..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108627,3110109..3110213))
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), transcript variant hCT1955720"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955720.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3105182..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108627,3109327..3109437,
FT                   3110109..3110164))
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), transcript variant hCT1777074"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1777074.2;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3105182..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108664))
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), transcript variant hCT1955721"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955721.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3105356..3105447,3105501..3105583,
FT                   3107757..3107869,3108128..3108272,3108482..3108627,
FT                   3110109..3110213))
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), transcript variant hCT1955722"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955722.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3105449..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108521))
FT                   /codon_start=1
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), isoform CRA_a"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955720.1
FT                   protein_id=hCP1765658.0 isoform=CRA_a"
FT                   /db_xref="GOA:P14555"
FT                   /db_xref="HGNC:HGNC:9031"
FT                   /db_xref="InterPro:IPR001211"
FT                   /db_xref="InterPro:IPR013090"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="PDB:1AYP"
FT                   /db_xref="PDB:1BBC"
FT                   /db_xref="PDB:1DB4"
FT                   /db_xref="PDB:1DB5"
FT                   /db_xref="PDB:1DCY"
FT                   /db_xref="PDB:1J1A"
FT                   /db_xref="PDB:1KQU"
FT                   /db_xref="PDB:1KVO"
FT                   /db_xref="PDB:1N28"
FT                   /db_xref="PDB:1N29"
FT                   /db_xref="PDB:1POD"
FT                   /db_xref="PDB:1POE"
FT                   /db_xref="PDB:2GNY"
FT                   /db_xref="PDB:3U8B"
FT                   /db_xref="PDB:3U8D"
FT                   /db_xref="PDB:3U8H"
FT                   /db_xref="PDB:3U8I"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14555"
FT                   /protein_id="EAW94907.1"
FT                   /translation="MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYG
FT                   CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCR
FT                   SQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC"
FT   CDS             complement(join(3105449..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108521))
FT                   /codon_start=1
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), isoform CRA_a"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955721.1
FT                   protein_id=hCP1765663.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA96"
FT                   /protein_id="EAW94908.1"
FT                   /translation="MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYG
FT                   CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCR
FT                   SQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC"
FT   CDS             complement(join(3105449..3105591,3107763..3107869,
FT                   3108128..3108272,3108482..3108521))
FT                   /codon_start=1
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), isoform CRA_a"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1777074.2
FT                   protein_id=hCP1713331.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RA96"
FT                   /protein_id="EAW94909.1"
FT                   /translation="MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYG
FT                   CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCR
FT                   SQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC"
FT   CDS             complement(join(3105558..3105583,3107757..3107869,
FT                   3108128..3108272,3108482..3108521))
FT                   /codon_start=1
FT                   /gene="PLA2G2A"
FT                   /locus_tag="hCG_1738998"
FT                   /product="phospholipase A2, group IIA (platelets, synovial
FT                   fluid), isoform CRA_b"
FT                   /note="gene_id=hCG1738998.2 transcript_id=hCT1955722.1
FT                   protein_id=hCP1765670.0 isoform=CRA_b"
FT                   /protein_id="EAW94910.1"
FT                   /translation="MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYG
FT                   CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCGKRLLQK
FT                   STV"
FT   gene            3154272..3217255
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /note="gene_id=hCG38174.4"
FT   mRNA            join(3154272..3154802,3172190..3172229,3180870..3180917,
FT                   3185710..3185770,3192099..3192204,3194949..3195108,
FT                   3210877..3210926,3212139..3212283,3215845..3215951,
FT                   3216624..3217246)
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   hCT2357797"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT2357797.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 15-JUL-2004"
FT   mRNA            join(3154620..3154802,3185710..3185770,3189559..3189677,
FT                   3194949..3195009,3216911..3217223)
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   hCT1955766"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT1955766.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(3154737..3154802,3185710..3185757)
FT                   /codon_start=1
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, isoform CRA_a"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT1955766.1
FT                   protein_id=hCP1765642.1 isoform=CRA_a"
FT                   /protein_id="EAW94911.1"
FT                   /translation="MCFWMTAWTREFSFWETDWAMKCTFLLCRGWKGKNDG"
FT   CDS             join(3195026..3195108,3210877..3210926,3212139..3212283,
FT                   3215845..3215951,3216624..3216748)
FT                   /codon_start=1
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, isoform CRA_c"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT2357797.0
FT                   protein_id=hCP1923062.0 isoform=CRA_c"
FT                   /protein_id="EAW94913.1"
FT                   /translation="MEVRTKRPRIGTDTNRPFVEEEIQMAIRTPEMKGLLPLAWFLACS
FT                   VPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGR
FT                   LEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYF
FT                   PNILCS"
FT   mRNA            join(3196265..3196522,3210877..3210926,3212139..3212283,
FT                   3215845..3215951,3216624..3217255)
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   hCT29413"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT29413.1; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   gene            complement(<3203859..3204193)
FT                   /locus_tag="hCG_1803530"
FT                   /note="gene_id=hCG1803530.1"
FT   mRNA            complement(<3203859..3204193)
FT                   /locus_tag="hCG_1803530"
FT                   /product="hCG1803530"
FT                   /note="gene_id=hCG1803530.1 transcript_id=hCT1842790.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(3203859..3204095)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1803530"
FT                   /product="hCG1803530"
FT                   /note="gene_id=hCG1803530.1 transcript_id=hCT1842790.1
FT                   protein_id=hCP1713378.0"
FT                   /protein_id="EAW94914.1"
FT                   /translation="MQVCLWDLPSGVALLCLSHSLDELIRVQGFSSYFYAGIRGCPGQR
FT                   SLALALTQQTMLNEGMTEYSNQEKAQCQIQDPT"
FT   CDS             join(3210887..3210926,3212139..3212283,3215845..3215951,
FT                   3216624..3216748)
FT                   /codon_start=1
FT                   /gene="PLA2G5"
FT                   /locus_tag="hCG_38174"
FT                   /product="phospholipase A2, group V, isoform CRA_b"
FT                   /note="gene_id=hCG38174.4 transcript_id=hCT29413.1
FT                   protein_id=hCP48096.1 isoform=CRA_b"
FT                   /protein_id="EAW94912.1"
FT                   /translation="MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYG
FT                   CYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCH
FT                   VNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS"
FT   gene            complement(3238042..3245591)
FT                   /gene="PLA2G2D"
FT                   /locus_tag="hCG_37568"
FT                   /note="gene_id=hCG37568.2"
FT   mRNA            complement(join(3238042..3240316,3241564..3241670,
FT                   3242390..3242534,3245516..3245591))
FT                   /gene="PLA2G2D"
FT                   /locus_tag="hCG_37568"
FT                   /product="phospholipase A2, group IID"
FT                   /note="gene_id=hCG37568.2 transcript_id=hCT28801.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(3240171..3240316,3241564..3241670,
FT                   3242390..3242534,3245516..3245555))
FT                   /codon_start=1
FT                   /gene="PLA2G2D"
FT                   /locus_tag="hCG_37568"
FT                   /product="phospholipase A2, group IID"
FT                   /note="gene_id=hCG37568.2 transcript_id=hCT28801.2
FT                   protein_id=hCP48102.1"
FT                   /protein_id="EAW94915.1"
FT                   /translation="MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYG
FT                   CHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWC
FT                   EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC"
FT   gene            <3265482..>3274455
FT                   /gene="PLA2G2F"
FT                   /locus_tag="hCG_38179"
FT                   /note="gene_id=hCG38179.2"
FT   mRNA            join(<3265482..3265597,3266220..3266272,3269500..3269644,
FT                   3270634..3270743,3274244..>3274455)
FT                   /gene="PLA2G2F"
FT                   /locus_tag="hCG_38179"
FT                   /product="phospholipase A2, group IIF"
FT                   /note="gene_id=hCG38179.2 transcript_id=hCT29418.2; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   CDS             join(3265482..3265597,3266220..3266272,3269500..3269644,
FT                   3270634..3270743,3274244..3274455)
FT                   /codon_start=1
FT                   /gene="PLA2G2F"
FT                   /locus_tag="hCG_38179"
FT                   /product="phospholipase A2, group IIF"
FT                   /note="gene_id=hCG38179.2 transcript_id=hCT29418.2
FT                   protein_id=hCP48101.2"
FT                   /protein_id="EAW94916.1"
FT                   /translation="MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMK
FT                   KFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVD
FT                   WCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLC
FT                   LMNQTYREEYRGFLNVYCQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP"
FT   gene            <3275681..>3277229
FT                   /locus_tag="hCG_1983701"
FT                   /note="gene_id=hCG1983701.0"
FT   mRNA            join(<3275681..3275693,3275847..3276031,3276465..3276515,
FT                   3277128..>3277229)
FT                   /locus_tag="hCG_1983701"
FT                   /product="hCG1983701"
FT                   /note="gene_id=hCG1983701.0 transcript_id=hCT2257608.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(3275681..3275693,3275847..3276031,3276465..3276515,
FT                   3277128..>3277229)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1983701"
FT                   /product="hCG1983701"
FT                   /note="gene_id=hCG1983701.0 transcript_id=hCT2257608.0
FT                   protein_id=hCP1855102.0"
FT                   /protein_id="EAW94917.1"
FT                   /translation="MERRGAPYLPPYLPEPQLRVSSLHGASPTCPKTTEATLRLDSTAA
FT                   SKLAWQCPWSTIVAGEGEPGRVSGEDTVTPPASPALGKLLNYDVGTWGSGRRDRGPDAG
FT                   PSSSPSSSAADIC"
FT   gene            complement(3289115..>3301201)
FT                   /locus_tag="hCG_38175"
FT                   /note="gene_id=hCG38175.4"
FT   mRNA            complement(join(3289115..3289350,3290073..3290211,
FT                   3301061..>3301201))
FT                   /locus_tag="hCG_38175"
FT                   /product="hCG38175"
FT                   /note="gene_id=hCG38175.4 transcript_id=hCT29414.4; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 15-AUG-2003"
FT   CDS             complement(join(3290157..3290211,3301061..>3301200))
FT                   /codon_start=1
FT                   /locus_tag="hCG_38175"
FT                   /product="hCG38175"
FT                   /note="gene_id=hCG38175.4 transcript_id=hCT29414.4
FT                   protein_id=hCP48097.4"
FT                   /protein_id="EAW94918.1"
FT                   /translation="APTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDT
FT                   DRWMHPWSWCQLPLQAEGL"
FT   gene            complement(3310335..>3312481)
FT                   /locus_tag="hCG_2041907"
FT                   /note="gene_id=hCG2041907.0"
FT   mRNA            complement(join(3310335..3310678,3312414..>3312481))
FT                   /locus_tag="hCG_2041907"
FT                   /product="hCG2041907"
FT                   /note="gene_id=hCG2041907.0 transcript_id=hCT2347138.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(3310450..>3310674)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041907"
FT                   /product="hCG2041907"
FT                   /note="gene_id=hCG2041907.0 transcript_id=hCT2347138.0
FT                   protein_id=hCP1912689.0"
FT                   /protein_id="EAW94919.1"
FT                   /translation="IAPPWVVKEDHVSGGVSARLRREVCDPWELLGRAWSGPGLFFGLP
FT                   PHTLWSSRKPLWPSECVKDGGFRSCWFCN"
FT   gene            3312134..3319503
FT                   /gene="UBXD3"
FT                   /locus_tag="hCG_1983703"
FT                   /note="gene_id=hCG1983703.1"
FT   mRNA            join(3312134..3312207,3316602..3319503)
FT                   /gene="UBXD3"
FT                   /locus_tag="hCG_1983703"
FT                   /product="UBX domain containing 3"
FT                   /note="gene_id=hCG1983703.1 transcript_id=hCT2257610.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-OCT-2003"
FT   CDS             3316617..3317459
FT                   /codon_start=1
FT                   /gene="UBXD3"
FT                   /locus_tag="hCG_1983703"
FT                   /product="UBX domain containing 3"
FT                   /note="gene_id=hCG1983703.1 transcript_id=hCT2257610.1
FT                   protein_id=hCP1855104.0"
FT                   /db_xref="HGNC:HGNC:26354"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96LJ8"
FT                   /protein_id="EAW94920.1"
FT                   /translation="MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGR
FT                   TRPSLQKSQGVEVCAHHIPSPPPAIPYELPSSQKPGACAPKSPNQGASDEIPELQQQVP
FT                   TGASSSLNKYPVLPSINRKNLEEEAVETVAKKASSLQLSSIRALYQDETGTMKTSEEDS
FT                   RARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQRFVRHFRPTDDLQ
FT                   TIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP"
FT   gene            <3436620..>3480289
FT                   /locus_tag="hCG_1812043"
FT                   /note="gene_id=hCG1812043.2"
FT   mRNA            join(<3436620..3436758,3438854..3439006,3440340..3440610,
FT                   3443548..3443693,3444608..3444739,3445400..3445524,
FT                   3449378..3449554,3453912..3454022,3456202..3456404,
FT                   3456891..3457005,3458778..3458963,3462315..3462498,
FT                   3463658..3463848,3468446..3468623,3469093..3469407,
FT                   3471470..3471607,3474259..3474372,3476182..3476256,
FT                   3476883..3476952,3478081..3478198,3479783..>3480289)
FT                   /locus_tag="hCG_1812043"
FT                   /product="hCG1812043"
FT                   /note="gene_id=hCG1812043.2 transcript_id=hCT1955767.2;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 27-FEB-2003"
FT   CDS             join(3436620..3436758,3438854..3439006,3440340..3440610,
FT                   3443548..3443693,3444608..3444739,3445400..3445524,
FT                   3449378..3449554,3453912..3454022,3456202..3456404,
FT                   3456891..3457005,3458778..3458963,3462315..3462498,
FT                   3463658..3463848,3468446..3468623,3469093..3469407,
FT                   3471470..3471607,3474259..3474372,3476182..3476256,
FT                   3476883..3476952,3478081..3478198,3479783..3480289)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812043"
FT                   /product="hCG1812043"
FT                   /note="gene_id=hCG1812043.2 transcript_id=hCT1955767.2
FT                   protein_id=hCP1765652.2"
FT                   /protein_id="EAW94921.1"
FT                   /translation="MPGLLNWITGAALPLTASDVTSCVSGYALGLTASLTYGNLEAQPF
FT                   QGLFVYPLDECTTVIGFEAVIADRVVTVQIKDKAKLESGHFDASHVRSPTVTGNILQDG
FT                   VSIAPHSCTPGKVTLDEDLERILFVANLGTIAPMENVTIFISTSSELPTLPSGAVRVLL
FT                   PAVCAPTVPQFCTKSTGTSNQQAQGKDRHCFGAWAPGSWNKLCLATLLNTEVSNPMEYE
FT                   FNFQLEIRGPCLLAGVESPTHEIRADAAPSARSAKSIIITLANKHTFDRPVEILIHPSE
FT                   PHMPHVLIEKGDMTLGEFDQHLKGRTDFIKGMKKKSRAERKTEIIRKRLHKDIPHHSVI
FT                   MLNFCPDLQSVQPCLRKAHGEFIFLIDRSSSMSGISMHRVKDAMLVALKSLMPACLFNI
FT                   IGFGSTFKSLFPSSQTYSEDSLAMACDDIQRMKADMGGTNILSPLKWVIRQPVHRGHPR
FT                   LLFVITDGAVNNTGKVLELVRNHAFSTRCYSFGIGPNVCHRLVKGLASVSEGSAELLME
FT                   GERLQPKMVKSLKKAMAPVLSDVTVEWIFPETTEVLVSPVSASSLFPGERLVGYGIVCD
FT                   ASLHISNPRSDKRRRYSMLHSQESGSSVFYHSQDDGPGLEGGDCAKNSGAPFILGQAKN
FT                   ARLASGDSTTKHDLNLSQRRRAYSTNQITNHKPLPRATMASDPMPAAKRYPLRKARLQD
FT                   LTNQTSLDVQRWQIDLQPLLNSGQDLNQGPKLRGPGARRPSLLPQGCQPFLPWGQETQA
FT                   WSPVRERTSDSRSPGDLEPSHHPSAFETETSSDWDPPAESQERASPSRPATPAPVLGKA
FT                   LVKGLHDSQRLQWEVSFELGTPGPERGGAQDADLWSETFHHLAARAIIRDFEQLAEREG
FT                   EIEQGSNRRYQVSALHTSKACNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGS
FT                   RALAQQWRGTSSGFGRPQTMLGEDSAPGNDMEASPTALFSEARSPGREKHGASEGPQRS
FT                   LATNTLSSMKASENLFGSWLNLNKSRLLTRAAKGFLSKPLIKAVESTSGNQSFDYIPLV
FT                   SLQLASGAFLLNEAFCEATHIPMEKLKWTSPFTCHRVSLTTRPSESKTPSPQLCTSSPP
FT                   RHPSCDSFSLEPLAKGKLGLEPRAVVEHTGKLWATVVGLAWLEHSSASYFTEWELVAAK
FT                   ANSWLEQQEVPEGRTQGTLKAAARQLFVLLRHWDENLEFNMLCYNPNYV"
FT   gene            complement(3524228..3554909)
FT                   /locus_tag="hCG_1812044"
FT                   /note="gene_id=hCG1812044.1"
FT   mRNA            complement(join(3524228..3524348,3524606..3524910,
FT                   3531698..3531817,3532310..3532392,3554705..3554909))
FT                   /locus_tag="hCG_1812044"
FT                   /product="hCG1812044"
FT                   /note="gene_id=hCG1812044.1 transcript_id=hCT1955769.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3524239..3524348,3524606..3524780))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812044"
FT                   /product="hCG1812044"
FT                   /note="gene_id=hCG1812044.1 transcript_id=hCT1955769.1
FT                   protein_id=hCP1765672.1"
FT                   /protein_id="EAW94922.1"
FT                   /translation="MNESRERIRKLQRMIDLQNSPWVRPRLSFQNSSICLPLTEIELMS
FT                   HSWTDLKLSSVILDTCPSAGDSACLRYQPLPETGLCSLLSLCHFILTPK"
FT   gene            complement(3609658..3613462)
FT                   /gene="CAMK2N1"
FT                   /locus_tag="hCG_38181"
FT                   /note="gene_id=hCG38181.4"
FT   mRNA            complement(join(3609658..3610985,3612480..3613462))
FT                   /gene="CAMK2N1"
FT                   /locus_tag="hCG_38181"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   inhibitor 1, transcript variant hCT29420"
FT                   /note="gene_id=hCG38181.4 transcript_id=hCT29420.4; splice
FT                   donor-acceptor pairs covered / total pairs = 1/1; created
FT                   on 25-NOV-2003"
FT   mRNA            complement(join(3609658..3610985,3611633..>3611898))
FT                   /gene="CAMK2N1"
FT                   /locus_tag="hCG_38181"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   inhibitor 1, transcript variant hCT1955770"
FT                   /note="gene_id=hCG38181.4 transcript_id=hCT1955770.2;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 25-NOV-2003"
FT   gene            <3609704..3612512
FT                   /locus_tag="hCG_2042223"
FT                   /note="gene_id=hCG2042223.0"
FT   mRNA            join(<3609704..3610985,3612480..3612512)
FT                   /locus_tag="hCG_2042223"
FT                   /product="hCG2042223"
FT                   /note="gene_id=hCG2042223.0 transcript_id=hCT2347454.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 18-JUN-2003"
FT   CDS             <3609783..3609995
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042223"
FT                   /product="hCG2042223"
FT                   /note="gene_id=hCG2042223.0 transcript_id=hCT2347454.0
FT                   protein_id=hCP1912681.0"
FT                   /protein_id="EAW94925.1"
FT                   /translation="GPKLQTKNGKRFPHARGIFANTMQNRQLVCLKRIPINNRKDTPSI
FT                   PVRGLRAQRKETKMPFGISRYLALL"
FT   CDS             complement(join(3610915..3610985,3612480..3612645))
FT                   /codon_start=1
FT                   /gene="CAMK2N1"
FT                   /locus_tag="hCG_38181"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   inhibitor 1, isoform CRA_a"
FT                   /note="gene_id=hCG38181.4 transcript_id=hCT29420.4
FT                   protein_id=hCP48094.4 isoform=CRA_a"
FT                   /db_xref="GOA:Q7Z7J9"
FT                   /db_xref="HGNC:HGNC:24190"
FT                   /db_xref="InterPro:IPR026779"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Z7J9"
FT                   /protein_id="EAW94923.1"
FT                   /translation="MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPP
FT                   KLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV"
FT   CDS             complement(join(3610915..3610985,3611633..>3611897))
FT                   /codon_start=1
FT                   /gene="CAMK2N1"
FT                   /locus_tag="hCG_38181"
FT                   /product="calcium/calmodulin-dependent protein kinase II
FT                   inhibitor 1, isoform CRA_b"
FT                   /note="gene_id=hCG38181.4 transcript_id=hCT1955770.2
FT                   protein_id=hCP1765684.2 isoform=CRA_b"
FT                   /protein_id="EAW94924.1"
FT                   /translation="QRETETQGWRGGGTRETEGGRDRDKAPERGAEAGETEPRTRVWGG
FT                   RRSRRNNKGDRHLRQGETETSIGCRPSRRGTMEGLRKARLSRDVVIEDDRIDDVLKNMT
FT                   DKAPPGV"
FT   gene            complement(3626711..>3681027)
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /note="gene_id=hCG38180.2"
FT   mRNA            complement(join(3626711..3626897,3626972..3628680,
FT                   3629330..3629450,3630483..3630570,3635165..3635754))
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, transcript
FT                   variant hCT2258550"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2258550.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3626711..3628680,3629330..3629450,
FT                   3630483..3630570,3635165..3635754))
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, transcript
FT                   variant hCT29419"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT29419.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(3627951..3628680,3629330..3629450,
FT                   3630483..3630570,3635165..3635284))
FT                   /codon_start=1
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2258550.0
FT                   protein_id=hCP1855059.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA0"
FT                   /protein_id="EAW94926.1"
FT                   /translation="MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKV
FT                   HLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWN
FT                   RTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSI
FT                   QSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLS
FT                   SQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQE
FT                   HEAQLLSRAKPEDRESLKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICR
FT                   QAITRVIPLYNS"
FT   CDS             complement(join(3627951..3628680,3629330..3629450,
FT                   3630483..3630570,3635165..3635284))
FT                   /codon_start=1
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT29419.2
FT                   protein_id=hCP48093.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA0"
FT                   /protein_id="EAW94927.1"
FT                   /translation="MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKV
FT                   HLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWN
FT                   RTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSI
FT                   QSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLS
FT                   SQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQE
FT                   HEAQLLSRAKPEDRESLKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICR
FT                   QAITRVIPLYNS"
FT   gene            3628034..3628659
FT                   /locus_tag="hCG_2045609"
FT                   /note="gene_id=hCG2045609.0"
FT   mRNA            join(3628034..3628428,3628495..3628659)
FT                   /locus_tag="hCG_2045609"
FT                   /product="hCG2045609"
FT                   /note="gene_id=hCG2045609.0 transcript_id=hCT2360444.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             3628164..3628349
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045609"
FT                   /product="hCG2045609"
FT                   /note="gene_id=hCG2045609.0 transcript_id=hCT2360444.0
FT                   protein_id=hCP1925674.0"
FT                   /protein_id="EAW94930.1"
FT                   /translation="MLLELLLHLLEAQALLPLQILLPENEEEGGTCGKAKNQRQHLPEP
FT                   DARLLPLQQAVEVLAA"
FT   mRNA            complement(join(<3628472..3628680,3629330..3629450,
FT                   3630483..3630570,3680659..3680881))
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, transcript
FT                   variant hCT2357795"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2357795.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(<3628472..3628680,3629330..3629358))
FT                   /codon_start=1
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2357795.0
FT                   protein_id=hCP1923063.0 isoform=CRA_c"
FT                   /protein_id="EAW94929.1"
FT                   /translation="MVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPL
FT                   DSVDLGLETVYEKFHPSIQSFTDVIGHYISGERP"
FT   mRNA            complement(join(<3635156..3635309,3641393..3641440,
FT                   3680030..>3681027))
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, transcript
FT                   variant hCT2258548"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2258548.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<3635156..3635309,3641393..3641440,
FT                   3680030..3681027))
FT                   /codon_start=1
FT                   /gene="C1orf166"
FT                   /locus_tag="hCG_38180"
FT                   /product="chromosome 1 open reading frame 166, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG38180.2 transcript_id=hCT2258548.0
FT                   protein_id=hCP1855060.0 isoform=CRA_b"
FT                   /protein_id="EAW94928.1"
FT                   /translation="MDAAEARRPAAALARRRPVGALGIEQAAQWGAGHRGGGAPSAEML
FT                   LAHVARVALALQALEVAEGRQRGLAEQAGQGARLVRPRQQHSVAAQHHGLVARLVAVDP
FT                   GEDARVAPVRRAVGDARQQVGVRRPAAPRTPGGAALARLHADAVRPQRQLHLSAPARPA
FT                   ASPDLAHGVVGAAVALGVQGDGVAQVPHGVGRVLLVELHFLAPAAEHTAQALQRPVGQQ
FT                   VRAGAQEAGEQRRVGEPRTQALRLALGLVLHQHEFVTSPGQHRGGGERGWGRRELTGVL
FT                   SGDRGREGAQKSTALESREAGQGRGQSLPGDAQCQAGLASQMPGAQPGQQPRSPVVVCC
FT                   WNLWPINGGRPPGLAAVMESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKVS
FT                   A"
FT   gene            3716212..3746197
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /note="gene_id=hCG37690.3"
FT   mRNA            join(3716212..3716546,3720860..3720980,3732218..3732329,
FT                   3741129..3741186,3745739..3746179)
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, transcript variant
FT                   hCT2357815"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT2357815.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   mRNA            join(3716225..3716546,3732218..3732329,3741129..3741186,
FT                   3745739..3746197)
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, transcript variant hCT28924"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT28924.3; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   mRNA            join(3716225..3716546,3732218..3732329,3745739..3746086)
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, transcript variant
FT                   hCT1961488"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT1961488.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             join(3716393..3716546,3732218..3732329,3741129..3741186,
FT                   3745739..3745855)
FT                   /codon_start=1
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, isoform CRA_b"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT28924.3
FT                   protein_id=hCP47615.2 isoform=CRA_b"
FT                   /protein_id="EAW94932.1"
FT                   /translation="MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQ
FT                   EGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQ
FT                   VMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ"
FT   CDS             join(3716393..3716546,3732218..3732329,3745739..3745766)
FT                   /codon_start=1
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, isoform CRA_a"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT1961488.1
FT                   protein_id=hCP1774603.0 isoform=CRA_a"
FT                   /protein_id="EAW94931.1"
FT                   /translation="MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQ
FT                   EGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASLAPTGPCT"
FT   CDS             join(3716393..3716546,3720860..3720980,3732218..3732263)
FT                   /codon_start=1
FT                   /gene="CDA"
FT                   /locus_tag="hCG_37690"
FT                   /product="cytidine deaminase, isoform CRA_c"
FT                   /note="gene_id=hCG37690.3 transcript_id=hCT2357815.0
FT                   protein_id=hCP1923058.0 isoform=CRA_c"
FT                   /protein_id="EAW94933.1"
FT                   /translation="MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQ
FT                   EGRIFKGRVSLLPMLEVQWREPSSLQSQTPEFKLSSCLSLPSSWDYRVQHRKCLLPAGH
FT                   LC"
FT   gene            3760562..3778624
FT                   /gene="PINK1"
FT                   /locus_tag="hCG_38873"
FT                   /note="gene_id=hCG38873.3"
FT   mRNA            join(3760562..3761042,3764949..3765236,3767001..3767101,
FT                   3771599..3771781,3772670..3772833,3775619..3775746,
FT                   3776109..3776345,3777548..3778624)
FT                   /gene="PINK1"
FT                   /locus_tag="hCG_38873"
FT                   /product="PTEN induced putative kinase 1, transcript
FT                   variant hCT30119"
FT                   /note="gene_id=hCG38873.3 transcript_id=hCT30119.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            join(3760576..3760702,3771742..3771781,3772670..3772833,
FT                   3775619..3775746,3776109..>3776164)
FT                   /gene="PINK1"
FT                   /locus_tag="hCG_38873"
FT                   /product="PTEN induced putative kinase 1, transcript
FT                   variant hCT2357824"
FT                   /note="gene_id=hCG38873.3 transcript_id=hCT2357824.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   CDS             join(3760656..3761042,3764949..3765236,3767001..3767101,
FT                   3771599..3771781,3772670..3772833,3775619..3775746,
FT                   3776109..3776345,3777548..3777805)
FT                   /codon_start=1
FT                   /gene="PINK1"
FT                   /locus_tag="hCG_38873"
FT                   /product="PTEN induced putative kinase 1, isoform CRA_b"
FT                   /note="gene_id=hCG38873.3 transcript_id=hCT30119.3
FT                   protein_id=hCP48745.2 isoform=CRA_b"
FT                   /protein_id="EAW94935.1"
FT                   /translation="MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGER
FT                   PGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAF
FT                   GLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIG
FT                   KGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMW
FT                   NISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAF
FT                   TSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAA
FT                   MMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLP
FT                   FSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGK
FT                   AHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHIL
FT                   ALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCS
FT                   WRAAL"
FT   CDS             join(3771774..3771781,3772670..3772833,3775619..3775746,
FT                   3776109..>3776164)
FT                   /codon_start=1
FT                   /gene="PINK1"
FT                   /locus_tag="hCG_38873"
FT                   /product="PTEN induced putative kinase 1, isoform CRA_a"
FT                   /note="gene_id=hCG38873.3 transcript_id=hCT2357824.0
FT                   protein_id=hCP1923065.0 isoform=CRA_a"
FT                   /protein_id="EAW94934.1"
FT                   /translation="MKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRD
FT                   LKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTA
FT                   RPGPRAVIDYSKADA"
FT   gene            complement(3777694..3790237)
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /note="gene_id=hCG38871.3"
FT   mRNA            complement(join(3777694..3779141,3780742..3781236,
FT                   3781329..3781435,3781560..3781680,3782336..3782483,
FT                   3782932..3783080,3783323..3783416,3784145..3784239,
FT                   3784381..3784484,3784806..3784892,3789586..3789696,
FT                   3789902..3790237))
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, transcript variant hCT2258547"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT2258547.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3780488..3781236,3781329..3781435,
FT                   3781560..3781611,3789611..3789696,3789902..3790237))
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, transcript variant hCT1955781"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955781.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3780488..3781076,3784162..3784239,
FT                   3784381..3784484,3784806..3784892,3789586..3789696,
FT                   3789902..3790237))
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, transcript variant hCT1955780"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955780.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3780488..3781236,3781329..3781435,
FT                   3781560..3781680,3782336..3782483,3782932..3783080,
FT                   3783323..3783416,3784145..3784239,3784381..3784484,
FT                   3784806..3784892,3789586..3789696,3789902..3790237))
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, transcript variant hCT30117"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT30117.3; splice
FT                   donor-acceptor pairs covered / total pairs = 10/10; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(3780545..3780608,3780885..3781236,
FT                   3781329..3781435,3781560..3781620,3789620..3789696,
FT                   3789902..3790237))
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, transcript variant hCT1955779"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955779.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3781002..3781076,3784162..3784239,
FT                   3784381..3784484,3784806..3784892,3789586..3789696,
FT                   3789902..3790106))
FT                   /codon_start=1
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, isoform CRA_d"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955780.1
FT                   protein_id=hCP1765599.0 isoform=CRA_d"
FT                   /protein_id="EAW94940.1"
FT                   /translation="MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGP
FT                   RTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSV
FT                   EDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYD
FT                   ISDLGQHTLIVADTENLLKAPTIVGKSSLNPIPSPHSVETGQGGGLLGLVVLFCFV"
FT   CDS             complement(join(3781087..3781236,3781329..3781435,
FT                   3781560..3781620,3789620..3789696,3789902..3790106))
FT                   /codon_start=1
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, isoform CRA_b"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955779.1
FT                   protein_id=hCP1765703.0 isoform=CRA_b"
FT                   /protein_id="EAW94937.1"
FT                   /translation="MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGP
FT                   RTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDIQLEFVRID
FT                   PFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
FT                   FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD"
FT   CDS             complement(join(3781087..3781236,3781329..3781435,
FT                   3781560..3781611,3789611..3789696,3789902..3790106))
FT                   /codon_start=1
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, isoform CRA_a"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT1955781.1
FT                   protein_id=hCP1765612.0 isoform=CRA_a"
FT                   /protein_id="EAW94936.1"
FT                   /translation="MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGP
FT                   RTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLLEFVRID
FT                   PFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
FT                   FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD"
FT   CDS             complement(join(3781087..3781236,3781329..3781435,
FT                   3781560..3781680,3782336..3782483,3782932..3783080,
FT                   3783323..3783416,3784145..3784239,3784381..3784484,
FT                   3784806..3784892,3789586..3789696,3789902..3790106))
FT                   /codon_start=1
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, isoform CRA_c"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT30117.3
FT                   protein_id=hCP48742.0 isoform=CRA_c"
FT                   /db_xref="GOA:P39656"
FT                   /db_xref="HGNC:HGNC:2728"
FT                   /db_xref="InterPro:IPR005013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39656"
FT                   /protein_id="EAW94938.1"
FT                   /translation="MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGP
FT                   RTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSV
FT                   EDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYD
FT                   ISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSY
FT                   SFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQ
FT                   RYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQL
FT                   SNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGY
FT                   THLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD"
FT   CDS             complement(join(3781087..3781236,3781329..3781435,
FT                   3781560..3781680,3782336..3782483,3782932..3783080,
FT                   3783323..3783416,3784145..3784239,3784381..3784484,
FT                   3784806..3784892,3789586..3789696,3789902..3790106))
FT                   /codon_start=1
FT                   /gene="DDOST"
FT                   /locus_tag="hCG_38871"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase, isoform CRA_c"
FT                   /note="gene_id=hCG38871.3 transcript_id=hCT2258547.0
FT                   protein_id=hCP1855094.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAD5"
FT                   /protein_id="EAW94939.1"
FT                   /translation="MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGP
FT                   RTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSV
FT                   EDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYD
FT                   ISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSY
FT                   SFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQ
FT                   RYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQL
FT                   SNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGY
FT                   THLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD"
FT   gene            complement(3792719..3846480)
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /note="gene_id=hCG38872.2"
FT   mRNA            complement(join(3792719..3793467,3794920..3795037,
FT                   3799130..3799197,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846480))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT2258542"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258542.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3792719..3792992,3793303..3793467,
FT                   3794920..3795037,3799130..3799200,3800647..3800905,
FT                   3811362..3811593,3813518..3813729,3814755..3814835,
FT                   3816097..3816653,3818896..3819043,3827076..3827185,
FT                   3833152..3833604,3838345..3838534,3842160..3842261,
FT                   3844199..3844345,3846182..3846480))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT1955782"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT1955782.1;
FT                   splice donor-acceptor pairs covered / total pairs = 14/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3792719..3792909,3793093..3793467,
FT                   3794920..3795037,3799130..3799200,3800647..3800905,
FT                   3811362..3811593,3813518..3813729,3814755..3814835,
FT                   3816097..3816653,3818896..3819043,3827076..3827185,
FT                   3833152..3833604,3838345..3838534,3842160..3842261,
FT                   3844199..3844345,3846182..3846480))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT2258539"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258539.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3792719..3793467,3794920..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846480))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT30118"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT30118.3; splice
FT                   donor-acceptor pairs covered / total pairs = 14/14; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(3792719..3792909,3793093..3793467,
FT                   3794916..3795037,3799130..3799200,3800647..3800905,
FT                   3811362..3811593,3813518..3813729,3814755..3814835,
FT                   3816097..3816653,3818896..3819043,3827076..3827185,
FT                   3833152..3833604,3838345..3838534,3842160..3842261,
FT                   3844199..3844345,3846182..3846480))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT2258541"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258541.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3792721..3793467,3794920..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846055..3846197))
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, transcript variant
FT                   hCT2357823"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2357823.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(3792868..3792992,3793303..3793467,
FT                   3794920..3795037,3799130..3799200,3800647..3800905,
FT                   3811362..3811593,3813518..3813729,3814755..3814835,
FT                   3816097..3816653,3818896..3819043,3827076..3827185,
FT                   3833152..3833604,3838345..3838534,3842160..3842261,
FT                   3844199..3844345,3846182..3846412))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_d"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT1955782.1
FT                   protein_id=hCP1765615.1 isoform=CRA_d"
FT                   /protein_id="EAW94944.1"
FT                   /translation="MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAA
FT                   DEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKE
FT                   HPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPR
FT                   INEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQ
FT                   HDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRK
FT                   ETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQV
FT                   SSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYF
FT                   LDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDA
FT                   PQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVW
FT                   LEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVV
FT                   GGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKS
FT                   KLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRD
FT                   CNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPN
FT                   MEEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAI
FT                   PPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGMLVFASKPETCFTAFTSPDGEGS
FT                   SCHVEEAQYQLGRNCASV"
FT   CDS             complement(join(3793289..3793467,3794920..3795037,
FT                   3799130..3799197,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846412))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_b"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258542.0
FT                   protein_id=hCP1855086.0 isoform=CRA_b"
FT                   /protein_id="EAW94942.1"
FT                   /translation="MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAA
FT                   DEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKE
FT                   HPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPR
FT                   INEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQ
FT                   HDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRK
FT                   ETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQV
FT                   SSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYF
FT                   LDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDA
FT                   PQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVW
FT                   LEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVV
FT                   GGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKS
FT                   KLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRD
FT                   CNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVVSTGPQNKPARKTSAADNGEPNM
FT                   EEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAIP
FT                   PTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL"
FT   CDS             complement(join(3793289..3793467,3794920..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846412))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_a"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258539.0
FT                   protein_id=hCP1855087.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF4"
FT                   /protein_id="EAW94941.1"
FT                   /translation="MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAA
FT                   DEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKE
FT                   HPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPR
FT                   INEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQ
FT                   HDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRK
FT                   ETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQV
FT                   SSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYF
FT                   LDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDA
FT                   PQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVW
FT                   LEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVV
FT                   GGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKS
FT                   KLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRD
FT                   CNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPN
FT                   MEEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAI
FT                   PPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL"
FT   CDS             complement(join(3793289..3793467,3794920..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846412))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_a"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT30118.3
FT                   protein_id=hCP48743.3 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF4"
FT                   /protein_id="EAW94945.1"
FT                   /translation="MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAA
FT                   DEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKE
FT                   HPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPR
FT                   INEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQ
FT                   HDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRK
FT                   ETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQV
FT                   SSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYF
FT                   LDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDA
FT                   PQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVW
FT                   LEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVV
FT                   GGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKS
FT                   KLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRD
FT                   CNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPN
FT                   MEEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLTHHNSPPGLSCPLSNNSAI
FT                   PPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL"
FT   CDS             complement(join(3793289..3793467,3794920..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844276))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_c"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2357823.0
FT                   protein_id=hCP1923064.0 isoform=CRA_c"
FT                   /protein_id="EAW94943.1"
FT                   /translation="MQGLPDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNE
FT                   DVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMN
FT                   KDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKI
FT                   NLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDET
FT                   LSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQV
FT                   PPDPVQVEEKLLPQPVIQHDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITA
FT                   MRNSYDVRLSTLEENLRKETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPK
FT                   VFSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEE
FT                   PSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFA
FT                   EVEAKLARLSSTVARTDAPQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVD
FT                   LASEVALEVVRTAEPGVWLEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPV
FT                   VDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGD
FT                   WVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERD
FT                   SMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTG
FT                   PQNKPARKTSAADNGEPNMEEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLT
FT                   HHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKSKSNFGSEPL"
FT   CDS             complement(join(3793392..3793467,3794916..3795037,
FT                   3799130..3799200,3800647..3800905,3811362..3811593,
FT                   3813518..3813729,3814755..3814835,3816097..3816653,
FT                   3818896..3819043,3827076..3827185,3833152..3833604,
FT                   3838345..3838534,3842160..3842261,3844199..3844345,
FT                   3846182..3846412))
FT                   /codon_start=1
FT                   /gene="KIF17"
FT                   /locus_tag="hCG_38872"
FT                   /product="kinesin family member 17, isoform CRA_e"
FT                   /note="gene_id=hCG38872.2 transcript_id=hCT2258541.0
FT                   protein_id=hCP1855088.0 isoform=CRA_e"
FT                   /protein_id="EAW94946.1"
FT                   /translation="MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAA
FT                   DEPPKQFTFDGAYHVDHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPSQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKE
FT                   HPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPR
FT                   INEDPKDALLREYQEEIKKLKAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQ
FT                   HDMEAEKQLIREEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRK
FT                   ETEAVLQVGVLYKAEVMSRAEFASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQV
FT                   SSRFAELPKVEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYF
FT                   LDECLGQEAAGHLLGEQNYLPQEEPQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDA
FT                   PQADVPKVPVQVPAPTDLLEPSDARPEAEAADDFPPRPEVDLASEVALEVVRTAEPGVW
FT                   LEAQAPVALVAQPEPLPATAGVKRESVGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVV
FT                   GGEQAKNKDLKEKHKRRKRYADERRKQLVAALQNSDEDSGDWVLLNVYDSIQEEVRAKS
FT                   KLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLLQQLLEQVQPLIRRD
FT                   CNYSNLEKILRESCWDEDNGFWKIPHPVITKTSLPVAVSTGPQNKPARKTSAADNGEPN
FT                   MEEDRYRLMLSRSNSENIASNYFRSKRASQILSTDARKSLSDTSQLATRPQLPTQQQLC
FT                   HPTHPGP"
FT   gene            complement(3848439..3861544)
FT                   /locus_tag="hCG_38876"
FT                   /note="gene_id=hCG38876.4"
FT   mRNA            complement(join(3848439..3850702,3851463..3851622,
FT                   3852333..3852441,3852790..3852958,3853056..3853342,
FT                   3861471..3861544))
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, transcript variant hCT2357827"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT2357827.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(3848439..3850702,3851463..3851622,
FT                   3852333..3852441,3852790..3852958,3853103..3853342,
FT                   3854627..3854773,3855708..3855782,3856230..3856310,
FT                   3860888..3861347))
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, transcript variant hCT2357826"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT2357826.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(3849374..3850702,3851463..3851622,
FT                   3852333..3852441,3852790..3852958,3853103..3853342,
FT                   3854627..3854773,3855708..3855782,3856230..3856310,
FT                   3856665..3856793,3860711..3860853))
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, transcript variant hCT30122"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT30122.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   CDS             complement(3850023..3850322)
FT                   /codon_start=1
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, isoform CRA_b"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT2357827.0
FT                   protein_id=hCP1923067.0 isoform=CRA_b"
FT                   /protein_id="EAW94948.1"
FT                   /translation="MASWRTCGLLRFQEGRWSCRLRITLWVASDDLLCGFGCFGTSGLL
FT                   LYSWGRSLFTAKLQPSPKEARPWGADWESPERGFWGGRSELLLWAKTWSEPPCL"
FT   CDS             complement(join(3850499..3850702,3851463..3851622,
FT                   3852333..3852441,3852790..3852958,3853103..3853342,
FT                   3854627..3854773,3855708..3855782,3856230..3856310,
FT                   3856665..3856751))
FT                   /codon_start=1
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, isoform CRA_a"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT30122.3
FT                   protein_id=hCP48736.2 isoform=CRA_a"
FT                   /db_xref="HGNC:HGNC:28819"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZV89"
FT                   /protein_id="EAW94947.1"
FT                   /translation="MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESV
FT                   WLVQQQLWALKDCPRRRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQF
FT                   AFMARNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERAQPEPCPGP
FT                   TGEVPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARH
FT                   ARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGH
FT                   SCLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGV
FT                   VPHQVFRNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGP
FT                   PGRPPRTLRPLSHAKSEAELQGLG"
FT   CDS             complement(join(3850499..3850702,3851463..3851622,
FT                   3852333..3852441,3852790..3852958,3853103..3853342,
FT                   3854627..3854764))
FT                   /codon_start=1
FT                   /locus_tag="hCG_38876"
FT                   /product="hCG38876, isoform CRA_c"
FT                   /note="gene_id=hCG38876.4 transcript_id=hCT2357826.0
FT                   protein_id=hCP1923066.0 isoform=CRA_c"
FT                   /protein_id="EAW94949.1"
FT                   /translation="MAHALRRILYSTWCPADCQFAFMARNPRSPASKLFCHLFVGSQPG
FT                   EVQILHLLLCRSFQLAYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVREPFGRDQL
FT                   SQNVHALVSFRRLPAEGLVGSGKELPESEGRARHARLGNPYCSPTLVRKKAIRSKVIRS
FT                   GAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGHSCLVESEGSLTENIWAFAGISRPCA
FT                   LALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVFRNHLGRYCLEHLPAEFPSL
FT                   EALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQGLG"
FT   gene            complement(3871391..3915975)
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /note="gene_id=hCG38870.2"
FT   mRNA            complement(join(3871391..3871958,3872020..3873801,
FT                   3874253..3874366,3876254..3876365,3878433..3878592,
FT                   3885836..3885926,3894048..3894197,3896255..3896335,
FT                   3899601..3899744,3902118..3902281,3905268..3905421,
FT                   3908489..3908588,3909022..3909217,3915871..3915975))
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant hCT2258534"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258534.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/13;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3871391..3871884,3873454..3873801,
FT                   3874253..3874366,3876254..3876365,3878433..3878592,
FT                   3885836..3885926,3894048..3894202,3896255..3896335,
FT                   3899601..3899744,3902118..3902281,3905268..3905421,
FT                   3908489..3908588,3909022..3909217,3914863..3915332))
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant hCT30116"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT30116.2; splice
FT                   donor-acceptor pairs covered / total pairs = 13/13; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(3871391..3871884,3873454..3873801,
FT                   3874253..3874366,3876254..3876365,3878433..3878592,
FT                   3885836..3885926,3894048..3894202,3896255..3896335,
FT                   3899601..3899744,3902122..3902281,3905268..3905421,
FT                   3908489..3908588,3909022..3909217))
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant hCT2258531"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258531.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3873507..3873801,3874253..3874366,
FT                   3876254..3876365,3878433..3878592,3885836..3885926,
FT                   3894048..3894202,3896255..3896335,3899601..3899744,
FT                   3902122..3902281,3905268..3905421,3908489..3908588,
FT                   3909022..3909117))
FT                   /codon_start=1
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258531.0
FT                   protein_id=hCP1855080.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q5SSJ5"
FT                   /db_xref="HGNC:HGNC:24973"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="PDB:2RQP"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SSJ5"
FT                   /protein_id="EAW94953.1"
FT                   /translation="MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTV
FT                   NSTRETPPKSKLAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPKGEPENEE
FT                   KEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLSASQLARAQKQTPMASSPRPKMDA
FT                   ILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGK
FT                   GASGSFVVVQKSRKTPQKSRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSLI
FT                   RKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGS
FT                   LMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWMEQ
FT                   ISGKGFSGTFQLCFPYYPSPGVLFPKKEPDDSRDEDEDEDESSEEDSEDEEPPPKRRLQ
FT                   KKTPAKSPGKAASVKQRGSKPAPKVSAAQRGKARPLPKKAPPKAKTPAKKTRPSSTVIK
FT                   KPSGGSSKKPATSARKEVKLPGKGKSTMKKSFRVKK"
FT   CDS             complement(join(3873507..3873801,3874253..3874366,
FT                   3876254..3876365,3878433..3878550))
FT                   /codon_start=1
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT30116.2
FT                   protein_id=hCP48741.3 isoform=CRA_b"
FT                   /db_xref="GOA:B4E0N8"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B4E0N8"
FT                   /protein_id="EAW94951.1"
FT                   /translation="MEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKK
FT                   TLQKCEKNGWMEQISGKGFSGTFQLCFPYYPSPGVLFPKKEPDDSRDEDEDEDESSEED
FT                   SEDEEPPPKRRLQKKTPAKSPGKAASVKQRGSKPAPKVSAAQRGKARPLPKKAPPKAKT
FT                   PAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGKGKSTMKKSFRVKK"
FT   CDS             complement(join(3873507..3873801,3874253..3874366,
FT                   3876254..3876365,3878433..3878550))
FT                   /codon_start=1
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258534.0
FT                   protein_id=hCP1855082.0 isoform=CRA_b"
FT                   /db_xref="GOA:B4E0N8"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B4E0N8"
FT                   /protein_id="EAW94952.1"
FT                   /translation="MEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKK
FT                   TLQKCEKNGWMEQISGKGFSGTFQLCFPYYPSPGVLFPKKEPDDSRDEDEDEDESSEED
FT                   SEDEEPPPKRRLQKKTPAKSPGKAASVKQRGSKPAPKVSAAQRGKARPLPKKAPPKAKT
FT                   PAKKTRPSSTVIKKPSGGSSKKPATSARKEVKLPGKGKSTMKKSFRVKK"
FT   mRNA            complement(join(3893915..3894202,3896255..3896335,
FT                   3899601..3899744,3902122..3903409))
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant hCT2258535"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258535.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3893972..3894202,3896255..3896335,
FT                   3899601..3899744,3902122..3902175))
FT                   /codon_start=1
FT                   /gene="HP1BP3"
FT                   /locus_tag="hCG_38870"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG38870.2 transcript_id=hCT2258535.0
FT                   protein_id=hCP1855078.0 isoform=CRA_a"
FT                   /protein_id="EAW94950.1"
FT                   /translation="MASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELE
FT                   RRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKTPQKSRNRKNRSSAVDPEPQ
FT                   VKLEDVLPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDIRYEQLAWPLKHDVLLPLAP
FT                   FSWEKR"
FT   gene            complement(3934968..4304064)
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /note="gene_id=hCG1812032.1"
FT   mRNA            complement(join(3934968..3936176,3939414..3939560,
FT                   3941821..3941902,3945583..3945729,3953291..3953389,
FT                   3955807..3955888,3957337..3957462,3969046..3969218,
FT                   3977605..3977720,3979448..3979668,3981741..3981858,
FT                   3983159..3983252,3985584..3985678,3988566..3988698,
FT                   3990409..3990513,3992657..3992893,3993297..3993443,
FT                   4007510..4007707,4014386..4014556,4021701..4021820,
FT                   4023552..4023685,4027881..4028127,4033067..4033155,
FT                   4069673..4069879,4069967..4070512,4078185..4078293,
FT                   4097662..4097784,4101190..4101287,4108522..4108636,
FT                   4109236..4109415,4131107..4131202,4179261..4179389,
FT                   4217018..4217093,4303996..4304064))
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant hCT1955725"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT1955725.1;
FT                   splice donor-acceptor pairs covered / total pairs = 32/33;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(3934968..3936176,3939414..3939560,
FT                   3941821..3941902,3945583..3945729,3953291..3953389,
FT                   3955807..3955888,3957337..3957462,3969046..3969218,
FT                   3977605..3977720,3979448..3979668,3981741..3981858,
FT                   3983159..3983252,3985584..3985678,3988566..3988698,
FT                   3990409..3990513,3992657..3992893,3993297..3993443,
FT                   4007510..4007707,4014386..4014556,4021701..4021820,
FT                   4023552..4023685,4027881..4028127,4033067..4033155,
FT                   4069673..4070512,4078185..4078293,4097662..4097784,
FT                   4101190..4101287,4108522..4108636,4109236..4109415,
FT                   4131107..4131202,4179261..4179399))
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant hCT2258525"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT2258525.0;
FT                   splice donor-acceptor pairs covered / total pairs = 30/30;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(3935995..3936176,3939414..3939560,
FT                   3941821..3941902,3945583..3945729,3953291..3953389,
FT                   3955807..3955888,3957337..3957462,3969046..3969218,
FT                   3977605..3977720,3979448..3979668,3981741..3981858,
FT                   3983159..3983252,3985584..3985678,3988566..3988698,
FT                   3990409..3990513,3992657..3992893,3993297..3993443,
FT                   4007510..4007707,4014386..4014556,4021701..4021820,
FT                   4023552..4023685,4027881..4028127,4033067..4033155,
FT                   4069673..4069879,4069967..4070512,4078185..4078293,
FT                   4097662..4097784,4101190..4101287,4108522..4108636,
FT                   4109236..4109415,4131107..4131136))
FT                   /codon_start=1
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_b"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT1955725.1
FT                   protein_id=hCP1765686.0 isoform=CRA_b"
FT                   /protein_id="EAW94955.1"
FT                   /translation="MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQAN
FT                   QHIMMVNHLPMPYPVPQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDF
FT                   PNAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGG
FT                   SRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKP
FT                   KPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAA
FT                   PTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPC
FT                   SVAPNDIPLVSSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKL
FT                   EFIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQTEEILDS
FT                   QNLNSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKVLESEQD
FT                   KMSQGFHPERDPSDLKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSSGDGVT
FT                   FPFKPESWKPTDTEGKKQYDREFLLDFQFMPACIQKPEGLPPISDVVLDKINQPKLPMR
FT                   TLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSVKED
FT                   VHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTV
FT                   DTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRC
FT                   QKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF
FT                   KLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKI
FT                   VKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLM
FT                   TKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGK
FT                   GSSGGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEFDSRRTLTSRGSMGREK
FT                   NDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAER
FT                   NKTRESAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGL
FT                   LHVFVRVGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDI
FT                   PHIWLYLAELVTPMLKEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKV
FT                   GALWREADLSWKDFLPEGEDVHNFLLEQKLDFIESDSPCSSEALSKKELSAEELYKRLE
FT                   KLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAAIIADSSTFRVDTAVIK
FT                   QRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKW
FT                   ESSKDPAEQNGKGVALKSVTAFFTWLREAEEESEDN"
FT   CDS             complement(join(3935995..3936176,3939414..3939560,
FT                   3941821..3941902,3945583..3945729,3953291..3953389,
FT                   3955807..3955888,3957337..3957462,3969046..3969218,
FT                   3977605..3977720,3979448..3979668,3981741..3981858,
FT                   3983159..3983252,3985584..3985678,3988566..3988698,
FT                   3990409..3990513,3992657..3992893,3993297..3993443,
FT                   4007510..4007707,4014386..4014556,4021701..4021820,
FT                   4023552..4023685,4027881..4028127,4033067..4033155,
FT                   4069673..4070512,4078185..4078293,4097662..4097784,
FT                   4101190..4101287,4108522..4108636,4109236..4109415,
FT                   4131107..4131136))
FT                   /codon_start=1
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_c"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT2258525.0
FT                   protein_id=hCP1855070.0 isoform=CRA_c"
FT                   /db_xref="GOA:O43432"
FT                   /db_xref="HGNC:HGNC:3298"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:1HU3"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43432"
FT                   /protein_id="EAW94956.1"
FT                   /translation="MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQAN
FT                   QHIMMVNHLPMPYPVPQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDF
FT                   PNAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGG
FT                   SRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKP
FT                   KPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAA
FT                   PTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPC
FT                   SVAPNDIPLVSSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKL
FT                   ECIPAPITPSTVPSFPPTPPTPPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESI
FT                   RTCLSEDAKEIQNKIEVEADGQTEEILDSQNLNSRRSPVPAQIAITVPKTWKKPKDRTR
FT                   TTEEMLEAELELKAEEELSIDKVLESEQDKMSQGFHPERDPSDLKKVKAVEENGEEAEP
FT                   VRNGAESVSEGEGIDANSGSTDSSGDGVTFPFKPESWKPTDTEGKKQYDREFLLDFQFM
FT                   PACIQKPEGLPPISDVVLDKINQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGV
FT                   PLLNVGSRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQADDPENIKTQE
FT                   LFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANM
FT                   CRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEER
FT                   TRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLC
FT                   RLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRA
FT                   DQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLD
FT                   PSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSALQPP
FT                   APSGSTPSTPVEFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQ
FT                   EEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSAHDKAALSEEELERK
FT                   SKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVRVGVESTLERSQITRDHMGQLLYQL
FT                   VQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKEGGISMRELTIEFS
FT                   KPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQKL
FT                   DFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPT
FT                   FLRALMTAVCKAAIIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVK
FT                   LDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNGKGVALKSVTAFFTWLREAE
FT                   EESEDN"
FT   mRNA            complement(join(<4109236..4109365,4131979..>4132223))
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant hCT2258522"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT2258522.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<4109236..4109365,4131979..4132223))
FT                   /codon_start=1
FT                   /gene="EIF4G3"
FT                   /locus_tag="hCG_1812032"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_a"
FT                   /note="gene_id=hCG1812032.1 transcript_id=hCT2258522.0
FT                   protein_id=hCP1855074.0 isoform=CRA_a"
FT                   /protein_id="EAW94954.1"
FT                   /translation="MMMRHDKAIYIGKFEIIDDQRAGKIVVNLTGRLNKCGVISLRYDV
FT                   QLKDLEKKWQNNLLSSCQFCFIVLTTLAGIMDLEEASSPSIRPGAQTPTAVYQANQHIM
FT                   MVNHLPMPYPVPQGPQYCIPQ"
FT   gene            complement(4345120..4473316)
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /note="gene_id=hCG38869.3"
FT   mRNA            complement(join(4345120..4345296,4347327..4347966,
FT                   4349582..4349677,4353085..4353275,4354994..4355061,
FT                   4355766..4355876,4361393..4361496,4363685..4363762,
FT                   4364581..4364679,4365969..4366079,4372824..4372938,
FT                   4375056..4375198,4383775..4383966,4385353..4385418,
FT                   4386521..4386667,4388099..4388220,4400525..4400737,
FT                   4407017..4407158,4417885..4417971,4418179..4418230,
FT                   4473188..4473316))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT1955776"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955776.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345120..4345296,4347327..4347966,
FT                   4349582..4349677,4353085..4353275,4354994..4355061,
FT                   4355766..4355876,4361393..4361496,4363685..4363762,
FT                   4364581..4364679,4365969..4366079,4372824..4372938,
FT                   4375056..4375198,4383775..4383966,4385353..4385418,
FT                   4386521..4386667,4388099..4388220,4400525..4400737,
FT                   4407017..4407158,4417885..4417971,4418179..4418230,
FT                   4472749..4472963))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT1686617"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1686617.1;
FT                   splice donor-acceptor pairs covered / total pairs = 18/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345584..4345755,4345964..4346680,
FT                   4346733..4347966,4349582..4349677,4353085..4353275,
FT                   4354994..4355061,4355766..4355876,4361393..4361496,
FT                   4363685..4363762,4364581..4364679,4365969..4366079,
FT                   4372824..4372938,4375056..4375198,4383775..4383966,
FT                   4385353..4385418,4386521..4386667,4388099..4388220,
FT                   4400525..4400737,4407017..4407158,4417885..4417971,
FT                   4473188..4473316))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254428"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254428.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345584..4345755,4345964..4346680,
FT                   4346733..4347966,4349582..4349677,4353085..4353275,
FT                   4354994..4355061,4355766..4355876,4361393..4361496,
FT                   4363685..4363762,4364581..4364679,4365969..4366079,
FT                   4372824..4372938,4375056..4375198,4383775..4383966,
FT                   4385353..4385418,4386521..4386667,4388099..4388220,
FT                   4400525..4400737,4407017..4407158,4417885..4417971,
FT                   4418179..4418230,4473188..4473316))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254416"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254416.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/21;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345584..4345755,4345964..4346680,
FT                   4346733..4347966,4353085..4353275,4354994..4355061,
FT                   4355766..4355876,4361393..4361496,4363685..4363762,
FT                   4364581..4364679,4365969..4366079,4372824..4372938,
FT                   4375056..4375198,4383775..4383966,4385353..4385418,
FT                   4386521..4386667,4388099..4388220,4400525..4400737,
FT                   4407017..4407158,4417885..4418028))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254422"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254422.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345584..4345755,4345964..4346680,
FT                   4346733..4347966,4349582..4349677,4353085..4353275,
FT                   4354994..4355061,4355766..4355876,4361393..4361496,
FT                   4363685..4363762,4364581..4364679,4365969..4366079,
FT                   4372824..4372938,4375056..4375198,4383775..4383966,
FT                   4385353..4385418,4386521..4386667,4388099..4388220,
FT                   4400525..4400737,4407017..4407158,4417885..4418028))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254420"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254420.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345584..4345755,4345964..4346680,
FT                   4346733..4347966,4349582..4349677,4353085..4353275,
FT                   4354994..4355061,4355766..4355876,4361393..4361496,
FT                   4363685..4363762,4364581..4364679,4365969..4366079,
FT                   4372824..4372938,4375056..4375198,4383775..4383966,
FT                   4385353..4385418,4386521..4386667,4388099..4388220,
FT                   4400525..4400737,4407017..4407319))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254425"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254425.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345964..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4418179..4418230))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT2254423"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254423.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345964..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4418028))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT1955777"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955777.1;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4345964..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407319))
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, transcript
FT                   variant hCT1955778"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955778.1;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4473188..4473190))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_e"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254428.0
FT                   protein_id=hCP1855127.0 isoform=CRA_e"
FT                   /db_xref="GOA:P42892"
FT                   /db_xref="HGNC:HGNC:3146"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="PDB:3DWB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42892"
FT                   /protein_id="EAW94964.1"
FT                   /translation="MMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAA
FT                   RTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVD
FT                   PCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQ
FT                   VYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFS
FT                   VYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDE
FT                   EAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIF
FT                   YPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADE
FT                   KFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKA
FT                   FEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFEN
FT                   AMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSS
FT                   PKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVEQYSN
FT                   YSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGF
FT                   AQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEV
FT                   W"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4418179..4418229))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_b"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955776.0
FT                   protein_id=hCP1765690.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF7"
FT                   /protein_id="EAW94958.1"
FT                   /translation="MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGL
FT                   QVNFHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEAC
FT                   VSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHL
FT                   LENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQD
FT                   TLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGY
FT                   LNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ
FT                   TLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLV
FT                   RKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAE
FT                   DSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELD
FT                   KVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEI
FT                   VFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSV
FT                   EAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHS
FT                   LPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHF
FT                   RCPPGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4418179..4418229))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_b"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254423.0
FT                   protein_id=hCP1855119.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF7"
FT                   /protein_id="EAW94962.1"
FT                   /translation="MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGL
FT                   QVNFHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEAC
FT                   VSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHL
FT                   LENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQD
FT                   TLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGY
FT                   LNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ
FT                   TLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLV
FT                   RKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAE
FT                   DSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELD
FT                   KVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEI
FT                   VFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSV
FT                   EAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHS
FT                   LPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHF
FT                   RCPPGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4418179..4418229))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_b"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1686617.1
FT                   protein_id=hCP1689908.2 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF7"
FT                   /protein_id="EAW94963.1"
FT                   /translation="MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGL
FT                   QVNFHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEAC
FT                   VSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHL
FT                   LENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQD
FT                   TLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGY
FT                   LNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ
FT                   TLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLV
FT                   RKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAE
FT                   DSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELD
FT                   KVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEI
FT                   VFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSV
FT                   EAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHS
FT                   LPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHF
FT                   RCPPGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4417971,4418179..4418229))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_b"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254416.0
FT                   protein_id=hCP1855123.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF7"
FT                   /protein_id="EAW94965.1"
FT                   /translation="MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGL
FT                   QVNFHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEAC
FT                   VSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHL
FT                   LENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQD
FT                   TLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGY
FT                   LNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQ
FT                   TLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLV
FT                   RKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAE
FT                   DSKSIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELD
FT                   KVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEI
FT                   VFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSV
FT                   EAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHS
FT                   LPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHF
FT                   RCPPGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4353085..4353275,
FT                   4354994..4355061,4355766..4355876,4361393..4361496,
FT                   4363685..4363762,4364581..4364679,4365969..4366079,
FT                   4372824..4372938,4375056..4375198,4383775..4383966,
FT                   4385353..4385418,4386521..4386667,4388099..4388220,
FT                   4400525..4400737,4407017..4407158,4417885..4418013))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_d"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254422.0
FT                   protein_id=hCP1855124.0 isoform=CRA_d"
FT                   /protein_id="EAW94960.1"
FT                   /translation="MEALRESVLHLALQMSTYKRATLDEEDLVDSLSEGDAYPNGLQVN
FT                   FHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSV
FT                   TSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLEN
FT                   STASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQ
FT                   VVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNY
FT                   MVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLA
FT                   PAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKT
FT                   SSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSK
FT                   SIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVF
FT                   NDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFP
FT                   AGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAF
FT                   KRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRVWCSVRTPESSHEGLIT
FT                   DPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4418013))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_c"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955777.1
FT                   protein_id=hCP1765696.0 isoform=CRA_c"
FT                   /db_xref="GOA:P42892"
FT                   /db_xref="HGNC:HGNC:3146"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="PDB:3DWB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42892"
FT                   /protein_id="EAW94959.1"
FT                   /translation="MEALRESVLHLALQMSTYKRATLDEEDLVDSLSEGDAYPNGLQVN
FT                   FHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSV
FT                   TSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLEN
FT                   STASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQ
FT                   VVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNY
FT                   MVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLA
FT                   PAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKT
FT                   SSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSK
FT                   SIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVF
FT                   NDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFP
FT                   AGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAF
FT                   KRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPT
FT                   LGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCP
FT                   PGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407158,
FT                   4417885..4418013))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_c"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254420.0
FT                   protein_id=hCP1855128.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB2"
FT                   /protein_id="EAW94966.1"
FT                   /translation="MEALRESVLHLALQMSTYKRATLDEEDLVDSLSEGDAYPNGLQVN
FT                   FHSPRSGQRCWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSV
FT                   TSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLEN
FT                   STASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQ
FT                   VVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNY
FT                   MVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLA
FT                   PAINWLPFLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKT
FT                   SSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSK
FT                   SIATEIILEIKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVF
FT                   NDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFP
FT                   AGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAF
FT                   KRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPT
FT                   LGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCP
FT                   PGSPMNPPHKCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407260))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_a"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT1955778.1
FT                   protein_id=hCP1765609.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB0"
FT                   /protein_id="EAW94957.1"
FT                   /translation="MPLQGLGLQRNPFLQGKRGPGLTSSPPLLPPSLQVNFHSPRSGQR
FT                   CWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMD
FT                   PTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAE
FT                   RKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTS
FT                   PFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLG
FT                   GGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFL
FT                   NTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQ
FT                   DADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILE
FT                   IKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDL
FT                   YFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFY
FT                   TRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVE
FT                   QYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLF
FT                   FLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPH
FT                   KCEVW"
FT   CDS             complement(join(4347790..4347966,4349582..4349677,
FT                   4353085..4353275,4354994..4355061,4355766..4355876,
FT                   4361393..4361496,4363685..4363762,4364581..4364679,
FT                   4365969..4366079,4372824..4372938,4375056..4375198,
FT                   4383775..4383966,4385353..4385418,4386521..4386667,
FT                   4388099..4388220,4400525..4400737,4407017..4407260))
FT                   /codon_start=1
FT                   /gene="ECE1"
FT                   /locus_tag="hCG_38869"
FT                   /product="endothelin converting enzyme 1, isoform CRA_a"
FT                   /note="gene_id=hCG38869.3 transcript_id=hCT2254425.0
FT                   protein_id=hCP1855122.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB0"
FT                   /protein_id="EAW94961.1"
FT                   /translation="MPLQGLGLQRNPFLQGKRGPGLTSSPPLLPPSLQVNFHSPRSGQR
FT                   CWAARTQVEKRLVVLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMD
FT                   PTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAE
FT                   RKAQVYYRACMNETRIEELRAKPLMELIERLGGWNITGPWAKDNFQDTLQVVTAHYRTS
FT                   PFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLG
FT                   GGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFL
FT                   NTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQ
FT                   DADEKFMEVMYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILE
FT                   IKKAFEESLSTLKWMDEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDL
FT                   YFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFY
FT                   TRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKRQTECMVE
FT                   QYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLF
FT                   FLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPH
FT                   KCEVW"
FT   gene            <4391596..>4394732
FT                   /locus_tag="hCG_2042497"
FT                   /note="gene_id=hCG2042497.0"
FT   mRNA            join(<4391596..4391637,4391729..4391809,4394674..>4394732)
FT                   /locus_tag="hCG_2042497"
FT                   /product="hCG2042497"
FT                   /note="gene_id=hCG2042497.0 transcript_id=hCT2347728.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-JUN-2003"
FT   CDS             join(<4391597..4391637,4391729..4391809,4394674..>4394732)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042497"
FT                   /product="hCG2042497"
FT                   /note="gene_id=hCG2042497.0 transcript_id=hCT2347728.0
FT                   protein_id=hCP1912678.0"
FT                   /protein_id="EAW94967.1"
FT                   /translation="PTANAGWGRSPGRREHLLSCRLQGTRAQVRLPGGRLLQGTRLAQK
FT                   TGGEAEAAQLALRSP"
FT   gene            4421105..4426222
FT                   /locus_tag="hCG_2045605"
FT                   /note="gene_id=hCG2045605.0"
FT   mRNA            join(4421105..4421558,4421749..4422025,4425842..4426222)
FT                   /locus_tag="hCG_2045605"
FT                   /product="hCG2045605"
FT                   /note="gene_id=hCG2045605.0 transcript_id=hCT2360440.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 16-AUG-2004"
FT   CDS             join(4421871..4422025,4425842..4425938)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045605"
FT                   /product="hCG2045605"
FT                   /note="gene_id=hCG2045605.0 transcript_id=hCT2360440.0
FT                   protein_id=hCP1925670.0"
FT                   /protein_id="EAW94968.1"
FT                   /translation="MRIFPLPNPLTPLRCLQRTRAPRRESGRAGPRTWVLDSWSCAPCG
FT                   RWNCFFRDKVSLYCPGCSNSWAQAILRPQPPKVMGLQS"
FT   gene            4526061..4526451
FT                   /pseudo
FT                   /locus_tag="hCG_1640327"
FT                   /note="gene_id=hCG1640327.4"
FT   mRNA            4526061..4526451
FT                   /pseudo
FT                   /locus_tag="hCG_1640327"
FT                   /note="gene_id=hCG1640327.4 transcript_id=hCT1640454.4;
FT                   overlap evidence=yes; created on 22-JAN-2004"
FT   gene            complement(4539243..4541417)
FT                   /locus_tag="hCG_1640622"
FT                   /note="gene_id=hCG1640622.3"
FT   mRNA            complement(join(4539243..4539770,4540956..4541417))
FT                   /locus_tag="hCG_1640622"
FT                   /product="hCG1640622"
FT                   /note="gene_id=hCG1640622.3 transcript_id=hCT1640749.3;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(4539268..4539741)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1640622"
FT                   /product="hCG1640622"
FT                   /note="gene_id=hCG1640622.3 transcript_id=hCT1640749.3
FT                   protein_id=hCP1638689.3"
FT                   /protein_id="EAW94969.1"
FT                   /translation="MVLMEGLCSKQGCRGSTLASSSERKPLENQLGKQEEFWVYGKSEN
FT                   ISVLRKDIKDLKAQLQNANKVIQNLKIRVWSLLVTSDYLSSLERPWKLGAVGTLEGSSP
FT                   HSVTDEDEVWLSDGTGAFYSPGLQAKKDLESLIQRVSQLEVQLPKKSTRREAG"
FT   gene            <4559459..>4561909
FT                   /locus_tag="hCG_2040315"
FT                   /note="gene_id=hCG2040315.0"
FT   mRNA            join(<4559459..4559685,4560399..4560493,4561166..4561249,
FT                   4561690..>4561909)
FT                   /locus_tag="hCG_2040315"
FT                   /product="hCG2040315"
FT                   /note="gene_id=hCG2040315.0 transcript_id=hCT2345525.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/3;
FT                   created on 18-JUN-2003"
FT   CDS             join(<4559460..4559685,4560399..4560493,4561166..4561249,
FT                   4561690..>4561909)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040315"
FT                   /product="hCG2040315"
FT                   /note="gene_id=hCG2040315.0 transcript_id=hCT2345525.0
FT                   protein_id=hCP1912670.0"
FT                   /protein_id="EAW94970.1"
FT                   /translation="GLGLSMGLQLAERRVEAALKKQALLQTQLEEQLQDKVLHEKGPGP
FT                   AADAKRPGQGSPQCQVGTWWVPHEAGVPAEVTELGLAVERLQKQNLEKDQVNKDLTKKL
FT                   EALESLWLQEQAALETEDGEELQQSLRDLAQAESGVQLSGSKCTVDASERSLRGLWGQR
FT                   TPSPPRCYSPGRGRSPRRGPSPACSDSSALALIHSALHKHQLQVQ"
FT   gene            4565237..>4605356
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /note="gene_id=hCG1812046.1"
FT   mRNA            join(4565237..4565447,4570047..4570318,4593787..4593996,
FT                   4595731..4595833,4596668..4596882,4597942..4598014,
FT                   4598479..4598684,4600000..4600051,4603245..4603408,
FT                   4604450..4604501,4605180..>4605356)
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   transcript variant hCT1955783"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT1955783.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4565237..4565447,4570047..4570318,4593787..4593996,
FT                   4595731..4595833,4596668..4596882,4597942..4598014,
FT                   4598479..4598684,4600000..4600051,4603170..>4603192)
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   transcript variant hCT2253622"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT2253622.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4565237..4565447,4570047..4570318,4578473..4580718)
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   transcript variant hCT2253623"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT2253623.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             join(4570186..4570318,4593787..4593996,4595731..4595833,
FT                   4596668..4596882,4597942..4598014,4598479..4598684,
FT                   4600000..4600051,4603245..4603408,4604450..4604501,
FT                   4605180..>4605356)
FT                   /codon_start=1
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT1955783.1
FT                   protein_id=hCP1765611.1 isoform=CRA_c"
FT                   /protein_id="EAW94973.1"
FT                   /translation="MPLTPTVQGFQWTLRGPDVETSPFGAPRAASHGVGRHQELRDPTV
FT                   PGPTSSATNVSMVVSAGPWSGEKAEMNILEINKKSRPQLAENKQQFRNLKQKCLVTQVA
FT                   YFLANRQNNYDYEDCKDLIKSMLRDERLLTEEKLAEELGQAEELRQYKVLVHSQERELT
FT                   QLREKLQEGRDASRSLNQHLQALLTPDEPDNSQGRDLREQLAEGCRLAQHLVQKLSPEN
FT                   DDDEDEDVKVEEAEKVQELYAPREVQKAEEKEVPEDSLEECAITCSNSHHPCESNQPYG
FT                   NTRITFEEDQVDSTLIDSSSHDEWLDAVCIIPENESDHEQEEEKGPVSPRNLQESEEEE
FT                   APQESWDEGDWTLSIPPDMSASYQSDRSTFHSVEEQQVGLALDIGRHWCDQVKKEDQEA
FT                   TSPRLSRELLDEKEPEVLQDSLDRFYSTPCGYLELPDLCQPYRSEFYSLQEQHLGLALD
FT                   VDS"
FT   CDS             join(4570186..4570318,4593787..4593996,4595731..4595833,
FT                   4596668..4596882,4597942..4598014,4598479..4598684,
FT                   4600000..4600051,4603170..>4603192)
FT                   /codon_start=1
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT2253622.0
FT                   protein_id=hCP1855166.0 isoform=CRA_b"
FT                   /protein_id="EAW94972.1"
FT                   /translation="MPLTPTVQGFQWTLRGPDVETSPFGAPRAASHGVGRHQELRDPTV
FT                   PGPTSSATNVSMVVSAGPWSGEKAEMNILEINKKSRPQLAENKQQFRNLKQKCLVTQVA
FT                   YFLANRQNNYDYEDCKDLIKSMLRDERLLTEEKLAEELGQAEELRQYKVLVHSQERELT
FT                   QLREKLQEGRDASRSLNQHLQALLTPDEPDNSQGRDLREQLAEGCRLAQHLVQKLSPEN
FT                   DDDEDEDVKVEEAEKVQELYAPREVQKAEEKEVPEDSLEECAITCSNSHHPCESNQPYG
FT                   NTRITFEEDQVDSTLIDSSSHDEWLDAVCIIPENESDHEQEEEKGPVSPRSSGRFCC"
FT   CDS             join(4570280..4570318,4578473..4578664)
FT                   /codon_start=1
FT                   /gene="NBPF3"
FT                   /locus_tag="hCG_1812046"
FT                   /product="neuroblastoma breakpoint family, member 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1812046.1 transcript_id=hCT2253623.0
FT                   protein_id=hCP1855165.0 isoform=CRA_a"
FT                   /protein_id="EAW94971.1"
FT                   /translation="MVWADIKSCEIQQLPSRKIQRHSPYQDVKKCTGEENSGMRVKVLW
FT                   HPSSAGWRSWREMLHGFALPAVSENNRVLEE"
FT   gene            4633846..4704067
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /note="gene_id=hCG38868.2"
FT   mRNA            join(4633846..4634032,4679670..4679834,4686298..4686417,
FT                   4686769..4686884,4688781..4688955,4689712..4689887,
FT                   4693775..4693918,4695976..4696045,4699336..4699470,
FT                   4701404..4701595,4702177..4702296,4703038..4704067)
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney,
FT                   transcript variant hCT2253629"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT2253629.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4635022..4635163,4679670..4679834,4686298..4686417,
FT                   4686769..4686884,4688781..4688955,4689712..4689887,
FT                   4693775..4693918,4695976..4696045,4699336..4699470,
FT                   4701404..4701595,4702177..4702296,4703038..4704067)
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney,
FT                   transcript variant hCT1777409"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT1777409.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4672995..4673157,4686298..4686417,4686769..4686884,
FT                   4688781..4688955,4689712..4689887,4693775..4693918,
FT                   4695976..4696045,4699336..4699470,4701404..4701595,
FT                   4702177..4702296,4703038..4704067)
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney,
FT                   transcript variant hCT1955775"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT1955775.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/10;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4676914..4677063,4679670..4679834,4686298..4686417,
FT                   4686769..4686884,4688781..4688955,4689712..4689887,
FT                   4693775..4693918,4695976..4696045,4699336..4699470,
FT                   4701404..4701595,4702177..4702296,4703038..4704067)
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney,
FT                   transcript variant hCT30114"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT30114.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             join(4679774..4679834,4686298..4686417,4686769..4686884,
FT                   4688781..4688955,4689712..4689887,4693775..4693918,
FT                   4695976..4696045,4699336..4699470,4701404..4701595,
FT                   4702177..4702296,4703038..4703303)
FT                   /codon_start=1
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT30114.3
FT                   protein_id=hCP48738.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAG0"
FT                   /protein_id="EAW94974.1"
FT                   /translation="MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQK
FT                   LNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTN
FT                   AQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGI
FT                   VTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGG
FT                   RKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPH
FT                   NVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGH
FT                   HEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLA
FT                   PMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGED
FT                   VAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALAL
FT                   YPLSVLF"
FT   CDS             join(4679774..4679834,4686298..4686417,4686769..4686884,
FT                   4688781..4688955,4689712..4689887,4693775..4693918,
FT                   4695976..4696045,4699336..4699470,4701404..4701595,
FT                   4702177..4702296,4703038..4703303)
FT                   /codon_start=1
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT2253629.0
FT                   protein_id=hCP1855173.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAG0"
FT                   /protein_id="EAW94975.1"
FT                   /translation="MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQK
FT                   LNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTN
FT                   AQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGI
FT                   VTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGG
FT                   RKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPH
FT                   NVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGH
FT                   HEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLA
FT                   PMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGED
FT                   VAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALAL
FT                   YPLSVLF"
FT   CDS             join(4679774..4679834,4686298..4686417,4686769..4686884,
FT                   4688781..4688955,4689712..4689887,4693775..4693918,
FT                   4695976..4696045,4699336..4699470,4701404..4701595,
FT                   4702177..4702296,4703038..4703303)
FT                   /codon_start=1
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT1777409.1
FT                   protein_id=hCP1713361.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAG0"
FT                   /protein_id="EAW94976.1"
FT                   /translation="MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQK
FT                   LNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTN
FT                   AQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGI
FT                   VTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGG
FT                   RKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPH
FT                   NVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGH
FT                   HEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLA
FT                   PMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGED
FT                   VAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALAL
FT                   YPLSVLF"
FT   CDS             join(4686402..4686417,4686769..4686884,4688781..4688955,
FT                   4689712..4689887,4693775..4693918,4695976..4696045,
FT                   4699336..4699470,4701404..4701595,4702177..4702296,
FT                   4703038..4703303)
FT                   /codon_start=1
FT                   /gene="ALPL"
FT                   /locus_tag="hCG_38868"
FT                   /product="alkaline phosphatase, liver/bone/kidney, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG38868.2 transcript_id=hCT1955775.1
FT                   protein_id=hCP1765705.1 isoform=CRA_b"
FT                   /db_xref="GOA:P05186"
FT                   /db_xref="HGNC:HGNC:438"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05186"
FT                   /protein_id="EAW94977.1"
FT                   /translation="MFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT
FT                   YNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGK
FT                   SVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVI
FT                   MGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLT
FT                   LDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRI
FT                   DHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSI
FT                   FGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETH
FT                   GGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSAGSLAAGPLLL
FT                   ALALYPLSVLF"
FT   gene            <4712156..4716808
FT                   /locus_tag="hCG_2041901"
FT                   /note="gene_id=hCG2041901.0"
FT   mRNA            join(<4712156..4712744,4716640..4716808)
FT                   /locus_tag="hCG_2041901"
FT                   /product="hCG2041901"
FT                   /note="gene_id=hCG2041901.0 transcript_id=hCT2347132.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             <4712331..4712711
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041901"
FT                   /product="hCG2041901"
FT                   /note="gene_id=hCG2041901.0 transcript_id=hCT2347132.0
FT                   protein_id=hCP1912683.0"
FT                   /protein_id="EAW94978.1"
FT                   /translation="GGGNIAVGTRVDISTAFPADQALFSRASQHTLTHLPRNQPWRAGT
FT                   VIFPILQMKKQKQKCLNLWEDTPLTRAGARTLAMQCGCRVQDFNHPLHPLASGRAGLQA
FT                   GFSPFPAAPTSCLLLESKFPVL"
FT   gene            complement(4721877..4794962)
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /note="gene_id=hCG37586.4"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4794893..4794962))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2254409"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254409.1;
FT                   splice donor-acceptor pairs covered / total pairs = 23/23;
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4729503..4729580,
FT                   4731730..4731861,4733869..4734006,4734506..4734592,
FT                   4735231..4735302,4735776..4735931,4737108..4737237,
FT                   4737372..4737472,4737682..4737765,4738832..4738885,
FT                   4739284..4739362,4739642..4739745,4742956..4743141,
FT                   4743584..4743622,4744675..4744722,4745665..4745700,
FT                   4751955..4752048,4775410..4775445,4794893..4794962))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2254405"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254405.1;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4790850..4790956,4794150..4794232,4794893..4794962))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2254407"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254407.1;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723750,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4729580,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4794893..4794944))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2357816"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2357816.0;
FT                   splice donor-acceptor pairs covered / total pairs = 23/23;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4775410..4775445,4790850..4790956,4793237..4793320))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT1848939"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT1848939.2;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4775410..4775445,4778783..4778960))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2254408"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254408.1;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4751955..4752048,
FT                   4775410..4775445,4777428..4777828))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT28819"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT28819.4; splice
FT                   donor-acceptor pairs covered / total pairs = 24/24; created
FT                   on 19-MAR-2003"
FT   mRNA            complement(join(4721877..4722919,4723341..4723383,
FT                   4723616..4723719,4724055..4724157,4725149..4725272,
FT                   4727353..4727466,4728473..4728582,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745700,4747990..4748172))
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, transcript
FT                   variant hCT2254410"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254410.1;
FT                   splice donor-acceptor pairs covered / total pairs = 22/22;
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745700,4751955..4752048,4775410..4775445,
FT                   4777428..4777471))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_c"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT28819.4
FT                   protein_id=hCP48744.3 isoform=CRA_c"
FT                   /db_xref="GOA:P47736"
FT                   /db_xref="HGNC:HGNC:9858"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="PDB:1SRQ"
FT                   /db_xref="PDB:3BRW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47736"
FT                   /protein_id="EAW94981.1"
FT                   /translation="MSGRKRSFTFGAYGGVDKSFTSRRSVWRSDGQNQHFPQALDLSRV
FT                   NLVPSYTPSLYPKNTDLFEMIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGRE
FT                   GPFPLILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEH
FT                   FNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAK
FT                   LVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEES
FT                   PAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTE
FT                   GDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVS
FT                   VTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALL
FT                   ETLYEELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPN
FT                   TVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEK
FT                   RESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSSS
FT                   ASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR
FT                   SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745700,4747990..4748064))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_e"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254410.1
FT                   protein_id=hCP1855146.1 isoform=CRA_e"
FT                   /db_xref="GOA:J3KPC5"
FT                   /db_xref="HGNC:HGNC:9858"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="UniProtKB/TrEMBL:J3KPC5"
FT                   /protein_id="EAW94984.1"
FT                   /translation="MAQLRPAVPPGRPRRGSLPAGASWQNTDLFEMIEKMQGSRMDEQR
FT                   CSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETEPLQ
FT                   SPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLR
FT                   TKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISN
FT                   NFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQT
FT                   GTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMI
FT                   ASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTK
FT                   LINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMENGSGGGGF
FT                   FESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPT
FT                   RKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEM
FT                   PTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKR
FT                   DSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC
FT                   "
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_b"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254407.1
FT                   protein_id=hCP1855142.1 isoform=CRA_b"
FT                   /db_xref="GOA:P47736"
FT                   /db_xref="HGNC:HGNC:9858"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="PDB:1SRQ"
FT                   /db_xref="PDB:3BRW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47736"
FT                   /protein_id="EAW94980.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPP
FT                   AGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFA
FT                   SVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPD
FT                   AGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_b"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254409.1
FT                   protein_id=hCP1855140.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB5"
FT                   /protein_id="EAW94982.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPP
FT                   AGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFA
FT                   SVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPD
FT                   AGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_b"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254408.1
FT                   protein_id=hCP1855145.1 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB5"
FT                   /protein_id="EAW94985.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPP
FT                   AGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFA
FT                   SVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPD
FT                   AGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4731730..4731861,4733869..4734006,
FT                   4734506..4734592,4735231..4735302,4735776..4735931,
FT                   4737108..4737237,4737372..4737472,4737682..4737765,
FT                   4738832..4738885,4739284..4739362,4739642..4739745,
FT                   4742956..4743141,4743584..4743622,4744675..4744722,
FT                   4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_b"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT1848939.2
FT                   protein_id=hCP1713342.2 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB5"
FT                   /protein_id="EAW94986.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPP
FT                   AGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFA
FT                   SVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPD
FT                   AGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4723375..4723383,4723616..4723719,
FT                   4724055..4724157,4725149..4725272,4727353..4727466,
FT                   4728473..4728582,4729503..4729580,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_a"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2254405.1
FT                   protein_id=hCP1855143.0 isoform=CRA_a"
FT                   /protein_id="EAW94979.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLLIPGKSASRFGRRGSAIGIGTVEESLIVPGKSPTRKKSG
FT                   PFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKN
FT                   RAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIY
FT                   STWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC"
FT   CDS             complement(join(4729155..4729580,4731730..4731861,
FT                   4733869..4734006,4734506..4734592,4735231..4735302,
FT                   4735776..4735931,4737108..4737237,4737372..4737472,
FT                   4737682..4737765,4738832..4738885,4739284..4739362,
FT                   4739642..4739745,4742956..4743141,4743584..4743622,
FT                   4744675..4744722,4745665..4745682))
FT                   /codon_start=1
FT                   /gene="RAP1GA1"
FT                   /locus_tag="hCG_37586"
FT                   /product="RAP1, GTPase activating protein 1, isoform CRA_d"
FT                   /note="gene_id=hCG37586.4 transcript_id=hCT2357816.0
FT                   protein_id=hCP1923056.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3V1A7"
FT                   /db_xref="HGNC:HGNC:9858"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="UniProtKB/TrEMBL:G3V1A7"
FT                   /protein_id="EAW94983.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYS
FT                   LDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTS
FT                   HSGSFAPNNPDLAKAAGISLLIPGKSASRFGRRGSAIGIGTVEEVVVRGAAGSGGCLHA
FT                   LFSARSQDGGHIGDVAPLPPGQAPGRAGWSGGSSDGTQHLLWGLVPVPEPVPLTRGFWP
FT                   CLGPWDPGPVPARIRYPKALHPAARPPISPVCMERHPSPLP"
FT   gene            complement(4804218..4909067)
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /note="gene_id=hCG1812038.1"
FT   mRNA            complement(join(4804218..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4827388..4827492,
FT                   4829402..4829508,4830152..4830282,4831617..4831727,
FT                   4832017..4832078,4832358..4832480,4832635..4832759,
FT                   4841280..4841348,4846927..4847054,4847541..4847655,
FT                   4849789..4849986,4854461..4854610,4855595..4855723,
FT                   4862337..4862516,4872959..4873041,4874030..4874163,
FT                   4877399..4877507,4878419..4878543,4878884..4879011,
FT                   4882439..4882595,4883556..4883676,4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT2254397"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254397.0;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4804218..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4820990..4821145,
FT                   4827388..4827492,4829402..4829508,4830152..4830282,
FT                   4831617..4831727,4832017..4832078,4832358..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847054,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855723,4862337..4862516,4872959..4873041,
FT                   4874030..4874163,4877399..4877507,4878419..4878543,
FT                   4878884..4879011,4882439..4882595,4883556..4883676,
FT                   4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT2254404"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254404.0;
FT                   splice donor-acceptor pairs covered / total pairs = 26/26;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4804218..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4827388..4827492,
FT                   4829402..4829508,4830152..4830282,4831617..4831727,
FT                   4832017..4832078,4832358..4832480,4832635..4832759,
FT                   4841280..4841348,4846927..4847057,4847541..4847655,
FT                   4849789..4849986,4854461..4854610,4855595..4855723,
FT                   4862337..4862516,4872959..4873041,4874030..4874163,
FT                   4877399..4877507,4878419..4878543,4878884..4879011,
FT                   4882439..4882595,4883556..4883676,4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT2254398"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254398.0;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4804218..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4820990..4821145,
FT                   4827388..4827492,4829402..4829508,4830152..4830282,
FT                   4831617..4831727,4832017..4832078,4832358..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847054,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855723,4862317..4862516,4872959..4873041,
FT                   4874030..4874163,4877399..4877507,4878419..4878543,
FT                   4878884..4879011,4882439..4882595,4883556..4883676,
FT                   4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT1955736"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT1955736.1;
FT                   splice donor-acceptor pairs covered / total pairs = 25/26;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4804541..4804732,4832465..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847057,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855723,4862337..4862516,4872959..4873041,
FT                   4874030..4874163,4877399..4877507,4878419..4878543,
FT                   4878884..4879011,4882439..4882595,4883556..4883676,
FT                   4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT2254402"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254402.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(4804725..4804732,4832465..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847057,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855723,4862337..4862516,4872959..4873041,
FT                   4874030..4874163,4877399..4877507,4878419..4878543,
FT                   4878884..4879011,4882439..4882595,4883556..4883676,
FT                   4908695..4908828))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_e"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254402.0
FT                   protein_id=hCP1855131.0 isoform=CRA_e"
FT                   /protein_id="EAW94991.1"
FT                   /translation="MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCR
FT                   RNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFL
FT                   QVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYI
FT                   DPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTV
FT                   CNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATR
FT                   KIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSA
FT                   VLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTR
FT                   KPKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMR
FT                   KQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHD
FT                   KLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYK
FT                   TVNNLLKAAVKGSDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESK
FT                   EERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQ
FT                   CKILEREGE"
FT   CDS             complement(join(4805055..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4827388..4827492,
FT                   4829402..4829508,4830152..4830282,4831617..4831727,
FT                   4832017..4832078,4832358..4832480,4832635..4832759,
FT                   4841280..4841348,4846927..4847054,4847541..4847655,
FT                   4849789..4849986,4854461..4854610,4855595..4855723,
FT                   4862337..4862516,4872959..4873041,4874030..4874163,
FT                   4877399..4877507,4878419..4878543,4878884..4879011,
FT                   4882439..4882595,4883556..4883676,4908695..4908828))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_d"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254397.0
FT                   protein_id=hCP1855130.0 isoform=CRA_d"
FT                   /protein_id="EAW94990.1"
FT                   /translation="MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCR
FT                   RNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFL
FT                   QVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYI
FT                   DPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTV
FT                   CNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATR
FT                   KIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSA
FT                   VLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTR
FT                   KPKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMR
FT                   KQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHD
FT                   KLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYK
FT                   TVNNLLKAAVKGDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKE
FT                   ERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQC
FT                   KILEREGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWR
FT                   KFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVV
FT                   DHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDN
FT                   KKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQIMHAFSVAPFDQNLSIDGKILS
FT                   DDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH"
FT   CDS             complement(join(4805055..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4820990..4821145,
FT                   4827388..4827492,4829402..4829508,4830152..4830282,
FT                   4831617..4831727,4832017..4832078,4832358..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847054,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855723,4862337..4862516,4872959..4873041,
FT                   4874030..4874163,4877399..4877507,4878419..4878543,
FT                   4878884..4879011,4882439..4882595,4883556..4883676,
FT                   4908695..4908828))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_b"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254404.0
FT                   protein_id=hCP1855133.0 isoform=CRA_b"
FT                   /protein_id="EAW94988.1"
FT                   /translation="MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCR
FT                   RNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFL
FT                   QVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYI
FT                   DPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTV
FT                   CNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATR
FT                   KIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSA
FT                   VLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTR
FT                   KPKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMR
FT                   KQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHD
FT                   KLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYK
FT                   TVNNLLKAAVKGDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKE
FT                   ERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQC
FT                   KILEREGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWR
FT                   KFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVV
FT                   DHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDN
FT                   KKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQV
FT                   IRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLG
FT                   TLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH"
FT   CDS             complement(join(4805055..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4827388..4827492,
FT                   4829402..4829508,4830152..4830282,4831617..4831727,
FT                   4832017..4832078,4832358..4832480,4832635..4832759,
FT                   4841280..4841348,4846927..4847057,4847541..4847655,
FT                   4849789..4849986,4854461..4854610,4855595..4855723,
FT                   4862337..4862516,4872959..4873041,4874030..4874163,
FT                   4877399..4877507,4878419..4878543,4878884..4879011,
FT                   4882439..4882595,4883556..4883676,4908695..4908828))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_a"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254398.0
FT                   protein_id=hCP1855135.0 isoform=CRA_a"
FT                   /protein_id="EAW94987.1"
FT                   /translation="MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCR
FT                   RNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFL
FT                   QVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYI
FT                   DPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTV
FT                   CNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATR
FT                   KIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSA
FT                   VLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTR
FT                   KPKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMR
FT                   KQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHD
FT                   KLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYK
FT                   TVNNLLKAAVKGSDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESK
FT                   EERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQ
FT                   CKILEREGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEW
FT                   RKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFV
FT                   VDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVD
FT                   NKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQIMHAFSVAPFDQNLSIDGKIL
FT                   SDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH"
FT   CDS             complement(join(4805055..4805077,4806446..4806472,
FT                   4812824..4812872,4815897..4816022,4820990..4821145,
FT                   4827388..4827492,4829402..4829508,4830152..4830282,
FT                   4831617..4831727,4832017..4832078,4832358..4832480,
FT                   4832635..4832759,4841280..4841348,4846927..4847054,
FT                   4847541..4847655,4849789..4849986,4854461..4854610,
FT                   4855595..4855652))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_f"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT1955736.1
FT                   protein_id=hCP1765662.0 isoform=CRA_f"
FT                   /protein_id="EAW94992.1"
FT                   /translation="MLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRK
FT                   QSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDK
FT                   LHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYKT
FT                   VNNLLKAAVKGDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEE
FT                   RKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCK
FT                   ILEREGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRK
FT                   FVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVD
FT                   HVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNK
FT                   KVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVI
FT                   RRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGT
FT                   LGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH"
FT   mRNA            complement(join(<4812795..4812872,4815897..4816022,
FT                   4820990..4821145,4827388..4827492,4829402..4829508,
FT                   4830152..4830282,4831617..4831727,4832017..4832078,
FT                   4832358..4832480,4832635..4832759,4841280..4841348,
FT                   4846927..4847054,4847541..4847655,4849789..4849865,
FT                   4849916..4849986,4854461..4854610,4855595..4855723,
FT                   4862337..4862516,4872959..4873041,4874030..4874163,
FT                   4877399..4877507,4878419..4878543,4878884..4879011,
FT                   4882439..4882595,4883556..4883676,4908695..4909067))
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, transcript
FT                   variant hCT2254403"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254403.0;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<4812795..4812872,4815897..4816022,
FT                   4820990..4821145,4827388..4827492,4829402..4829508,
FT                   4830152..4830282,4831617..4831727,4832017..4832078,
FT                   4832358..4832480,4832635..4832759,4841280..4841348,
FT                   4846927..4847054,4847541..4847655,4849789..4849865,
FT                   4849916..4849980))
FT                   /codon_start=1
FT                   /gene="USP48"
FT                   /locus_tag="hCG_1812038"
FT                   /product="ubiquitin specific peptidase 48, isoform CRA_c"
FT                   /note="gene_id=hCG1812038.1 transcript_id=hCT2254403.0
FT                   protein_id=hCP1855136.0 isoform=CRA_c"
FT                   /protein_id="EAW94989.1"
FT                   /translation="MSLSLWNGCKSGWMNQHLPNLLSIMKRISEYAADIFYSRYGGGPR
FT                   LTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGDGFWVGKSSLRSWRQLAL
FT                   EQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRL
FT                   VSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSLPNLFQ
FT                   DKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFT
FT                   FASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPE
FT                   CREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGE
FT                   KDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQ
FT                   IMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQG
FT                   KDEFVLGIC"
FT   gene            4938139..4951094
FT                   /gene="LDLRAD2"
FT                   /locus_tag="hCG_2045608"
FT                   /note="gene_id=hCG2045608.0"
FT   mRNA            join(4938139..4938410,4940271..4940696,4941816..4941947,
FT                   4947323..4947484,4948075..4951094)
FT                   /gene="LDLRAD2"
FT                   /locus_tag="hCG_2045608"
FT                   /product="low density lipoprotein receptor class A domain
FT                   containing 2"
FT                   /note="gene_id=hCG2045608.0 transcript_id=hCT2360443.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 16-AUG-2004"
FT   CDS             join(4938326..4938410,4940271..4940696,4941816..4941947,
FT                   4947323..4947484,4948075..4948088)
FT                   /codon_start=1
FT                   /gene="LDLRAD2"
FT                   /locus_tag="hCG_2045608"
FT                   /product="low density lipoprotein receptor class A domain
FT                   containing 2"
FT                   /note="gene_id=hCG2045608.0 transcript_id=hCT2360443.0
FT                   protein_id=hCP1925673.0"
FT                   /db_xref="GOA:Q5SZI1"
FT                   /db_xref="HGNC:HGNC:32071"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SZI1"
FT                   /protein_id="EAW94993.1"
FT                   /translation="MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLL
FT                   LRSHAASRRFYFVAPDTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPA
FT                   DPCAPGSYLQFYEGPPGAPRPLGSPLCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVG
FT                   EVTSFRLGPCGAYFRCQNGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQ
FT                   TGSTDAHTSRSLTPSPALGSAGSLWIAAERSSPAGRDPTRQDAALEGSTE"
FT   gene            complement(4948117..5022197)
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /note="gene_id=hCG1981506.0"
FT   mRNA            complement(join(4948117..4948199,4948687..4949361,
FT                   4949489..4949592,4949994..4950077,4950179..4950249,
FT                   4950410..4950488,4950577..4950652,4953736..4953792,
FT                   4953903..4954025,4954128..4954299,4954708..4954952,
FT                   4955256..4955477,4955866..4955964,4956855..4956963,
FT                   4957088..4957197,4957336..4957435,4957525..4957669,
FT                   4958368..4958479,4959141..4959257,4959340..4959487,
FT                   4959689..4959798,4960552..4960818,4961413..4961510,
FT                   4962675..4962879,4964699..4964959,4965245..4965424,
FT                   4965696..4965891,4966975..4967159,4967413..4967547,
FT                   4967876..4968016,4968113..4968254,4968644..4968795,
FT                   4969171..4969312,4970022..4970173,4971982..4972129,
FT                   4972322..4972473,4973228..4973366,4973563..4973714,
FT                   4973832..4973967,4974517..4974668,4974767..4974905,
FT                   4975915..4976066,4976237..4976372,4977420..4977571,
FT                   4977665..4977800,4977962..4978107,4978574..4978706,
FT                   4978793..4978944,4980067..4980217,4980485..4980639,
FT                   4980722..4980857,4981178..4981320,4981397..4981549,
FT                   4981661..4981786,4982889..4983069,4983159..4983259,
FT                   4985440..4985550,4985709..4985876,4986051..4986109,
FT                   4987629..4987715,4987860..4987987,4989971..4990084,
FT                   4990714..4990944,4991156..4991236,4991588..4991680,
FT                   4998060..4998251,4998494..4998634,4998871..4998965,
FT                   4999249..4999298,4999799..4999885,5000280..5000407,
FT                   5000490..5000603,5000765..5000876,5001503..5001621,
FT                   5001737..5001916,5002103..5002279,5002386..5002526,
FT                   5004061..5004128,5004308..5004366,5004452..5004538,
FT                   5004869..5004996,5005982..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010548,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5021796..5021840,5022049..5022197))
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   transcript variant hCT2254395"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254395.0;
FT                   splice donor-acceptor pairs covered / total pairs = 93/93;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4948117..4948199,4948687..4949361,
FT                   4949489..4949592,4949994..4950077,4950179..4950249,
FT                   4950410..4950488,4950577..4950652,4953736..4953792,
FT                   4953903..4954025,4954128..4954299,4954708..4954952,
FT                   4955256..4955477,4955866..4955964,4956855..4956963,
FT                   4957088..4957197,4957336..4957435,4957525..4957669,
FT                   4958368..4958479,4959141..4959257,4959340..4959487,
FT                   4959689..4959798,4960552..4960818,4961413..4961510,
FT                   4962675..4962879,4964699..4964959,4965245..4965424,
FT                   4965696..4965891,4966975..4967159,4967413..4967547,
FT                   4967876..4968016,4968113..4968254,4968644..4968795,
FT                   4969171..4969312,4970022..4970173,4971982..4972129,
FT                   4972322..4972473,4973228..4973366,4973563..4973714,
FT                   4973832..4973967,4974517..4974668,4974767..4974905,
FT                   4975915..4976066,4976237..4976372,4977420..4977571,
FT                   4977665..4977800,4977962..4978107,4978574..4978706,
FT                   4978793..4978944,4980067..4980217,4980485..4980639,
FT                   4980722..4980857,4981178..4981320,4981397..4981549,
FT                   4981661..4981786,4982889..4983069,4983159..4983259,
FT                   4985440..4985550,4985709..4985876,4986051..4986109,
FT                   4987629..4987715,4987860..4987987,4989971..4990084,
FT                   4990714..4990944,4991156..4991236,4991588..4991680,
FT                   4998060..4998251,4998494..4998634,4998871..4998965,
FT                   4999249..4999298,4999799..4999885,5000280..5000407,
FT                   5000490..5000603,5000765..5000876,5001503..5001621,
FT                   5001737..5001916,5002103..5002279,5002386..5002526,
FT                   5004061..5004128,5004308..5004366,5004452..5004538,
FT                   5004869..5004996,5005982..5006129,5006238..5006434,
FT                   5006531..5006710,5007214..5007377,5010402..5010548,
FT                   5010641..5010792,5010887..5011031,5011194..5011325,
FT                   5013088..5013207,5013293..5013547,5013811..5013939,
FT                   5015854..5016014,5016300..5016358,5016458..5016567,
FT                   5021796..5021840,5022049..5022197))
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   transcript variant hCT2254394"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254394.0;
FT                   splice donor-acceptor pairs covered / total pairs = 96/96;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(4948118..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004996,
FT                   5005982..5006129,5006238..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010548,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5016300..5016358,5016458..5016567,5021796..5021840,
FT                   5022049..5022197))
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   transcript variant hCT2357822"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2357822.0;
FT                   splice donor-acceptor pairs covered / total pairs = 95/95;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(4948124..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004996,
FT                   5005982..5006129,5006238..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010551,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5016300..5016358,5016458..5016567,5021796..5021840,
FT                   5022049..5022197))
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   transcript variant hCT2254396"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254396.0;
FT                   splice donor-acceptor pairs covered / total pairs = 95/95;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(4949189..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004996,
FT                   5005982..5006129,5006238..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010548,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5016300..5016358,5016458..5016567,5021796..5021840,
FT                   5022049..5022112))
FT                   /codon_start=1
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254394.0
FT                   protein_id=hCP1855116.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB6"
FT                   /protein_id="EAW94995.1"
FT                   /translation="MRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNF
FT                   TRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELD
FT                   VGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHS
FT                   YNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPP
FT                   VTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCE
FT                   PNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPAS
FT                   FHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNW
FT                   GHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRG
FT                   PCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPG
FT                   TPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYE
FT                   LARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQRA
FT                   ELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSG
FT                   LSCESCDAHFTRVPGGPYLGTCSGCSCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAG
FT                   FFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPG
FT                   YEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTR
FT                   NPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGE
FT                   LGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQG
FT                   NNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASY
FT                   AQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLY
FT                   LGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPC
FT                   YGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQVP
FT                   GPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMG
FT                   ITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFA
FT                   QLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVAS
FT                   QPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASI
FT                   SAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCEC
FT                   NGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMF
FT                   SRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVEVHP
FT                   ARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAG
FT                   VYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPA
FT                   YTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
FT                   GTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILR
FT                   LPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYCR
FT                   AAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQAR
FT                   IQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQ
FT                   VHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIR
FT                   IEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSG
FT                   EYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAH
FT                   AQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGAN
FT                   LAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSL
FT                   LRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAE
FT                   GQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSS
FT                   GTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWY
FT                   KRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPS
FT                   VSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQM
FT                   SVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLD
FT                   LNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLEA
FT                   SVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKR
FT                   GGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPG
FT                   LAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLV
FT                   SPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDAS
FT                   FKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGV
FT                   AQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQ
FT                   RTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAE
FT                   EAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQY
FT                   ICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRV
FT                   GSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSI
FT                   PAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRI
FT                   QNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECLA
FT                   LGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLL
FT                   VQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLPS
FT                   VRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIK
FT                   ITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRH
FT                   PTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAI
FT                   PKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSS
FT                   YVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGV
FT                   TVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAM
FT                   VGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKS
FT                   QGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQC
FT                   YDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQG
FT                   TRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGHVFS
FT                   RSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSGE
FT                   ARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAP
FT                   DVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS"
FT   CDS             complement(join(4949189..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004996,
FT                   5005982..5006129,5006238..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010548,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5016300..5016358,5016458..5016567,5021796..5021840,
FT                   5022049..5022112))
FT                   /codon_start=1
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2357822.0
FT                   protein_id=hCP1923044.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB6"
FT                   /protein_id="EAW94996.1"
FT                   /translation="MRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNF
FT                   TRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELD
FT                   VGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHS
FT                   YNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPP
FT                   VTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCE
FT                   PNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPAS
FT                   FHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNW
FT                   GHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRG
FT                   PCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPG
FT                   TPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRYE
FT                   LARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQRA
FT                   ELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSG
FT                   LSCESCDAHFTRVPGGPYLGTCSGCSCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAG
FT                   FFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPG
FT                   YEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTR
FT                   NPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGE
FT                   LGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQG
FT                   NNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRASY
FT                   AQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLY
FT                   LGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPC
FT                   YGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQVP
FT                   GPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMG
FT                   ITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFA
FT                   QLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVAS
FT                   QPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASI
FT                   SAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCEC
FT                   NGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMF
FT                   SRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVEVHP
FT                   ARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDAG
FT                   VYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPA
FT                   YTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
FT                   GTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILR
FT                   LPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYCR
FT                   AAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQAR
FT                   IQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQ
FT                   VHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPIR
FT                   IEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSG
FT                   EYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAH
FT                   AQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGAN
FT                   LAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSL
FT                   LRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVAE
FT                   GQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSS
FT                   GTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWY
FT                   KRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPS
FT                   VSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQM
FT                   SVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETLD
FT                   LNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLEA
FT                   SVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHKR
FT                   GGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPG
FT                   LAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHLV
FT                   SPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDAS
FT                   FKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGV
FT                   AQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQ
FT                   RTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAE
FT                   EAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQY
FT                   ICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRV
FT                   GSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSI
FT                   PAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRI
FT                   QNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECLA
FT                   LGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLL
FT                   VQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLPS
FT                   VRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIK
FT                   ITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRH
FT                   PTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAI
FT                   PKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSS
FT                   YVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGV
FT                   TVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAM
FT                   VGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKS
FT                   QGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQC
FT                   YDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQG
FT                   TRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGHVFS
FT                   RSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSGE
FT                   ARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAP
FT                   DVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS"
FT   CDS             complement(join(4949189..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004996,
FT                   5005982..5006129,5006238..5006434,5006531..5006710,
FT                   5007214..5007377,5010402..5010551,5010641..5010792,
FT                   5010887..5011031,5011194..5011325,5013088..5013207,
FT                   5013293..5013547,5013811..5013939,5015854..5016014,
FT                   5016300..5016358,5016458..5016567,5021796..5021840,
FT                   5022049..5022112))
FT                   /codon_start=1
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254396.0
FT                   protein_id=hCP1855115.0 isoform=CRA_c"
FT                   /protein_id="EAW94997.1"
FT                   /translation="MRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNF
FT                   TRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELDGWVFVELD
FT                   VGSEGNADGAQIQEMLLRVISSGSVASYVTSPQGFQFRRLGTVPQFPRACTEAEFACHS
FT                   YNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTSLPPRPETTIMRQPP
FT                   VTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCE
FT                   PNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPAS
FT                   FHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQTVTFTCVAIGVPTPIINWRLNW
FT                   GHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRA
FT                   GPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQP
FT                   GTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYNVRY
FT                   ELARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQRQVQFSEEHWVHESGRPVQR
FT                   AELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYS
FT                   GLSCESCDAHFTRVPGGPYLGTCSGCSCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKA
FT                   GFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAP
FT                   GYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLST
FT                   RNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPG
FT                   ELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQ
FT                   GNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRAS
FT                   YAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGL
FT                   YLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCP
FT                   CYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQV
FT                   PGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCM
FT                   GITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNF
FT                   AQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVA
FT                   SQPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAAS
FT                   ISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCE
FT                   CNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENM
FT                   FSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQAPLVVEVH
FT                   PARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSDA
FT                   GVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSP
FT                   AYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQA
FT                   SGTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGIL
FT                   RLPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHAGRTVRLYC
FT                   RAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQA
FT                   RIQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHT
FT                   QVHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTRPI
FT                   RIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADS
FT                   GEYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQA
FT                   HAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGA
FT                   NLAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGS
FT                   LLRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSQVA
FT                   EGQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGS
FT                   SGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITW
FT                   YKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVP
FT                   SVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQ
FT                   MSVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSSHVAEGETL
FT                   DLNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRVMGSSGPLE
FT                   ASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQAHAQVTWHK
FT                   RGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAP
FT                   GLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHL
FT                   VSPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDA
FT                   SFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYG
FT                   VAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLE
FT                   QRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQA
FT                   EEAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQ
FT                   YICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSR
FT                   VGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATS
FT                   IPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLR
FT                   IQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVGHAVEFECL
FT                   ALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLL
FT                   LVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLMLP
FT                   SVRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEI
FT                   KITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIR
FT                   HPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGA
FT                   IPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESS
FT                   SYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEG
FT                   VTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLA
FT                   MVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGK
FT                   SQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQ
FT                   CYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQ
FT                   GTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGHVF
FT                   SRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSG
FT                   EARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGA
FT                   PDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS"
FT   CDS             complement(join(4949189..4949361,4949489..4949592,
FT                   4949994..4950077,4950179..4950249,4950410..4950488,
FT                   4950577..4950652,4953736..4953792,4953903..4954025,
FT                   4954128..4954299,4954708..4954952,4955256..4955477,
FT                   4955866..4955964,4956855..4956963,4957088..4957197,
FT                   4957336..4957435,4957525..4957669,4958368..4958479,
FT                   4959141..4959257,4959340..4959487,4959689..4959798,
FT                   4960552..4960818,4961413..4961510,4962675..4962879,
FT                   4964699..4964959,4965245..4965424,4965696..4965891,
FT                   4966975..4967159,4967413..4967547,4967876..4968016,
FT                   4968113..4968254,4968644..4968795,4969171..4969312,
FT                   4970022..4970173,4971982..4972129,4972322..4972473,
FT                   4973228..4973366,4973563..4973714,4973832..4973967,
FT                   4974517..4974668,4974767..4974905,4975915..4976066,
FT                   4976237..4976372,4977420..4977571,4977665..4977800,
FT                   4977962..4978107,4978574..4978706,4978793..4978944,
FT                   4980067..4980217,4980485..4980639,4980722..4980857,
FT                   4981178..4981320,4981397..4981549,4981661..4981786,
FT                   4982889..4983069,4983159..4983259,4985440..4985550,
FT                   4985709..4985876,4986051..4986109,4987629..4987715,
FT                   4987860..4987987,4989971..4990084,4990714..4990944,
FT                   4991156..4991236,4991588..4991680,4998060..4998251,
FT                   4998494..4998634,4998871..4998965,4999249..4999298,
FT                   4999799..4999885,5000280..5000407,5000490..5000603,
FT                   5000765..5000876,5001503..5001621,5001737..5001916,
FT                   5002103..5002279,5002386..5002526,5004061..5004128,
FT                   5004308..5004366,5004452..5004538,5004869..5004930))
FT                   /codon_start=1
FT                   /gene="HSPG2"
FT                   /locus_tag="hCG_1981506"
FT                   /product="heparan sulfate proteoglycan 2 (perlecan),
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1981506.0 transcript_id=hCT2254395.0
FT                   protein_id=hCP1855117.0 isoform=CRA_a"
FT                   /protein_id="EAW94994.1"
FT                   /translation="MKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTG
FT                   RRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECA
FT                   DGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAASTHTTNE
FT                   GIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLH
FT                   GQPLVVLQGNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMALAGI
FT                   DTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTG
FT                   YTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGT
FT                   PQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQ
FT                   PCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPD
FT                   GCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEG
FT                   AQLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQIT
FT                   GNNIMLVASQPALQGPERRSYEIMFREEFWRRPDGQPATREHLLMALADLDELLIRATF
FT                   SSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLY
FT                   LGHCELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCAC
FT                   PLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGQCLPETNQ
FT                   APLVVEVHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHF
FT                   PSVQPSDAGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFI
FT                   CTAKSKSPAYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQG
FT                   TATLHVQASGTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAK
FT                   AQIHGGILRLPAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHA
FT                   GRTVRLYCRAAGVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVAT
FT                   SPAGTAQARIQVVVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRR
FT                   GGSLPPHTQVHGSRLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTP
FT                   VPGSTRPIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRL
FT                   HQVTPADSGEYVCHVVGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDL
FT                   SCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITV
FT                   TVTGTQGANLAYPAGSTQPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLP
FT                   VRHQTHGSLLRLYQASPADSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRI
FT                   ESSSSQVAEGQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPADSGE
FT                   YVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVAS
FT                   QAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQ
FT                   GSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTH
FT                   GSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPSAGSPSAPGSSMPIRIESSSS
FT                   HVAEGETLDLNCVVPGQAHAQVTWHKRGGSLPSHHQTRGSRLRLHHVSPADSGEYVCRV
FT                   MGSSGPLEASVLVTIEASGSSAVHVPAPGGAPPIRIEPSSSRVAEGQTLDLKCVVPGQA
FT                   HAQVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPS
FT                   SPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTH
FT                   GSQLRLHLVSPADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSS
FT                   TVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYR
FT                   CVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRI
FT                   SSTPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMA
FT                   PGAPQVQAEEAELTVEAGHTATLRCSATGSPAPTIHWSKLRSPLPWQHRLEGDTLIIPR
FT                   VAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTP
FT                   PLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGP
FT                   PGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGH
FT                   SVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPSVLINIRTSVQTVVVG
FT                   HAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAG
FT                   TTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRL
FT                   ENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIK
FT                   DAYRKFEIKITFRPDSADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDA
FT                   GSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYL
FT                   GGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGG
FT                   QCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGR
FT                   SGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGP
FT                   VEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRP
FT                   VLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSF
FT                   LGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREP
FT                   CLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGF
FT                   LAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFISLGLQDGHLV
FT                   FRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSPGPNVAVNAK
FT                   GSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRAQAGANTRP
FT                   CPS"
FT   gene            5033923..5034498
FT                   /pseudo
FT                   /locus_tag="hCG_39965"
FT                   /note="gene_id=hCG39965.3"
FT   mRNA            5033923..5034498
FT                   /pseudo
FT                   /locus_tag="hCG_39965"
FT                   /note="gene_id=hCG39965.3 transcript_id=hCT31218.4; overlap
FT                   evidence=yes; created on 30-JAN-2004"
FT   gene            complement(5076531..5077371)
FT                   /pseudo
FT                   /locus_tag="hCG_1739577"
FT                   /note="gene_id=hCG1739577.2"
FT   mRNA            complement(5076531..5077371)
FT                   /pseudo
FT                   /locus_tag="hCG_1739577"
FT                   /note="gene_id=hCG1739577.2 transcript_id=hCT1777670.1;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   gene            5102645..5124573
FT                   /gene="ELA3B"
FT                   /locus_tag="hCG_1812047"
FT                   /note="gene_id=hCG1812047.2"
FT   mRNA            join(5102645..5102833,5104120..5104205,5106573..5106670,
FT                   5106787..5106921,5109444..5109580,5109939..5110081,
FT                   5112287..5112439,5124083..5124573)
FT                   /gene="ELA3B"
FT                   /locus_tag="hCG_1812047"
FT                   /product="elastase 3B, pancreatic, transcript variant
FT                   hCT2253634"
FT                   /note="gene_id=hCG1812047.2 transcript_id=hCT2253634.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 08-SEP-2004"
FT   mRNA            join(5102645..5102833,5104120..5104205,5106573..5106670,
FT                   5106787..5106921,5109444..5109580,5109939..5110081,
FT                   5112287..5112439,5115015..5115109)
FT                   /gene="ELA3B"
FT                   /locus_tag="hCG_1812047"
FT                   /product="elastase 3B, pancreatic, transcript variant
FT                   hCT2253637"
FT                   /note="gene_id=hCG1812047.2 transcript_id=hCT2253637.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 08-SEP-2004"
FT   CDS             join(5102791..5102833,5104120..5104205,5106573..5106670,
FT                   5106787..5106921,5109444..5109580,5109939..5110081,
FT                   5112287..5112439,5124083..5124121)
FT                   /codon_start=1
FT                   /gene="ELA3B"
FT                   /locus_tag="hCG_1812047"
FT                   /product="elastase 3B, pancreatic, isoform CRA_a"
FT                   /note="gene_id=hCG1812047.2 transcript_id=hCT2253634.0
FT                   protein_id=hCP1855153.0 isoform=CRA_a"
FT                   /protein_id="EAW94998.1"
FT                   /translation="MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVS
FT                   LQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINS
FT                   GDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWG
FT                   RLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLN
FT                   CPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEEKLQGNKAPESRT"
FT   CDS             join(5102791..5102833,5104120..5104205,5106573..5106670,
FT                   5106787..5106921,5109444..5109580,5109939..5110081,
FT                   5112287..5112439,5115015..5115032)
FT                   /codon_start=1
FT                   /gene="ELA3B"
FT                   /locus_tag="hCG_1812047"
FT                   /product="elastase 3B, pancreatic, isoform CRA_b"
FT                   /note="gene_id=hCG1812047.2 transcript_id=hCT2253637.0
FT                   protein_id=hCP1855151.0 isoform=CRA_b"
FT                   /db_xref="GOA:P08861"
FT                   /db_xref="HGNC:HGNC:15945"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08861"
FT                   /protein_id="EAW94999.1"
FT                   /translation="MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVS
FT                   LQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINS
FT                   GDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWG
FT                   RLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLN
FT                   CPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH"
FT   gene            5127588..5138479
FT                   /gene="ELA3A"
FT                   /locus_tag="hCG_2045900"
FT                   /note="gene_id=hCG2045900.0"
FT   mRNA            join(5127588..5127649,5128935..5129020,5131379..5131476,
FT                   5131594..5131728,5132807..5132943,5133302..5133444,
FT                   5135643..5135795,5136076..5136123,5138387..5138479)
FT                   /gene="ELA3A"
FT                   /locus_tag="hCG_2045900"
FT                   /product="elastase 3A, pancreatic, transcript variant
FT                   hCT1955788"
FT                   /note="gene_id=hCG2045900.0 transcript_id=hCT1955788.2;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 08-SEP-2004"
FT   mRNA            join(5127588..5127649,5128935..5129020,5131379..5131476,
FT                   5131594..5131728,5132807..5132943,5133302..5133444,
FT                   5135643..5135795,5138387..5138479)
FT                   /gene="ELA3A"
FT                   /locus_tag="hCG_2045900"
FT                   /product="elastase 3A, pancreatic, transcript variant
FT                   hCT2253636"
FT                   /note="gene_id=hCG2045900.0 transcript_id=hCT2253636.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 08-SEP-2004"
FT   CDS             join(5127607..5127649,5128935..5129020,5131379..5131476,
FT                   5131594..5131728,5132807..5132943,5133302..5133444,
FT                   5135643..5135795,5138387..5138404)
FT                   /codon_start=1
FT                   /gene="ELA3A"
FT                   /locus_tag="hCG_2045900"
FT                   /product="elastase 3A, pancreatic, isoform CRA_a"
FT                   /note="gene_id=hCG2045900.0 transcript_id=hCT2253636.1
FT                   protein_id=hCP1855152.1 isoform=CRA_a"
FT                   /protein_id="EAW95000.1"
FT                   /translation="MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVS
FT                   LQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINS
FT                   EELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWG
FT                   RLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLN
FT                   CPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH"
FT   CDS             join(5127607..5127649,5128935..5129020,5131379..5131476,
FT                   5131594..5131728,5132807..5132943,5133302..5133444,
FT                   5135643..5135795,5136076..5136084)
FT                   /codon_start=1
FT                   /gene="ELA3A"
FT                   /locus_tag="hCG_2045900"
FT                   /product="elastase 3A, pancreatic, isoform CRA_b"
FT                   /note="gene_id=hCG2045900.0 transcript_id=hCT1955788.2
FT                   protein_id=hCP1765641.2 isoform=CRA_b"
FT                   /protein_id="EAW95001.1"
FT                   /translation="MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVS
FT                   LQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINS
FT                   EELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWG
FT                   RLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLN
FT                   CPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEEGG"
FT   gene            5151439..5218838
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /note="gene_id=hCG1981007.0"
FT   mRNA            join(5151439..5151575,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5217317..5217665,
FT                   5217729..5217826,5217877..5218830)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253639"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253639.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5151439..5151575,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5217317..5217826,
FT                   5217877..5218699,5218752..5218819)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253640"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253640.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5151439..5151575,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5215832..5216892)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253641"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253641.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5151466..5151575,5156207..5157142)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253645"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253645.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             5156645..5156983
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_b"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253645.0
FT                   protein_id=hCP1855158.0 isoform=CRA_b"
FT                   /protein_id="EAW95005.1"
FT                   /translation="MSSWNQNHWLSLAACFLLSLHMRSQPSILLDARSNCTHGKSELPL
FT                   SLSLSLVVIRIHQNPCLDLSLAEAALFPTEFLCPLVRTISLLLWAFPRAYFSSAGCLFF
FT                   FFFFFCTV"
FT   mRNA            join(5178614..5178667,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5217317..5218838)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253644"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253644.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5178614..5178667,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5215832..5216892)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253646"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253646.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5178626..5178667,5199975..5200100,5204310..5204464,
FT                   5207603..5207675,5212328..5212437,5212558..5212755,
FT                   5215832..5216892)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253638"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253638.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5179217..5179433,5204310..5204464,5207603..5207675,
FT                   5212328..5212437,5212558..5212755,5217317..5218838)
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), transcript variant hCT2253642"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253642.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5217317..5217406)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_a"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253639.0
FT                   protein_id=hCP1855162.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE4"
FT                   /protein_id="EAW95002.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKSRRCVLL"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5217317..5217406)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_a"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253640.0
FT                   protein_id=hCP1855163.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE4"
FT                   /protein_id="EAW95003.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKSRRCVLL"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5217317..5217406)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_a"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253644.0
FT                   protein_id=hCP1855156.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE4"
FT                   /protein_id="EAW95004.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKSRRCVLL"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5217317..5217406)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_a"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253642.0
FT                   protein_id=hCP1855160.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE4"
FT                   /protein_id="EAW95007.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKSRRCVLL"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5215832..5215921)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_c"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253638.0
FT                   protein_id=hCP1855159.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE6"
FT                   /protein_id="EAW95006.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQR
FT                   GLKNVFDEAILAALEPPETQPKRKCCIF"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5215832..5215921)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_c"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253641.0
FT                   protein_id=hCP1855164.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE6"
FT                   /protein_id="EAW95008.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQR
FT                   GLKNVFDEAILAALEPPETQPKRKCCIF"
FT   CDS             join(5204360..5204464,5207603..5207675,5212328..5212437,
FT                   5212558..5212755,5215832..5215921)
FT                   /codon_start=1
FT                   /gene="CDC42"
FT                   /locus_tag="hCG_1981007"
FT                   /product="cell division cycle 42 (GTP binding protein,
FT                   25kDa), isoform CRA_c"
FT                   /note="gene_id=hCG1981007.0 transcript_id=hCT2253646.0
FT                   protein_id=hCP1855157.0 isoform=CRA_c"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE6"
FT                   /protein_id="EAW95009.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQR
FT                   GLKNVFDEAILAALEPPETQPKRKCCIF"
FT   gene            complement(5245579..5268835)
FT                   /gene="WNT4"
FT                   /locus_tag="hCG_39970"
FT                   /note="gene_id=hCG39970.2"
FT   mRNA            complement(join(5245579..5246387,5247081..5247223,
FT                   5247315..5247446,5255486..5255721,5268715..5268835))
FT                   /gene="WNT4"
FT                   /locus_tag="hCG_39970"
FT                   /product="wingless-type MMTV integration site family,
FT                   member 4"
FT                   /note="gene_id=hCG39970.2 transcript_id=hCT31223.2; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(5245920..5246387,5247081..5247223,
FT                   5247315..5247446,5255486..5255721,5268715..5268791))
FT                   /codon_start=1
FT                   /gene="WNT4"
FT                   /locus_tag="hCG_39970"
FT                   /product="wingless-type MMTV integration site family,
FT                   member 4"
FT                   /note="gene_id=hCG39970.2 transcript_id=hCT31223.2
FT                   protein_id=hCP49765.2"
FT                   /protein_id="EAW95010.1"
FT                   /translation="MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEK
FT                   LKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQ
FT                   GTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGV
FT                   AFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR
FT                   AVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCE
FT                   QDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQ
FT                   CQRLVELHTCR"
FT   gene            complement(5448301..5449007)
FT                   /pseudo
FT                   /locus_tag="hCG_1792358"
FT                   /note="gene_id=hCG1792358.3"
FT   mRNA            complement(5448301..5449007)
FT                   /pseudo
FT                   /locus_tag="hCG_1792358"
FT                   /note="gene_id=hCG1792358.3 transcript_id=hCT1831618.3;
FT                   overlap evidence=no; created on 15-SEP-2004"
FT   gene            5578168..5657490
FT                   /gene="ZBTB40"
FT                   /locus_tag="hCG_1812845"
FT                   /note="gene_id=hCG1812845.1"
FT   mRNA            join(5578168..5578309,5616207..5616972,5617727..5617860,
FT                   5627820..5628012,5628627..5628769,5632380..5632572,
FT                   5634332..5634468,5634861..5635062,5635431..5635564,
FT                   5637509..5637677,5638006..5638464,5639254..5639460,
FT                   5643632..5643796,5646393..5646607,5647828..5647990,
FT                   5648709..5648795,5650555..5650781,5652539..5657490)
FT                   /gene="ZBTB40"
FT                   /locus_tag="hCG_1812845"
FT                   /product="zinc finger and BTB domain containing 40,
FT                   transcript variant hCT1957954"
FT                   /note="gene_id=hCG1812845.1 transcript_id=hCT1957954.1;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   CDS             join(5616276..5616972,5617727..5617860,5627820..5628012,
FT                   5628627..5628769,5632380..5632572,5634332..5634468,
FT                   5634861..5635062,5635431..5635564,5637509..5637677,
FT                   5638006..5638464,5639254..5639460,5643632..5643796,
FT                   5646393..5646607,5647828..5647990,5648709..5648795,
FT                   5650555..5650781,5652539..5652733)
FT                   /codon_start=1
FT                   /gene="ZBTB40"
FT                   /locus_tag="hCG_1812845"
FT                   /product="zinc finger and BTB domain containing 40, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1812845.1 transcript_id=hCT1957954.1
FT                   protein_id=hCP1765695.0 isoform=CRA_b"
FT                   /protein_id="EAW95012.1"
FT                   /translation="MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAA
FT                   SLLFKTLLDNTDTISIDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFD
FT                   VAVSCKNLLTSLVNCSVQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPEL
FT                   AATPGGPVKAETEEAAHSVSQEMSVNSPTAQESQRNAETPAETPTTAEACSPSPAVQTF
FT                   SEAKKTSTEPGCERKHYQLNFLLENEGVFSDALMVTQDVLKKLEMCSEIKGPQKEMIVK
FT                   CFEGEGGHSAFQRILGKVREESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQP
FT                   KGSTEEGKTLSVLLLEHKEDLIQCVTQLRPIMESLETAKEEFLTGTEKRVILNCCEGRT
FT                   PKETIENLLHRMTEEKTLTAEGLVKLLQAVKTTFPNLGLLLEKLQKSATLPSTTVQPSP
FT                   DDYGTELLRRYHENLSEIFTDNQILLKMISHMTSLAPGEREVMEKLVKRDSGSGGFNSL
FT                   ISAVLEKQTLSATAIWQLLLVVQETKTCPLDLLMEEIRREPGADAFFRAVTTPEHATLE
FT                   TILRHNQLILEAIQQKIECKLFTSEEEHLAETVKEILSIPSETASPEASLRAVLSRAME
FT                   KSVPAIEICHLLCSVHKSFPGLQPVMQELAYIGVLTKEDGEKETWKVSNKFHLEANNKE
FT                   DEKAAKEDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCRLKV
FT                   HMKRCRVAKSKQVQCKECSETKDSKKELDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLC
FT                   GREFAHASGMQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTGDRPFMCKHCLM
FT                   TFTQASALAYHTKKKHSEGKMYACQYCDAVFAQSIELSRHVRTHTGDKPYVCRDCGKGF
FT                   RQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQDHRKHIHEVHSKEYHPCPTCGKIFSA
FT                   PSMLERHMVTHVGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSLQC
FT                   SSCDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSGSQPFRCL
FT                   YCAATFRFPGALQHHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKVMSTET
FT                   QAAASQMAQVIQTPEPVAPTEQVITLEETQLAGSQVFVTLPDSQASQASSELVAVTVED
FT                   LLDGTVTLICGEAK"
FT   mRNA            join(5638653..5639460,5643632..5643796,5646393..5646607,
FT                   5647828..5647990,5648709..5648795,5650555..5650781,
FT                   5652539..5657490)
FT                   /gene="ZBTB40"
FT                   /locus_tag="hCG_1812845"
FT                   /product="zinc finger and BTB domain containing 40,
FT                   transcript variant hCT1957953"
FT                   /note="gene_id=hCG1812845.1 transcript_id=hCT1957953.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(5639256..5639460,5643632..5643796,5646393..5646607,
FT                   5647828..5647990,5648709..5648795,5650555..5650781,
FT                   5652539..5652733)
FT                   /codon_start=1
FT                   /gene="ZBTB40"
FT                   /locus_tag="hCG_1812845"
FT                   /product="zinc finger and BTB domain containing 40, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1812845.1 transcript_id=hCT1957953.1
FT                   protein_id=hCP1765694.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RBP0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:B2RBP0"
FT                   /protein_id="EAW95011.1"
FT                   /translation="MQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTGDRPFMC
FT                   KHCLMTFTQASALAYHTKKKHSEGKMYACQYCDAVFAQSIELSRHVRTHTGDKPYVCRD
FT                   CGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFPTLQDHRKHIHEVHSKEYHPCPTCG
FT                   KIFSAPSMLERHMVTHVGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKF
FT                   SSLQCSSCDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSGSQ
FT                   PFRCLYCAATFRFPGALQHHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKV
FT                   MSTETQAAASQMAQVIQTPEPVAPTEQVITLEETQLAGSQVFVTLPDSQASQASSELVA
FT                   VTVEDLLDGTVTLICGEAK"
FT   gene            5689694..5731232
FT                   /gene="EPHA8"
FT                   /locus_tag="hCG_39973"
FT                   /note="gene_id=hCG39973.2"
FT   mRNA            join(5689694..5690062,5695622..5695686,5702552..5703215,
FT                   5714115..5714270,5716508..5716843,5720963..5721087,
FT                   5721161..5721323,5722867..5722960,5723743..5723810,
FT                   5724949..5725113,5725313..5725498,5725788..5725849,
FT                   5726475..5726684,5728299..5728448,5728536..5728726,
FT                   5728938..5729111,5729265..5731232)
FT                   /gene="EPHA8"
FT                   /locus_tag="hCG_39973"
FT                   /product="EPH receptor A8"
FT                   /note="gene_id=hCG39973.2 transcript_id=hCT31226.3; splice
FT                   donor-acceptor pairs covered / total pairs = 16/16; created
FT                   on 26-AUG-2002"
FT   CDS             join(5689969..5690062,5695622..5695686,5702552..5703215,
FT                   5714115..5714270,5716508..5716843,5720963..5721087,
FT                   5721161..5721323,5722867..5722960,5723743..5723810,
FT                   5724949..5725113,5725313..5725498,5725788..5725849,
FT                   5726475..5726684,5728299..5728448,5728536..5728726,
FT                   5728938..5729111,5729265..5729379)
FT                   /codon_start=1
FT                   /gene="EPHA8"
FT                   /locus_tag="hCG_39973"
FT                   /product="EPH receptor A8"
FT                   /note="gene_id=hCG39973.2 transcript_id=hCT31226.3
FT                   protein_id=hCP49757.1"
FT                   /protein_id="EAW95013.1"
FT                   /translation="MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWG
FT                   WLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFT
FT                   LRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRR
FT                   LKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGAD
FT                   SSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFY
FT                   KSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVN
FT                   GTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLV
FT                   ANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSL
FT                   LWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTS
FT                   AGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQD
FT                   SDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRI
FT                   HIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHP
FT                   NIIRLEGVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSD
FT                   LGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAF
FT                   RTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLM
FT                   LDCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSRCPPPAFVRSCFDLRGGSGGG
FT                   GGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQ
FT                   TMRAQLTSTQGPRRHL"
FT   gene            5764284..5767325
FT                   /gene="C1QA"
FT                   /locus_tag="hCG_1981379"
FT                   /note="gene_id=hCG1981379.1"
FT   mRNA            join(5764284..5764346,5765254..5765423,5766477..5767325)
FT                   /gene="C1QA"
FT                   /locus_tag="hCG_1981379"
FT                   /product="complement component 1, q subcomponent, A chain,
FT                   transcript variant hCT2254216"
FT                   /note="gene_id=hCG1981379.1 transcript_id=hCT2254216.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 29-APR-2003"
FT   mRNA            join(5764403..5764504,5765254..5765423,5766477..5767325)
FT                   /gene="C1QA"
FT                   /locus_tag="hCG_1981379"
FT                   /product="complement component 1, q subcomponent, A chain,
FT                   transcript variant hCT2254212"
FT                   /note="gene_id=hCG1981379.1 transcript_id=hCT2254212.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 29-APR-2003"
FT   CDS             join(5765261..5765423,5766477..5767051)
FT                   /codon_start=1
FT                   /gene="C1QA"
FT                   /locus_tag="hCG_1981379"
FT                   /product="complement component 1, q subcomponent, A chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1981379.1 transcript_id=hCT2254212.0
FT                   protein_id=hCP1855214.1 isoform=CRA_a"
FT                   /db_xref="GOA:P02745"
FT                   /db_xref="HGNC:HGNC:1241"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="PDB:1PK6"
FT                   /db_xref="PDB:2JG8"
FT                   /db_xref="PDB:2JG9"
FT                   /db_xref="PDB:2WNU"
FT                   /db_xref="PDB:2WNV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02745"
FT                   /protein_id="EAW95014.1"
FT                   /translation="MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRP
FT                   GLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKG
FT                   SPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTF
FT                   QVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPK
FT                   KGHIYQGSEADSVFSGFLIFPSA"
FT   CDS             join(5765261..5765423,5766477..5767051)
FT                   /codon_start=1
FT                   /gene="C1QA"
FT                   /locus_tag="hCG_1981379"
FT                   /product="complement component 1, q subcomponent, A chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1981379.1 transcript_id=hCT2254216.1
FT                   protein_id=hCP1855220.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAG6"
FT                   /protein_id="EAW95015.1"
FT                   /translation="MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRP
FT                   GLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKG
FT                   SPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTF
FT                   QVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPK
FT                   KGHIYQGSEADSVFSGFLIFPSA"
FT   gene            5771284..5775762
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /note="gene_id=hCG2037016.0"
FT   mRNA            join(5771284..5771388,5771662..5771855,5774878..5775762)
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   transcript variant hCT2254210"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254210.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 17-MAR-2003"
FT   mRNA            join(5771286..5771365,5771662..5771855,5774878..5775762)
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   transcript variant hCT2254218"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254218.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 17-MAR-2003"
FT   mRNA            join(5771304..5771537,5771662..5771855,5774878..5775762)
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   transcript variant hCT2254213"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254213.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 17-MAR-2003"
FT   CDS             join(5771675..5771855,5774878..5775434)
FT                   /codon_start=1
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254210.1
FT                   protein_id=hCP1855215.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA7"
FT                   /protein_id="EAW95016.1"
FT                   /translation="MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAP
FT                   GKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGI
FT                   PGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVP
FT                   GLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVN
FT                   DYYDMVGIQGSDSVFSGFLLFPD"
FT   CDS             join(5771675..5771855,5774878..5775434)
FT                   /codon_start=1
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254218.1
FT                   protein_id=hCP1855222.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA7"
FT                   /protein_id="EAW95017.1"
FT                   /translation="MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAP
FT                   GKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGI
FT                   PGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVP
FT                   GLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVN
FT                   DYYDMVGIQGSDSVFSGFLLFPD"
FT   CDS             join(5771675..5771855,5774878..5775434)
FT                   /codon_start=1
FT                   /gene="C1QC"
FT                   /locus_tag="hCG_2037016"
FT                   /product="complement component 1, q subcomponent, C chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2037016.0 transcript_id=hCT2254213.1
FT                   protein_id=hCP1855219.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAA7"
FT                   /protein_id="EAW95018.1"
FT                   /translation="MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAP
FT                   GKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGI
FT                   PGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVP
FT                   GLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVN
FT                   DYYDMVGIQGSDSVFSGFLLFPD"
FT   gene            5780413..5789232
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /note="gene_id=hCG39967.4"
FT   mRNA            join(5780413..5780606,5787038..5787241,5788410..5789232)
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   transcript variant hCT2254221"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT2254221.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 20-JUN-2003"
FT   mRNA            join(5780632..5780954,5787038..5787241,5788410..5789232)
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   transcript variant hCT31220"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT31220.3; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 20-JUN-2003"
FT   mRNA            join(5780836..5780954,5781659..5781811,5787038..5787241,
FT                   5788410..5789232)
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   transcript variant hCT1965811"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT1965811.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 20-JUN-2003"
FT   CDS             join(5787055..5787241,5788410..5788984)
FT                   /codon_start=1
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT31220.3
FT                   protein_id=hCP49761.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB9"
FT                   /protein_id="EAW95019.1"
FT                   /translation="MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPG
FT                   TPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAP
FT                   GAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCK
FT                   VPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENV
FT                   FLQATDKNSLLGMEGANSIFSGFLLFPDMEA"
FT   CDS             join(5787055..5787241,5788410..5788984)
FT                   /codon_start=1
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT2254221.1
FT                   protein_id=hCP1855213.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB9"
FT                   /protein_id="EAW95020.1"
FT                   /translation="MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPG
FT                   TPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAP
FT                   GAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCK
FT                   VPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENV
FT                   FLQATDKNSLLGMEGANSIFSGFLLFPDMEA"
FT   CDS             join(5787055..5787241,5788410..5788984)
FT                   /codon_start=1
FT                   /gene="C1QB"
FT                   /locus_tag="hCG_39967"
FT                   /product="complement component 1, q subcomponent, B chain,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG39967.4 transcript_id=hCT1965811.1
FT                   protein_id=hCP1780767.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB9"
FT                   /protein_id="EAW95021.1"
FT                   /translation="MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPG
FT                   TPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAP
FT                   GAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCK
FT                   VPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENV
FT                   FLQATDKNSLLGMEGANSIFSGFLLFPDMEA"
FT   gene            5838150..6064046
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /note="gene_id=hCG1812037.1"
FT   mRNA            join(5838150..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6040391,6063591..6064046)
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, transcript variant hCT2254227"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254227.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5838150..5838299,5906549..5906613,5909520..5910196,
FT                   5988106..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6040391,6063591..6064046)
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, transcript variant hCT2254226"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254226.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5838150..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021609,
FT                   6031092..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6040422)
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, transcript variant hCT1955735"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT1955735.1;
FT                   splice donor-acceptor pairs covered / total pairs = 14/15;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5838150..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038660,6038754..6039744,6040064..6040412)
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, transcript variant hCT2254225"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254225.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   mRNA            join(5838150..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021489..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038660,6038754..6040104)
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, transcript variant hCT2254224"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254224.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   CDS             join(5838239..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038660,6038754..6038966)
FT                   /codon_start=1
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, isoform CRA_c"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254225.0
FT                   protein_id=hCP1855202.0 isoform=CRA_c"
FT                   /protein_id="EAW95024.1"
FT                   /translation="MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEE
FT                   VSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVP
FT                   GSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEV
FT                   RSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAA
FT                   RGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQ
FT                   GDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSL
FT                   MLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLL
FT                   AHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQ
FT                   PDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYG
FT                   RYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRRGFERADS
FT                   EYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGE
FT                   VCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKST
FT                   PVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNI
FT                   LVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWS
FT                   YGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHR
FT                   PKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQ
FT                   YKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEGQP
FT                   LARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKE
FT                   SNDCSCGG"
FT   CDS             join(5838239..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021489..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038660,6038754..6038966)
FT                   /codon_start=1
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, isoform CRA_a"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254224.0
FT                   protein_id=hCP1855198.0 isoform=CRA_a"
FT                   /protein_id="EAW95022.1"
FT                   /translation="MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEE
FT                   VSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVP
FT                   GSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEV
FT                   RSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAA
FT                   RGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQ
FT                   GDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSL
FT                   MLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLL
FT                   AHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQ
FT                   PDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYG
FT                   RYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSE
FT                   YTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEV
FT                   CSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTP
FT                   VMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNIL
FT                   VNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSY
FT                   GIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRP
FT                   KFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQY
FT                   KESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEGQPL
FT                   ARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKES
FT                   NDCSCGG"
FT   CDS             join(5838239..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021609,
FT                   6031092..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038666)
FT                   /codon_start=1
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, isoform CRA_b"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT1955735.1
FT                   protein_id=hCP1765674.0 isoform=CRA_b"
FT                   /protein_id="EAW95023.1"
FT                   /translation="MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEE
FT                   VSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVP
FT                   GSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEV
FT                   RSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAA
FT                   RGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQ
FT                   GDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSL
FT                   MLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLL
FT                   AHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQ
FT                   PDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYG
FT                   RYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRRGFERADS
FT                   EYTDKLQHYTSGHSMYTPKRAGTLGPFTVGSPIYIDPFTYEDPNEAVREFAKEIDISCV
FT                   KIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHP
FT                   NVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAD
FT                   MNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAI
FT                   QYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQ
FT                   LMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFN
FT                   TVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMR
FT                   AQMNQIQSVEV"
FT   CDS             join(5838239..5838299,5906549..5906613,5909520..5910204,
FT                   5988114..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038666)
FT                   /codon_start=1
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, isoform CRA_e"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254227.0
FT                   protein_id=hCP1855199.0 isoform=CRA_e"
FT                   /protein_id="EAW95026.1"
FT                   /translation="MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEE
FT                   VSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVP
FT                   GSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEV
FT                   RSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAA
FT                   RGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQ
FT                   GDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSL
FT                   MLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLL
FT                   AHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQ
FT                   PDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYG
FT                   RYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRRGFERADS
FT                   EYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGE
FT                   VCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKST
FT                   PVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNI
FT                   LVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWS
FT                   YGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHR
FT                   PKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQ
FT                   YKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV"
FT   CDS             join(5838239..5838299,5906549..5906613,5909520..5910196,
FT                   5988106..5988269,5989950..5990285,6007435..6007559,
FT                   6017959..6018121,6020547..6020655,6021486..6021553,
FT                   6031075..6031197,6031798..6032045,6033041..6033256,
FT                   6034110..6034259,6035470..6035663,6037540..6037695,
FT                   6038558..6038666)
FT                   /codon_start=1
FT                   /gene="EPHB2"
FT                   /locus_tag="hCG_1812037"
FT                   /product="EPH receptor B2, isoform CRA_d"
FT                   /note="gene_id=hCG1812037.1 transcript_id=hCT2254226.0
FT                   protein_id=hCP1855201.0 isoform=CRA_d"
FT                   /protein_id="EAW95025.1"
FT                   /translation="MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEE
FT                   VSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVP
FT                   GSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEV
FT                   RSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAA
FT                   RGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVLSGCPSGTFKANQ
FT                   GDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSL
FT                   MLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLL
FT                   AHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQ
FT                   PDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYG
FT                   RYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRRGFERADS
FT                   EYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGE
FT                   VCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKST
FT                   PVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNI
FT                   LVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWS
FT                   YGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHR
FT                   PKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQ
FT                   YKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV"
FT   gene            6075073..6089581
FT                   /locus_tag="hCG_1812041"
FT                   /note="gene_id=hCG1812041.1"
FT   mRNA            join(6075073..6075193,6089292..6089581)
FT                   /locus_tag="hCG_1812041"
FT                   /product="hCG1812041"
FT                   /note="gene_id=hCG1812041.1 transcript_id=hCT1955743.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(6075080..6075193,6089292..6089324)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812041"
FT                   /product="hCG1812041"
FT                   /note="gene_id=hCG1812041.1 transcript_id=hCT1955743.0
FT                   protein_id=hCP1765688.0"
FT                   /protein_id="EAW95027.1"
FT                   /translation="MFIAALFIIAPNRKQPRCPSTSGWLNKLCYIHTRNHYSITGMSHR
FT                   AQP"
FT   gene            complement(6080401..6097462)
FT                   /locus_tag="hCG_1982139"
FT                   /note="gene_id=hCG1982139.0"
FT   mRNA            complement(join(6080401..6080511,6083768..6084003,
FT                   6085025..6085182,6088191..6088300,6090374..6090509,
FT                   6097380..6097462))
FT                   /locus_tag="hCG_1982139"
FT                   /product="hCG1982139, transcript variant hCT2255301"
FT                   /note="gene_id=hCG1982139.0 transcript_id=hCT2255301.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(6080402..6080511,6083768..6084003,
FT                   6085025..6085182,6088191..6088300,6090374..6090509,
FT                   6097380..6097391))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1982139"
FT                   /product="hCG1982139, isoform CRA_b"
FT                   /note="gene_id=hCG1982139.0 transcript_id=hCT2255301.0
FT                   protein_id=hCP1855182.0 isoform=CRA_b"
FT                   /protein_id="EAW95029.1"
FT                   /translation="MKTQDGWWPNLLKVKKKWLLPAICSFFCLLSVVMTGCFLWQYHLP
FT                   KLKTGSLGPEETSAPVRMCPRHPEPVPLAHPLPVLKEALEKVDQILRQAMSAPGVAAMS
FT                   AVVIHNDTVLWTGNFGKKNGSDPASGAPNEYTMYRISSISKIFPVLMLYRLWEEGIVAS
FT                   LDDPLERYASTFTINNPLGLASAEQQGLMDGLEQVGPAPRPSPVTLRRMASQLSGLPRR
FT                   LRSTSLLWKGSTQEALNLLKDDVLVVDPGTR"
FT   mRNA            complement(join(6083768..6084003,6085025..6085091,
FT                   6087936..6088300,6090374..6090509,6097380..6097432))
FT                   /locus_tag="hCG_1982139"
FT                   /product="hCG1982139, transcript variant hCT2341009"
FT                   /note="gene_id=hCG1982139.0 transcript_id=hCT2341009.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(6083927..6084003,6085025..6085091,
FT                   6087936..6088300,6090374..6090509,6097380..6097391))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1982139"
FT                   /product="hCG1982139, isoform CRA_a"
FT                   /note="gene_id=hCG1982139.0 transcript_id=hCT2341009.0
FT                   protein_id=hCP1907593.0 isoform=CRA_a"
FT                   /protein_id="EAW95028.1"
FT                   /translation="MKTQDGWWPNLLKVKKKWLLPAICSFFCLLSVVMTGCFLWQYHLP
FT                   KLKTGSLGPEETSAPVRMCPRHPEPVPLAHPLPVLKEALEKVSDDPGGNWAYGLGLGDE
FT                   GEGSPSVLAVAFIHSSVQHVFLEHLLCARHYGYGRKKTLTCSQEITNLEARGTVKIPNI
FT                   YNPGARVRGTLGRRMAQTRLLGPPMSTPCTGSPASPRSFLSSCCTVCGRRASWPP"
FT   gene            complement(6135892..6139169)
FT                   /locus_tag="hCG_1812029"
FT                   /note="gene_id=hCG1812029.1"
FT   mRNA            complement(join(6135892..6136263,6138944..6139169))
FT                   /locus_tag="hCG_1812029"
FT                   /product="hCG1812029"
FT                   /note="gene_id=hCG1812029.1 transcript_id=hCT1955716.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6135964..6136263,6138944..6139135))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812029"
FT                   /product="hCG1812029"
FT                   /note="gene_id=hCG1812029.1 transcript_id=hCT1955716.0
FT                   protein_id=hCP1765656.0"
FT                   /protein_id="EAW95030.1"
FT                   /translation="MLAELIFLFRSLHGILASAGTIGAVAAWLMSYKPALFGFLFLLLL
FT                   LSNWLVKYEHKLTLPEPQQEEEKPKTSENDSKNSKAVNTKEVNRTHACFALQDEILQRL
FT                   LFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS
FT                   "
FT   gene            6144473..6211595
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /note="gene_id=hCG38847.2"
FT   mRNA            join(6144473..6145008,6155533..6155698,6169499..6169667,
FT                   6175437..6175593,6178834..6178912,6180142..6180234,
FT                   6181006..6181112,6182558..6182639,6184149..6184243,
FT                   6193614..6193756,6194136..6194226,6196300..6196434,
FT                   6197199..6197272,6198367..6198478,6202303..6202435,
FT                   6204065..6204252,6204628..6204742,6206521..6206648,
FT                   6207295..6207441,6208254..6211595)
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   transcript variant hCT30093"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT30093.2; splice
FT                   donor-acceptor pairs covered / total pairs = 18/19; created
FT                   on 26-AUG-2002"
FT   mRNA            join(6144473..6145008,6155533..6155698,6169499..6169558,
FT                   6175460..6175593,6178834..6178912,6180142..6180234,
FT                   6181006..6181079,6184177..6184243,6193614..6193756,
FT                   6194136..6194226,6196300..6196434,6197199..6197272,
FT                   6198367..6198478,6202303..6202435,6204065..6204252,
FT                   6204628..6204742,6206521..6206648,6207295..6207441,
FT                   6208254..6211595)
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   transcript variant hCT2254191"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT2254191.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/18;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6144473..6145008,6155533..6155698,6175460..6175593,
FT                   6178834..6178912,6180142..6180234,6181006..6181112,
FT                   6182558..6182639,6184149..6184243,6193614..6193756,
FT                   6194136..6194226,6196300..6196434,6197199..6197272,
FT                   6198367..6198478,6202303..6202435,6204065..6204252,
FT                   6204628..6204742,6206521..6206648,6207295..6207441,
FT                   6208254..6211595)
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   transcript variant hCT1955774"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT1955774.1;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   CDS             join(6144658..6145008,6155533..6155698,6169499..6169667,
FT                   6175437..6175593,6178834..6178912,6180142..6180234,
FT                   6181006..6181112,6182558..6182639,6184149..6184243,
FT                   6193614..6193756,6194136..6194226,6196300..6196434,
FT                   6197199..6197272,6198367..6198478,6202303..6202435,
FT                   6204065..6204252,6204628..6204742,6206521..6206648,
FT                   6207295..6207441,6208254..6208439)
FT                   /codon_start=1
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT30093.2
FT                   protein_id=hCP48708.2 isoform=CRA_a"
FT                   /protein_id="EAW95031.1"
FT                   /translation="MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLS
FT                   GPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAET
FT                   PEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEE
FT                   NESEPEEPSGQAGGLQDDSSGGYGDGQASGEGGIRCLPLSSKSRQVGIDACKCFWLWYP
FT                   HFSQKRRCPLLSSLGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRT
FT                   LQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTK
FT                   KTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVT
FT                   GLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSH
FT                   QLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKE
FT                   KIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELE
FT                   ANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGY
FT                   SCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVL
FT                   KQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRG
FT                   ELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVV
FT                   SRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNY
FT                   PATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM"
FT   CDS             join(6144658..6145008,6155533..6155698,6175460..6175593,
FT                   6178834..6178912,6180142..6180234,6181006..6181112,
FT                   6182558..6182639,6184149..6184243,6193614..6193756,
FT                   6194136..6194226,6196300..6196434,6197199..6197272,
FT                   6198367..6198478,6202303..6202435,6204065..6204252,
FT                   6204628..6204742,6206521..6206648,6207295..6207441,
FT                   6208254..6208439)
FT                   /codon_start=1
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT1955774.1
FT                   protein_id=hCP1765681.0 isoform=CRA_b"
FT                   /protein_id="EAW95032.1"
FT                   /translation="MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLS
FT                   GPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAET
FT                   PEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEE
FT                   NESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWL
FT                   DNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKV
FT                   IIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGN
FT                   PMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFN
FT                   VLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKEL
FT                   HQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPS
FT                   DVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPV
FT                   ALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPP
FT                   AVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLF
FT                   WNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRA
FT                   DPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVH
FT                   GALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM"
FT   CDS             join(6184187..6184243,6193614..6193756,6194136..6194226,
FT                   6196300..6196434,6197199..6197272,6198367..6198478,
FT                   6202303..6202435,6204065..6204252,6204628..6204742,
FT                   6206521..6206648,6207295..6207441,6208254..6208439)
FT                   /codon_start=1
FT                   /gene="AOF2"
FT                   /locus_tag="hCG_38847"
FT                   /product="amine oxidase (flavin containing) domain 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG38847.2 transcript_id=hCT2254191.0
FT                   protein_id=hCP1855205.0 isoform=CRA_c"
FT                   /protein_id="EAW95033.1"
FT                   /translation="MELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQ
FT                   LDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEK
FT                   IKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEA
FT                   NPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYS
FT                   CVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLK
FT                   QQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGE
FT                   LFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVS
FT                   RWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYP
FT                   ATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM"
FT   gene            complement(6209108..6293927)
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /note="gene_id=hCG1643237.3"
FT   mRNA            complement(join(6209108..6214129,6216270..6219460,
FT                   6234105..6234210,6234668..6234733,6293844..6293927))
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, transcript variant
FT                   hCT1643364"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT1643364.3;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6209108..6214129,6216270..6219460,
FT                   6234105..6234210,6293844..6293874))
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, transcript variant
FT                   hCT1955715"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT1955715.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6213971..6214129,6216270..6219341))
FT                   /codon_start=1
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, isoform CRA_a"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT1955715.1
FT                   protein_id=hCP1765664.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC0"
FT                   /protein_id="EAW95034.1"
FT                   /translation="MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELL
FT                   DLQDKVIQAEGSNSSMLAEIEVLRQRVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTR
FT                   ELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLSLNEERNLTKKISSELEMLRVKVK
FT                   ELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKLIKELTQKLEQNK
FT                   KMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKNR
FT                   NQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQL
FT                   EEIKLQIKKQKELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKR
FT                   ERLRNREFALNNENYSLSNRQVSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPS
FT                   SSKSEGKKSREQPSVLSRYPPAAQEHSKAWKGTSKPGTESGLKGKVEKTTRTFSDTTHG
FT                   SVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGCSKAIGALASSRRSSSE
FT                   GLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQPAAVVM
FT                   EDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKA
FT                   KTRGAPRTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSR
FT                   AIIKPVIVDKDVKKIMGGSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGE
FT                   ALRERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPE
FT                   TVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEVGFSDARHVTVRNAWKSRRDL
FT                   KSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGPSSGDAPEPS
FT                   SRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMEEEGEDCTLSVYRQLHNSLDPSEL
FT                   PGKQGLPESGRVRAEERLRPTRPCAEEN"
FT   CDS             complement(join(6213971..6214129,6216270..6219341))
FT                   /codon_start=1
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, isoform CRA_a"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT1643364.3
FT                   protein_id=hCP1638694.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC0"
FT                   /protein_id="EAW95036.1"
FT                   /translation="MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELL
FT                   DLQDKVIQAEGSNSSMLAEIEVLRQRVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTR
FT                   ELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLSLNEERNLTKKISSELEMLRVKVK
FT                   ELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKLIKELTQKLEQNK
FT                   KMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKNR
FT                   NQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQL
FT                   EEIKLQIKKQKELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKR
FT                   ERLRNREFALNNENYSLSNRQVSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPS
FT                   SSKSEGKKSREQPSVLSRYPPAAQEHSKAWKGTSKPGTESGLKGKVEKTTRTFSDTTHG
FT                   SVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGCSKAIGALASSRRSSSE
FT                   GLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQPAAVVM
FT                   EDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKA
FT                   KTRGAPRTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSR
FT                   AIIKPVIVDKDVKKIMGGSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGE
FT                   ALRERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPE
FT                   TVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEVGFSDARHVTVRNAWKSRRDL
FT                   KSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGPSSGDAPEPS
FT                   SRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMEEEGEDCTLSVYRQLHNSLDPSEL
FT                   PGKQGLPESGRVRAEERLRPTRPCAEEN"
FT   mRNA            complement(join(6214855..6219460,6234105..6234210,
FT                   6234668..6234733,6293844..6293927))
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, transcript variant
FT                   hCT2255285"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT2255285.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(6216180..6219341)
FT                   /codon_start=1
FT                   /gene="LUZP1"
FT                   /locus_tag="hCG_1643237"
FT                   /product="leucine zipper protein 1, isoform CRA_b"
FT                   /note="gene_id=hCG1643237.3 transcript_id=hCT2255285.0
FT                   protein_id=hCP1855183.0 isoform=CRA_b"
FT                   /protein_id="EAW95035.1"
FT                   /translation="MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELL
FT                   DLQDKVIQAEGSNSSMLAEIEVLRQRVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTR
FT                   ELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLSLNEERNLTKKISSELEMLRVKVK
FT                   ELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKLIKELTQKLEQNK
FT                   KMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKNR
FT                   NQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQL
FT                   EEIKLQIKKQKELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKR
FT                   ERLRNREFALNNENYSLSNRQVSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPS
FT                   SSKSEGKKSREQPSVLSRYPPAAQEHSKAWKGTSKPGTESGLKGKVEKTTRTFSDTTHG
FT                   SVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGCSKAIGALASSRRSSSE
FT                   GLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQPAAVVM
FT                   EDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKA
FT                   KTRGAPRTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSR
FT                   AIIKPVIVDKDVKKIMGGSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGE
FT                   ALRERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPE
FT                   TVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEVGFSDARHVTVRNAWKSRRDL
FT                   KSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGPSSGDAPEPS
FT                   SRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMVSSSLSPLSLFSLPFPSLPFPFSP
FT                   LLWPV"
FT   gene            complement(6316969..6319808)
FT                   /gene="HTR1D"
FT                   /locus_tag="hCG_38840"
FT                   /note="gene_id=hCG38840.2"
FT   mRNA            complement(6316969..6319808)
FT                   /gene="HTR1D"
FT                   /locus_tag="hCG_38840"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1D"
FT                   /note="gene_id=hCG38840.2 transcript_id=hCT30086.2; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(6318159..6319292)
FT                   /codon_start=1
FT                   /gene="HTR1D"
FT                   /locus_tag="hCG_38840"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 1D"
FT                   /note="gene_id=hCG38840.2 transcript_id=hCT30086.2
FT                   protein_id=hCP48711.2"
FT                   /protein_id="EAW95037.1"
FT                   /translation="MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVL
FT                   SVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTW
FT                   NFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVW
FT                   AISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYR
FT                   AARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKL
FT                   ADSALERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDF
FT                   FTWLGYLNSLINPIIYTVFNEEFRQAFQKIVPFRKAS"
FT   gene            6369800..6370417
FT                   /pseudo
FT                   /locus_tag="hCG_38841"
FT                   /note="gene_id=hCG38841.2"
FT   mRNA            6369800..6370417
FT                   /pseudo
FT                   /locus_tag="hCG_38841"
FT                   /note="gene_id=hCG38841.2 transcript_id=hCT30087.2; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   gene            <6416942..6418057
FT                   /locus_tag="hCG_2041903"
FT                   /note="gene_id=hCG2041903.0"
FT   mRNA            join(<6416942..6416986,6417687..6418057)
FT                   /locus_tag="hCG_2041903"
FT                   /product="hCG2041903"
FT                   /note="gene_id=hCG2041903.0 transcript_id=hCT2347134.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<6416953..6416986,6417687..6417781)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041903"
FT                   /product="hCG2041903"
FT                   /note="gene_id=hCG2041903.0 transcript_id=hCT2347134.0
FT                   protein_id=hCP1912685.0"
FT                   /protein_id="EAW95038.1"
FT                   /translation="GVGVLLCCPGWRLRLSLKTNQTNKKTKAKRHCSKLIHGQYLH"
FT   gene            complement(6436305..>6439223)
FT                   /locus_tag="hCG_2041904"
FT                   /note="gene_id=hCG2041904.0"
FT   mRNA            complement(join(6436305..6436675,6438981..>6439223))
FT                   /locus_tag="hCG_2041904"
FT                   /product="hCG2041904"
FT                   /note="gene_id=hCG2041904.0 transcript_id=hCT2347135.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(6439048..>6439221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041904"
FT                   /product="hCG2041904"
FT                   /note="gene_id=hCG2041904.0 transcript_id=hCT2347135.0
FT                   protein_id=hCP1912686.0"
FT                   /protein_id="EAW95039.1"
FT                   /translation="TFLFRGYQKLWFCFVLFCFFVFLIIFRCYPEICKCTFPVLTPSFY
FT                   HLTIREARLRLP"
FT   gene            complement(6441780..6476921)
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /note="gene_id=hCG38907.3"
FT   mRNA            complement(join(6441780..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6470345..6470452,6471081..6471199,
FT                   6476802..6476921))
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   transcript variant hCT1955786"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT1955786.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6441780..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6466102..6466215,6470345..6470452,
FT                   6471081..6471199,6476802..6476921))
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   transcript variant hCT30153"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT30153.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(6441780..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6466102..6466215,6470345..6470452,
FT                   6471081..6471199,6473443..6473608,6476802..6476891))
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   transcript variant hCT1955785"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT1955785.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6443022..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6466102..6466215,6470345..6470452,
FT                   6471081..6471199,6473443..6473599))
FT                   /codon_start=1
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT1955785.1
FT                   protein_id=hCP1765605.0 isoform=CRA_c"
FT                   /protein_id="EAW95042.1"
FT                   /translation="MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAER
FT                   LDEIFQTGLVAYVDLDERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKT
FT                   YRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGI
FT                   GTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEA
FT                   VKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQ
FT                   PDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKV
FT                   KVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEI
FT                   EGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGY
FT                   GYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRG
FT                   RGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKAD
FT                   GYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK"
FT   CDS             complement(join(6443022..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6470345..6470425))
FT                   /codon_start=1
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT1955786.1
FT                   protein_id=hCP1765624.0 isoform=CRA_a"
FT                   /db_xref="GOA:B4DT28"
FT                   /db_xref="HGNC:HGNC:5047"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006535"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:B4DT28"
FT                   /protein_id="EAW95040.1"
FT                   /translation="MKTYRQREKQGSKVQESTKGPDEAKIKVFVGKIPRDLYEDELVPL
FT                   FEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISV
FT                   ANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSA
FT                   AQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSF
FT                   SEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ
FT                   AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDY
FT                   HDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGP
FT                   PRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQ
FT                   PIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK"
FT   CDS             complement(join(6443022..6443634,6443769..6443890,
FT                   6446121..6446270,6451051..6451256,6454104..6454239,
FT                   6456132..6456308,6466102..6466215,6470345..6470425))
FT                   /codon_start=1
FT                   /gene="HNRPR"
FT                   /locus_tag="hCG_38907"
FT                   /product="heterogeneous nuclear ribonucleoprotein R,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38907.3 transcript_id=hCT30153.3
FT                   protein_id=hCP48808.2 isoform=CRA_b"
FT                   /protein_id="EAW95041.1"
FT                   /translation="MKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRK
FT                   YGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQN
FT                   RGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILE
FT                   EFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTV
FT                   EWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFE
FT                   DRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPR
FT                   MPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVR
FT                   GRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSR
FT                   GSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNN
FT                   DNQEFYQDTYGQQWK"
FT   gene            complement(6492562..6502032)
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /note="gene_id=hCG38843.4"
FT   mRNA            complement(join(6492562..6494656,6494828..6494874,
FT                   6495209..6495809,6499632..6499758,6500563..6500928))
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, transcript variant
FT                   hCT30089"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT30089.4; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 16-OCT-2003"
FT   mRNA            complement(join(6492563..6495809,6499632..6499758,
FT                   6500563..6500655,6501956..6502032))
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, transcript variant
FT                   hCT2349676"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT2349676.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-OCT-2003"
FT   mRNA            complement(join(6492563..6495809,6499632..6499758,
FT                   6500563..6500976))
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, transcript variant
FT                   hCT1955772"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT1955772.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 16-OCT-2003"
FT   CDS             complement(join(6494550..6494656,6494828..6494874,
FT                   6495209..6495809,6499632..6499758,6500563..6500595))
FT                   /codon_start=1
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, isoform CRA_b"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT30089.4
FT                   protein_id=hCP48714.3 isoform=CRA_b"
FT                   /protein_id="EAW95045.1"
FT                   /translation="MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQE
FT                   NYGNVVSLDFEIRSENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSER
FT                   QWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGD
FT                   RPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPH
FT                   KCNECGKSFCRLSHLIQHQRTHSGEKPYECEELVGKASAGALISSHTKFTRERNLMNVP
FT                   NVRRVSAGAQLLLNIREFIRTKL"
FT   CDS             complement(join(6494557..6495809,6499632..6499758,
FT                   6500563..6500595))
FT                   /codon_start=1
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, isoform CRA_a"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT2349676.0
FT                   protein_id=hCP1914926.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF3"
FT                   /protein_id="EAW95043.1"
FT                   /translation="MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQE
FT                   NYGNVVSLDFEIRSENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSER
FT                   QWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGD
FT                   RPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPH
FT                   KCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECN
FT                   ECGRGFSERSDLIKHYRVHTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECG
FT                   ENFSRISHLVQHQRTHTGEKPYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSF
FT                   GERSDLIKHQRTHTGEKPYECVQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRS
FT                   SALIKHKRVHTD"
FT   CDS             complement(join(6494557..6495809,6499632..6499758,
FT                   6500563..6500595))
FT                   /codon_start=1
FT                   /gene="ZNF436"
FT                   /locus_tag="hCG_38843"
FT                   /product="zinc finger protein 436, isoform CRA_a"
FT                   /note="gene_id=hCG38843.4 transcript_id=hCT1955772.2
FT                   protein_id=hCP1765691.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF3"
FT                   /protein_id="EAW95044.1"
FT                   /translation="MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDAAQRDLYRDVMQE
FT                   NYGNVVSLDFEIRSENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSER
FT                   QWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHCGKAFSQISDLNRHQKTHTGD
FT                   RPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPH
FT                   KCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECN
FT                   ECGRGFSERSDLIKHYRVHTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECG
FT                   ENFSRISHLVQHQRTHTGEKPYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSF
FT                   GERSDLIKHQRTHTGEKPYECVQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRS
FT                   SALIKHKRVHTD"
FT   gene            6501550..6502500
FT                   /gene="LOC148898"
FT                   /locus_tag="hCG_1981729"
FT                   /note="gene_id=hCG1981729.0"
FT   mRNA            6501550..6502500
FT                   /gene="LOC148898"
FT                   /locus_tag="hCG_1981729"
FT                   /product="hypothetical protein BC007899"
FT                   /note="gene_id=hCG1981729.0 transcript_id=hCT2254703.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             6501888..6502268
FT                   /codon_start=1
FT                   /gene="LOC148898"
FT                   /locus_tag="hCG_1981729"
FT                   /product="hypothetical protein BC007899"
FT                   /note="gene_id=hCG1981729.0 transcript_id=hCT2254703.0
FT                   protein_id=hCP1855300.0"
FT                   /db_xref="HGNC:HGNC:25122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NC38"
FT                   /protein_id="EAW95046.1"
FT                   /translation="MLAVPVRLKVGSRKPEWGTNRLTSCPAKDPLDRRLQNLRDRERVP
FT                   EPQRSLRPGVQEDSREHGQVPEVSDPQVDLEFVDLQAKPRYRRLILKTQIPEASDSQAA
FT                   QKPQAHRQIPETTEAGQETTSN"
FT   gene            <6508679..6509860
FT                   /locus_tag="hCG_2041902"
FT                   /note="gene_id=hCG2041902.0"
FT   mRNA            join(<6508679..6508718,6509540..6509860)
FT                   /locus_tag="hCG_2041902"
FT                   /product="hCG2041902"
FT                   /note="gene_id=hCG2041902.0 transcript_id=hCT2347133.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<6508718..6508718,6509540..6509703)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041902"
FT                   /product="hCG2041902"
FT                   /note="gene_id=hCG2041902.0 transcript_id=hCT2347133.0
FT                   protein_id=hCP1912684.0"
FT                   /protein_id="EAW95047.1"
FT                   /translation="ATAASLFSSSFGHNILVSSFIPSVLPVLPHLTLSFSSSMVTTSPP
FT                   LGSPPGWQR"
FT   gene            complement(6513270..6557407)
FT                   /gene="TCEA3"
FT                   /locus_tag="hCG_38846"
FT                   /note="gene_id=hCG38846.2"
FT   mRNA            complement(join(6513270..6514063,6516987..6517058,
FT                   6519913..6520048,6550605..6550652,6551720..6551782,
FT                   6557207..6557407))
FT                   /gene="TCEA3"
FT                   /locus_tag="hCG_38846"
FT                   /product="transcription elongation factor A (SII), 3,
FT                   transcript variant hCT1955773"
FT                   /note="gene_id=hCG38846.2 transcript_id=hCT1955773.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6513270..6514120,6516983..6517058,
FT                   6519913..6520059,6526520..6526672,6530184..6530242,
FT                   6530433..6530596,6541305..6541367,6549892..6550033,
FT                   6550547..6550652,6551720..6551782,6557207..6557407))
FT                   /gene="TCEA3"
FT                   /locus_tag="hCG_38846"
FT                   /product="transcription elongation factor A (SII), 3,
FT                   transcript variant hCT30092"
FT                   /note="gene_id=hCG38846.2 transcript_id=hCT30092.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/10; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(6513972..6514120,6516983..6517058,
FT                   6519913..6520059,6526520..6526672,6530184..6530242,
FT                   6530433..6530596,6541305..6541367,6549892..6550033,
FT                   6550547..6550652,6551720..6551782,6557207..6557275))
FT                   /codon_start=1
FT                   /gene="TCEA3"
FT                   /locus_tag="hCG_38846"
FT                   /product="transcription elongation factor A (SII), 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38846.2 transcript_id=hCT30092.3
FT                   protein_id=hCP48718.2 isoform=CRA_b"
FT                   /protein_id="EAW95049.1"
FT                   /translation="MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQT
FT                   TRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLE
FT                   CSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPKTPS
FT                   SPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH
FT                   IYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDELR
FT                   ELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNE
FT                   CGNRWKVSSLEDAEKPFKFCCLSGFVVLLMEQPAMNKVRKKKEEALNYLNWRSNKN"
FT   CDS             complement(join(6514055..6514063,6516987..6517058,
FT                   6519913..6520048,6550605..6550627))
FT                   /codon_start=1
FT                   /gene="TCEA3"
FT                   /locus_tag="hCG_38846"
FT                   /product="transcription elongation factor A (SII), 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG38846.2 transcript_id=hCT1955773.1
FT                   protein_id=hCP1765678.0 isoform=CRA_a"
FT                   /protein_id="EAW95048.1"
FT                   /translation="MGSASTAHDELRELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCK
FT                   KKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC"
FT   gene            complement(6561204..6617200)
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /note="gene_id=hCG1812045.1"
FT   mRNA            complement(join(6561204..6561395,6561725..6562383,
FT                   6562438..6562571,6563676..6563766,6564337..6564559,
FT                   6565719..6565914,6566067..6566174,6566268..6566335,
FT                   6566896..6567011,6567175..6567260,6568493..6568670,
FT                   6569202..6569296,6569553..6569686,6569772..6569962,
FT                   6570066..6570114,6571389..6571476,6571803..6571872,
FT                   6573743..6573852,6574028..6574114,6574296..6574371,
FT                   6574827..6574912,6575142..6575253,6584119..6584168,
FT                   6585337..6585411,6588520..6588665,6588761..6588833,
FT                   6616640..6616787,6617107..6617200))
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, transcript variant hCT2256383"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2256383.0;
FT                   splice donor-acceptor pairs covered / total pairs = 27/27;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6561204..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570239,6571382..6571476,
FT                   6571803..6571872,6573743..6573858,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616787,6617107..6617200))
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, transcript variant hCT1955771"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT1955771.0;
FT                   splice donor-acceptor pairs covered / total pairs = 23/25;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6561204..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570114,6571389..6571476,
FT                   6571803..6571872,6573743..6573852,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616846))
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, transcript variant hCT2256384"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2256384.0;
FT                   splice donor-acceptor pairs covered / total pairs = 24/24;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6561204..6561497,6561733..6562571,
FT                   6563676..6563766,6564337..6564559,6565719..6565914,
FT                   6566067..6566174,6566268..6566335,6566896..6567011,
FT                   6567175..6567260,6568493..6568670,6569202..6569296,
FT                   6569553..6569686,6569772..6569962,6570066..6570114,
FT                   6571389..6571476,6571803..6571872,6573743..6573852,
FT                   6574028..6574114,6574296..6574371,6574827..6574912,
FT                   6575142..6575253,6584119..6584168,6585337..6585411,
FT                   6588520..6588665,6588761..6588833,6616640..6616814))
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, transcript variant hCT2357803"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2357803.0;
FT                   splice donor-acceptor pairs covered / total pairs = 25/25;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(6562497..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570114,6571389..6571476,
FT                   6571803..6571872,6573743..6573852,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616768))
FT                   /codon_start=1
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, isoform CRA_a"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2357803.0
FT                   protein_id=hCP1923042.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8TDY4"
FT                   /db_xref="HGNC:HGNC:14987"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028775"
FT                   /db_xref="PDB:2B0O"
FT                   /db_xref="PDB:3LVQ"
FT                   /db_xref="PDB:3LVR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TDY4"
FT                   /protein_id="EAW95050.1"
FT                   /translation="MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEIL
FT                   EGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAV
FT                   FTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEK
FT                   ERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQ
FT                   HNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHL
FT                   SRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTIN
FT                   RPPVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSS
FT                   AFLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGV
FT                   LTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPK
FT                   PSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQP
FT                   LPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQP
FT                   DCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVI
FT                   STEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPP
FT                   PLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPS
FT                   QAPPNSEEGLREPPGTSRPSLTSGTTPSEMYLPVRFSSESTRSYRRGARSPEDGPSARQ
FT                   PLPRRNVPVGITEGDGSRTGSLPASSVQLLQD"
FT   CDS             complement(join(6562497..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570114,6571389..6571476,
FT                   6571803..6571872,6573743..6573852,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616768))
FT                   /codon_start=1
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, isoform CRA_a"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2256383.0
FT                   protein_id=hCP1855260.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB1"
FT                   /protein_id="EAW95051.1"
FT                   /translation="MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEIL
FT                   EGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAV
FT                   FTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEK
FT                   ERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQ
FT                   HNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHL
FT                   SRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTIN
FT                   RPPVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSS
FT                   AFLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGV
FT                   LTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPK
FT                   PSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQP
FT                   LPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQP
FT                   DCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVI
FT                   STEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPP
FT                   PLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPS
FT                   QAPPNSEEGLREPPGTSRPSLTSGTTPSEMYLPVRFSSESTRSYRRGARSPEDGPSARQ
FT                   PLPRRNVPVGITEGDGSRTGSLPASSVQLLQD"
FT   CDS             complement(join(6562497..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570114,6571389..6571476,
FT                   6571803..6571872,6573743..6573852,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616768))
FT                   /codon_start=1
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, isoform CRA_a"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT2256384.0
FT                   protein_id=hCP1855253.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB1"
FT                   /protein_id="EAW95053.1"
FT                   /translation="MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEIL
FT                   EGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAV
FT                   FTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEK
FT                   ERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQ
FT                   HNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHL
FT                   SRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTIN
FT                   RPPVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSS
FT                   AFLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGV
FT                   LTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPK
FT                   PSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQP
FT                   LPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQP
FT                   DCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVI
FT                   STEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPP
FT                   PLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPS
FT                   QAPPNSEEGLREPPGTSRPSLTSGTTPSEMYLPVRFSSESTRSYRRGARSPEDGPSARQ
FT                   PLPRRNVPVGITEGDGSRTGSLPASSVQLLQD"
FT   CDS             complement(join(6562497..6562571,6563676..6563766,
FT                   6564337..6564559,6565719..6565914,6566067..6566174,
FT                   6566268..6566335,6566896..6567011,6567175..6567260,
FT                   6568493..6568670,6569202..6569296,6569553..6569686,
FT                   6569772..6569962,6570066..6570239,6571382..6571476,
FT                   6571803..6571872,6573743..6573858,6574028..6574114,
FT                   6574296..6574371,6574827..6574912,6575142..6575253,
FT                   6584119..6584168,6585337..6585411,6588520..6588665,
FT                   6588761..6588833,6616640..6616768))
FT                   /codon_start=1
FT                   /gene="DDEFL1"
FT                   /locus_tag="hCG_1812045"
FT                   /product="development and differentiation enhancing
FT                   factor-like 1, isoform CRA_b"
FT                   /note="gene_id=hCG1812045.1 transcript_id=hCT1955771.0
FT                   protein_id=hCP1765671.0 isoform=CRA_b"
FT                   /protein_id="EAW95052.1"
FT                   /translation="MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEIL
FT                   EGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAV
FT                   FTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEK
FT                   ERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQ
FT                   HNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREGQE
FT                   HLSRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHST
FT                   INRPPVKLTLLTCQVRPNPEEKKCFDLVTRECLRVRLVRDTSPCGPSGFGGGSLGSGKA
FT                   SSISVGQKPPSLPTDNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSW
FT                   GSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHREL
FT                   GVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDY
FT                   IMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELV
FT                   LHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALV
FT                   GTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEE
FT                   EKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQ
FT                   GCARHASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREP
FT                   PGTSRPSLTSGTTPSEMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITE
FT                   GDGSRTGSLPASSVQLLQD"
FT   gene            complement(6607239..>6609279)
FT                   /locus_tag="hCG_2042294"
FT                   /note="gene_id=hCG2042294.0"
FT   mRNA            complement(6607239..>6609279)
FT                   /locus_tag="hCG_2042294"
FT                   /product="hCG2042294"
FT                   /note="gene_id=hCG2042294.0 transcript_id=hCT2347525.0;
FT                   overlap evidence=yes; created on 18-JUN-2003"
FT   CDS             complement(6608834..>6609199)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042294"
FT                   /product="hCG2042294"
FT                   /note="gene_id=hCG2042294.0 transcript_id=hCT2347525.0
FT                   protein_id=hCP1912680.0"
FT                   /protein_id="EAW95054.1"
FT                   /translation="IGRARRGPKEAILLFREEMMVVWIGLWLVEEERSAQIVEVFYKQS
FT                   RFVDGVHVGSAQDCVPHFFFSFFFLFDWDGVSLYCPGWSSVAPSRLTATSTSRVQAILL
FT                   PQPPKYLGLQAPATTPS"
FT   gene            complement(6637861..6663859)
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /note="gene_id=hCG37584.2"
FT   mRNA            complement(join(6637861..6638834,6648983..6649175,
FT                   6651664..6651778,6653544..6653702,6654468..6654687,
FT                   6657014..6657119,6663179..6663859))
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, transcript variant
FT                   hCT2256381"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2256381.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 22-DEC-2003"
FT   CDS             complement(join(6638827..6638834,6648983..6649175,
FT                   6651664..6651778,6653544..6653702,6654468..6654687,
FT                   6657014..6657119,6663179..6663430))
FT                   /codon_start=1
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, isoform CRA_c"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2256381.0
FT                   protein_id=hCP1855231.0 isoform=CRA_c"
FT                   /protein_id="EAW95057.1"
FT                   /translation="MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYY
FT                   TPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPT
FT                   PKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLD
FT                   VQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQ
FT                   ALDHLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPD
FT                   RTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPS
FT                   IMEPTASSAS"
FT   mRNA            complement(join(6639078..6642797,6648983..6649175,
FT                   6651664..6651778,6653544..6653702,6654468..6654687,
FT                   6657014..6657119,6663179..6663859))
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, transcript variant
FT                   hCT28817"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT28817.3; splice
FT                   donor-acceptor pairs covered / total pairs = 6/6; created
FT                   on 22-DEC-2003"
FT   mRNA            complement(join(6639079..6642797,6648983..6649175,
FT                   6651664..6651778,6653544..6653702,6654468..6654687,
FT                   6657014..6657119,6657220..6657438))
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, transcript variant
FT                   hCT2350481"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2350481.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 22-DEC-2003"
FT   mRNA            complement(join(6639079..6642797,6648983..6649175,
FT                   6651664..6652044))
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, transcript variant
FT                   hCT2350480"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2350480.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 22-DEC-2003"
FT   CDS             complement(join(6642529..6642797,6648983..6649175,
FT                   6651664..6651778,6653544..6653702,6654468..6654687,
FT                   6657014..6657119,6663179..6663430))
FT                   /codon_start=1
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, isoform CRA_a"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT28817.3
FT                   protein_id=hCP48715.3 isoform=CRA_a"
FT                   /protein_id="EAW95055.1"
FT                   /translation="MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYY
FT                   TPLYPQTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPT
FT                   PKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLD
FT                   VQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQ
FT                   ALDHLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPD
FT                   RTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPS
FT                   IMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSP
FT                   LISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN"
FT   CDS             complement(join(6642529..6642797,6648983..6649175,
FT                   6651664..6651778,6653544..6653692))
FT                   /codon_start=1
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, isoform CRA_d"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2350481.0
FT                   protein_id=hCP1915731.0 isoform=CRA_d"
FT                   /protein_id="EAW95058.1"
FT                   /translation="MFEDPTRPGKQQQLGQELKELMNTEQALDHLIQSCSLSFKHLTED
FT                   KANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
FT                   YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQA
FT                   PPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEA
FT                   GEGISDLFDSYDLGDLLIN"
FT   CDS             complement(join(6642529..6642797,6648983..6649004))
FT                   /codon_start=1
FT                   /gene="E2F2"
FT                   /locus_tag="hCG_37584"
FT                   /product="E2F transcription factor 2, isoform CRA_b"
FT                   /note="gene_id=hCG37584.2 transcript_id=hCT2350480.0
FT                   protein_id=hCP1915730.0 isoform=CRA_b"
FT                   /protein_id="EAW95056.1"
FT                   /translation="MEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTE
FT                   DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN"
FT   gene            complement(6681775..>6683552)
FT                   /locus_tag="hCG_2041905"
FT                   /note="gene_id=hCG2041905.0"
FT   mRNA            complement(join(6681775..6682081,6683402..>6683552))
FT                   /locus_tag="hCG_2041905"
FT                   /product="hCG2041905"
FT                   /note="gene_id=hCG2041905.0 transcript_id=hCT2347136.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(6682065..6682081,6683402..>6683519))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041905"
FT                   /product="hCG2041905"
FT                   /note="gene_id=hCG2041905.0 transcript_id=hCT2347136.0
FT                   protein_id=hCP1912687.0"
FT                   /protein_id="EAW95059.1"
FT                   /translation="PRTSSLMKLPSLEENRSCGEEEHNPEARERGGQGWCNCVGSSTY"
FT   gene            complement(6690555..6692462)
FT                   /gene="ID3"
FT                   /locus_tag="hCG_1982882"
FT                   /note="gene_id=hCG1982882.0"
FT   mRNA            complement(join(6690555..6691053,6691573..6691657,
FT                   6691765..6692462))
FT                   /gene="ID3"
FT                   /locus_tag="hCG_1982882"
FT                   /product="inhibitor of DNA binding 3, dominant negative
FT                   helix-loop-helix protein, transcript variant hCT2256379"
FT                   /note="gene_id=hCG1982882.0 transcript_id=hCT2256379.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   gene            6690572..6692112
FT                   /locus_tag="hCG_1981733"
FT                   /note="gene_id=hCG1981733.0"
FT   mRNA            join(6690572..6691011,6691906..6692112)
FT                   /locus_tag="hCG_1981733"
FT                   /product="hCG1981733"
FT                   /note="gene_id=hCG1981733.0 transcript_id=hCT2254707.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             6690591..6690692
FT                   /codon_start=1
FT                   /locus_tag="hCG_1981733"
FT                   /product="hCG1981733"
FT                   /note="gene_id=hCG1981733.0 transcript_id=hCT2254707.0
FT                   protein_id=hCP1855299.0"
FT                   /protein_id="EAW95062.1"
FT                   /translation="MQNVNFYKKFNIHRIVTESHLPVKKVQNLYTLL"
FT   mRNA            complement(join(6690637..6690720,6690775..6691053,
FT                   6691573..6691657,6691765..6692462))
FT                   /gene="ID3"
FT                   /locus_tag="hCG_1982882"
FT                   /product="inhibitor of DNA binding 3, dominant negative
FT                   helix-loop-helix protein, transcript variant hCT2256378"
FT                   /note="gene_id=hCG1982882.0 transcript_id=hCT2256378.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6691598..6691657,6691765..6692064))
FT                   /codon_start=1
FT                   /gene="ID3"
FT                   /locus_tag="hCG_1982882"
FT                   /product="inhibitor of DNA binding 3, dominant negative
FT                   helix-loop-helix protein, isoform CRA_a"
FT                   /note="gene_id=hCG1982882.0 transcript_id=hCT2256378.0
FT                   protein_id=hCP1855227.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q02535"
FT                   /db_xref="HGNC:HGNC:5362"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR026052"
FT                   /db_xref="PDB:2LFH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02535"
FT                   /protein_id="EAW95060.1"
FT                   /translation="MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMN
FT                   HCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAEL
FT                   APELVISNDKRSFCH"
FT   CDS             complement(join(6691598..6691657,6691765..6692064))
FT                   /codon_start=1
FT                   /gene="ID3"
FT                   /locus_tag="hCG_1982882"
FT                   /product="inhibitor of DNA binding 3, dominant negative
FT                   helix-loop-helix protein, isoform CRA_a"
FT                   /note="gene_id=hCG1982882.0 transcript_id=hCT2256379.0
FT                   protein_id=hCP1855224.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC4"
FT                   /protein_id="EAW95061.1"
FT                   /translation="MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMN
FT                   HCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAEL
FT                   APELVISNDKRSFCH"
FT   gene            6759974..6773206
FT                   /locus_tag="hCG_2036965"
FT                   /note="gene_id=hCG2036965.0"
FT   mRNA            join(6759974..6760177,6760421..6760638,6761147..6761237,
FT                   6762121..6762197,6771749..6771891,6772320..6772435,
FT                   6773029..6773206)
FT                   /locus_tag="hCG_2036965"
FT                   /product="hCG2036965, transcript variant hCT2341311"
FT                   /note="gene_id=hCG2036965.0 transcript_id=hCT2341311.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 12-MAR-2003"
FT   mRNA            join(6759974..6760177,6760421..6760638,6761147..6761195,
FT                   6761584..6761625,6762121..6762197,6771749..6771891,
FT                   6772320..6772435,6773029..6773206)
FT                   /locus_tag="hCG_2036965"
FT                   /product="hCG2036965, transcript variant hCT2357825"
FT                   /note="gene_id=hCG2036965.0 transcript_id=hCT2357825.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   CDS             join(6762195..6762197,6771749..6771891,6772320..6772435,
FT                   6773029..6773189)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2036965"
FT                   /product="hCG2036965, isoform CRA_a"
FT                   /note="gene_id=hCG2036965.0 transcript_id=hCT2341311.0
FT                   protein_id=hCP1907895.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF8"
FT                   /protein_id="EAW95063.1"
FT                   /translation="MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRL
FT                   QRLSCSVLNSSPAMRGGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPC
FT                   EDPARGWLSANPGREPSPGICWHLNLGLPSLHNCEE"
FT   CDS             join(6762195..6762197,6771749..6771891,6772320..6772435,
FT                   6773029..6773189)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2036965"
FT                   /product="hCG2036965, isoform CRA_a"
FT                   /note="gene_id=hCG2036965.0 transcript_id=hCT2357825.0
FT                   protein_id=hCP1923050.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAF8"
FT                   /protein_id="EAW95064.1"
FT                   /translation="MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRL
FT                   QRLSCSVLNSSPAMRGGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPC
FT                   EDPARGWLSANPGREPSPGICWHLNLGLPSLHNCEE"
FT   gene            6803378..6810637
FT                   /locus_tag="hCG_1981735"
FT                   /note="gene_id=hCG1981735.0"
FT   mRNA            join(6803378..6803478,6803587..6803854,6808908..6808926,
FT                   6808960..6809078,6809144..6809369,6810310..6810637)
FT                   /locus_tag="hCG_1981735"
FT                   /product="hCG1981735, transcript variant hCT2254710"
FT                   /note="gene_id=hCG1981735.0 transcript_id=hCT2254710.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/5;
FT                   created on 26-AUG-2002"
FT   mRNA            6803378..>6803872
FT                   /locus_tag="hCG_1981735"
FT                   /product="hCG1981735, transcript variant hCT2254709"
FT                   /note="gene_id=hCG1981735.0 transcript_id=hCT2254709.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             join(6803420..6803478,6803587..6803854,6808908..6808926,
FT                   6808960..6809036)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1981735"
FT                   /product="hCG1981735, isoform CRA_b"
FT                   /note="gene_id=hCG1981735.0 transcript_id=hCT2254710.0
FT                   protein_id=hCP1855301.0 isoform=CRA_b"
FT                   /protein_id="EAW95066.1"
FT                   /translation="MGHCDFIKNMITVTLQLPPGGVGECEAGISKNKQICEHTLLAYTL
FT                   GMKQLIVTVNKMDITEPPYSSTCFEEISKEVKAYIKKISYNSQTLPFVPISGWHGDNML
FT                   EPGSKMPWFEGCVTLLKALDSITLLPTPRTSLCSCP"
FT   CDS             6803420..>6803872
FT                   /codon_start=1
FT                   /locus_tag="hCG_1981735"
FT                   /product="hCG1981735, isoform CRA_a"
FT                   /note="gene_id=hCG1981735.0 transcript_id=hCT2254709.0
FT                   protein_id=hCP1855304.0 isoform=CRA_a"
FT                   /protein_id="EAW95065.1"
FT                   /translation="MGHCDFIKNMITVTLQLPPGLPRPCCGDGQGVSQARSELGLPLSG
FT                   QEDCAVLIVASGVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNKMDITEPPYSSTC
FT                   FEEISKEVKAYIKKISYNSQTLPFVPISGWHGDNMLEPGSKVRAGWA"
FT   gene            6824382..6829749
FT                   /gene="RPL11"
FT                   /locus_tag="hCG_1739238"
FT                   /note="gene_id=hCG1739238.2"
FT   mRNA            join(6824382..6824469,6825249..6825399,6826447..6826553,
FT                   6827300..6827431,6828438..6828548,6828984..6829749)
FT                   /gene="RPL11"
FT                   /locus_tag="hCG_1739238"
FT                   /product="ribosomal protein L11, transcript variant
FT                   hCT1777320"
FT                   /note="gene_id=hCG1739238.2 transcript_id=hCT1777320.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6824382..6824469,6825249..6825399,6826447..6826553,
FT                   6827300..6829020)
FT                   /gene="RPL11"
FT                   /locus_tag="hCG_1739238"
FT                   /product="ribosomal protein L11, transcript variant
FT                   hCT1955732"
FT                   /note="gene_id=hCG1739238.2 transcript_id=hCT1955732.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(6824464..6824469,6825249..6825399,6826447..6826553,
FT                   6827300..6827431,6828438..6828548,6828984..6829013)
FT                   /codon_start=1
FT                   /gene="RPL11"
FT                   /locus_tag="hCG_1739238"
FT                   /product="ribosomal protein L11, isoform CRA_b"
FT                   /note="gene_id=hCG1739238.2 transcript_id=hCT1777320.1
FT                   protein_id=hCP1713381.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5VVD0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:Q5VVD0"
FT                   /protein_id="EAW95068.1"
FT                   /translation="MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTG
FT                   QTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGN
FT                   FGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAM
FT                   RWFQQKYDGIILPGK"
FT   CDS             join(6824464..6824469,6825249..6825399,6826447..6826553,
FT                   6827300..6827437)
FT                   /codon_start=1
FT                   /gene="RPL11"
FT                   /locus_tag="hCG_1739238"
FT                   /product="ribosomal protein L11, isoform CRA_a"
FT                   /note="gene_id=hCG1739238.2 transcript_id=hCT1955732.1
FT                   protein_id=hCP1765661.0 isoform=CRA_a"
FT                   /protein_id="EAW95067.1"
FT                   /translation="MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTG
FT                   QTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGN
FT                   FGFGIQEHIDLGIKYDPSIGIYGLDFYVV"
FT   gene            complement(6837937..6839561)
FT                   /locus_tag="hCG_1818479"
FT                   /note="gene_id=hCG1818479.1"
FT   mRNA            complement(6837937..6839561)
FT                   /locus_tag="hCG_1818479"
FT                   /product="hCG1818479"
FT                   /note="gene_id=hCG1818479.1 transcript_id=hCT1963792.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(6839247..6839543)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1818479"
FT                   /product="hCG1818479"
FT                   /note="gene_id=hCG1818479.1 transcript_id=hCT1963792.1
FT                   protein_id=hCP1778665.0"
FT                   /protein_id="EAW95069.1"
FT                   /translation="MEFSLLLPRLECNGAISAHRNLRLPGSSDSPASASLVAGITGMCH
FT                   HARLILYFFLVEMEFLHVGQAGLELPTSDDPPVSASQSAEITGMSHHARPLPG"
FT   gene            6875928..6904926
FT                   /gene="TCEB3"
FT                   /locus_tag="hCG_37551"
FT                   /note="gene_id=hCG37551.2"
FT   mRNA            join(6875928..6876064,6881507..6881563,6882328..6882434,
FT                   6883331..6884516,6884893..6885004,6886586..6886741,
FT                   6886849..6886946,6888329..6888509,6888760..6888871,
FT                   6889439..6889611,6891998..6893274,6904813..6904926)
FT                   /gene="TCEB3"
FT                   /locus_tag="hCG_37551"
FT                   /product="transcription elongation factor B (SIII),
FT                   polypeptide 3 (110kDa, elongin A), transcript variant
FT                   hCT2254721"
FT                   /note="gene_id=hCG37551.2 transcript_id=hCT2254721.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6875928..6876064,6881507..6881563,6882328..6882434,
FT                   6883331..6884516,6884893..6885004,6886586..6886741,
FT                   6886849..6886946,6888329..6888509,6888760..6888871,
FT                   6889439..6889611,6891998..6894530)
FT                   /gene="TCEB3"
FT                   /locus_tag="hCG_37551"
FT                   /product="transcription elongation factor B (SIII),
FT                   polypeptide 3 (110kDa, elongin A), transcript variant
FT                   hCT28784"
FT                   /note="gene_id=hCG37551.2 transcript_id=hCT28784.3; splice
FT                   donor-acceptor pairs covered / total pairs = 10/10; created
FT                   on 26-AUG-2002"
FT   CDS             join(6875990..6876064,6881507..6881563,6882328..6882434,
FT                   6883331..6884516,6884893..6885004,6886586..6886741,
FT                   6886849..6886946,6888329..6888509,6888760..6888871,
FT                   6889439..6889611,6891998..6892059)
FT                   /codon_start=1
FT                   /gene="TCEB3"
FT                   /locus_tag="hCG_37551"
FT                   /product="transcription elongation factor B (SIII),
FT                   polypeptide 3 (110kDa, elongin A), isoform CRA_a"
FT                   /note="gene_id=hCG37551.2 transcript_id=hCT2254721.0
FT                   protein_id=hCP1855283.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q14241"
FT                   /db_xref="HGNC:HGNC:11620"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="PDB:4HFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14241"
FT                   /protein_id="EAW95070.1"
FT                   /translation="MAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILAE
FT                   TGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQK
FT                   EEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSP
FT                   TYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRL
FT                   GASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENR
FT                   RPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDK
FT                   SKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEETDMEDE
FT                   FEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKLPKVN
FT                   KTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSP
FT                   QEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSV
FT                   LEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQD
FT                   AREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
FT                   KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKK
FT                   IAPMMAKTIKAFKNRFSRR"
FT   CDS             join(6875990..6876064,6881507..6881563,6882328..6882434,
FT                   6883331..6884516,6884893..6885004,6886586..6886741,
FT                   6886849..6886946,6888329..6888509,6888760..6888871,
FT                   6889439..6889611,6891998..6892059)
FT                   /codon_start=1
FT                   /gene="TCEB3"
FT                   /locus_tag="hCG_37551"
FT                   /product="transcription elongation factor B (SIII),
FT                   polypeptide 3 (110kDa, elongin A), isoform CRA_a"
FT                   /note="gene_id=hCG37551.2 transcript_id=hCT28784.3
FT                   protein_id=hCP47613.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC6"
FT                   /protein_id="EAW95071.1"
FT                   /translation="MAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILAE
FT                   TGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQK
FT                   EEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSP
FT                   TYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRL
FT                   GASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKALSKEENR
FT                   RPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPEKAKLDK
FT                   SKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEETDMEDE
FT                   FEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKLPKVN
FT                   KTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSP
FT                   QEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSV
FT                   LEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQD
FT                   AREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
FT                   KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKK
FT                   IAPMMAKTIKAFKNRFSRR"
FT   gene            complement(6892868..6910786)
FT                   /locus_tag="hCG_2041579"
FT                   /note="gene_id=hCG2041579.1"
FT   mRNA            complement(join(6892868..6893637,6904609..6904664,
FT                   6904766..6904924,6910698..6910786))
FT                   /locus_tag="hCG_2041579"
FT                   /product="hCG2041579, transcript variant hCT2357796"
FT                   /note="gene_id=hCG2041579.1 transcript_id=hCT2357796.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(6892868..6893637,6904609..6904664,
FT                   6904770..6904924,6910698..>6910785))
FT                   /locus_tag="hCG_2041579"
FT                   /product="hCG2041579, transcript variant hCT2346810"
FT                   /note="gene_id=hCG2041579.1 transcript_id=hCT2346810.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 18-JUN-2003"
FT   CDS             complement(6893239..>6893586)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041579"
FT                   /product="hCG2041579, isoform CRA_a"
FT                   /note="gene_id=hCG2041579.1 transcript_id=hCT2346810.0
FT                   protein_id=hCP1912673.0 isoform=CRA_a"
FT                   /protein_id="EAW95072.1"
FT                   /translation="TSYVALEFEVGLTEVSSYRKHWLCILGFEKTYQAVTLTIPSVCLS
FT                   GSLRTHISNVWHLPLPGSQPSGFLLDRCSLTANKGADTALLSSDLAPVQLELDGSHVVS
FT                   PILTLWLRHSP"
FT   CDS             complement(6893342..6893422)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041579"
FT                   /product="hCG2041579, isoform CRA_b"
FT                   /note="gene_id=hCG2041579.1 transcript_id=hCT2357796.0
FT                   protein_id=hCP1923051.0 isoform=CRA_b"
FT                   /protein_id="EAW95073.1"
FT                   /translation="MASTSTWVTTKWVSTRSVFLDSQQGS"
FT   gene            6910889..6921132
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /note="gene_id=hCG37684.2"
FT   mRNA            join(6910889..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6919770..6921132)
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, transcript
FT                   variant hCT1961487"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT1961487.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6910889..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6918810..6918918,6919770..6921125)
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, transcript
FT                   variant hCT28918"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT28918.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   mRNA            join(6910889..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6918810..6918918,6919770..6919867,
FT                   6919913..6920725)
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, transcript
FT                   variant hCT2254724"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT2254724.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(6911014..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6918810..6918918,6919770..6919867,
FT                   6919913..6920084)
FT                   /codon_start=1
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT2254724.0
FT                   protein_id=hCP1855290.0 isoform=CRA_a"
FT                   /protein_id="EAW95074.1"
FT                   /translation="MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNE
FT                   SREGSGRGVFKPWEERTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSE
FT                   MRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGAD
FT                   TTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFISCTTTCWEGQRD
FT                   EAPERVGCHSLCQALSLGLAAETWPTEDTTPLGGLCRCQGTIVVL"
FT   CDS             join(6911014..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6918810..6918918,6919770..6919871)
FT                   /codon_start=1
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT28918.2
FT                   protein_id=hCP47612.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9GZP4"
FT                   /db_xref="HGNC:HGNC:25022"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GZP4"
FT                   /protein_id="EAW95075.1"
FT                   /translation="MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNE
FT                   SREGSGRGVFKPWEERTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSE
FT                   MRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGAD
FT                   TTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFIS"
FT   CDS             join(6911014..6911211,6911936..6911979,6912362..6912439,
FT                   6918170..6918274,6919770..6919788)
FT                   /codon_start=1
FT                   /gene="C1orf128"
FT                   /locus_tag="hCG_37684"
FT                   /product="chromosome 1 open reading frame 128, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG37684.2 transcript_id=hCT1961487.1
FT                   protein_id=hCP1774604.0 isoform=CRA_c"
FT                   /protein_id="EAW95076.1"
FT                   /translation="MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNE
FT                   SREGSGRGVFKPWEERTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSE
FT                   MRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYATNFADTR"
FT   gene            6923110..6928037
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /note="gene_id=hCG1981746.0"
FT   mRNA            join(6923110..6923745,6925151..6925254,6925502..6925533,
FT                   6925645..6925710,6926199..6926246,6926354..6926424,
FT                   6926557..6926630,6926721..6926822,6926924..6927097,
FT                   6927179..6928037)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254740"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254740.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6923110..6923745,6925151..6925254,6925502..6925533,
FT                   6925645..6925710,6926199..6926246,6926354..6926424,
FT                   6926557..6926630,6926721..6926822,6926924..6927013,
FT                   6927028..6927097,6927179..6928037)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254737"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254737.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/10;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6923110..6923745,6925151..6925254,6925502..6925533,
FT                   6925645..6925710,6926199..6926246,6926354..6926424,
FT                   6926721..6926822,6926924..6927097,6927179..6928037)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254739"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254739.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6923110..6923745,6925151..6925254,6925645..6925710,
FT                   6926199..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6926822,6926924..>6927097)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254734"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254734.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(6923518..6923745,6925151..6925254,6925645..6925710,
FT                   6926199..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6926822,6926924..>6927097)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_e"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254734.0
FT                   protein_id=hCP1855291.0 isoform=CRA_e"
FT                   /protein_id="EAW95081.1"
FT                   /translation="MTGSSPAASNMAASIQRSRVPASGFRTVGQATSGSAMAGFPGLER
FT                   KFRRGRPRGKSVSAGERGESPKRPRKSQGVEAPAVEPCGVCVVTPCLCPCSPMLPPCLE
FT                   LSGKRPRHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDE
FT                   AGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCW
FT                   LPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPG
FT                   VMHSSCPQ"
FT   CDS             join(6923518..6923745,6925151..6925254,6925502..6925533,
FT                   6925645..6925710,6926199..6926215)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_c"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254739.0
FT                   protein_id=hCP1855297.0 isoform=CRA_c"
FT                   /protein_id="EAW95079.1"
FT                   /translation="MTGSSPAASNMAASIQRSRVPASGFRTVGQATSGSAMAGFPGLER
FT                   KFRRGRPRGKSVSAGERGESPKRPRKSQGVEAPAVEPCGVCVVTPCLCPCSPMLPPCLE
FT                   LSGKRPRLFFYMDLETQGTAGLTPSPPSGSLTSSTSVPMRLGSL"
FT   mRNA            join(6923899..6923998,6925151..6925254,6925502..6925533,
FT                   6925645..6925710,6926199..6926246,6926557..6926630,
FT                   6926721..6926822,6926924..6927097,6927179..6928037)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254736"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254736.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   CDS             join(6925177..6925254,6925502..6925533,6925645..6925710,
FT                   6926199..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6926822,6926924..6927097,6927179..6927229)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_f"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254740.0
FT                   protein_id=hCP1855292.0 isoform=CRA_f"
FT                   /protein_id="EAW95082.1"
FT                   /translation="MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALS
FT                   TIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIE
FT                   HEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSA
FT                   KDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKE
FT                   FLEKLLPPV"
FT   CDS             join(6925177..6925254,6925502..6925533,6925645..6925710,
FT                   6926199..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6926822,6926924..6927013,6927028..6927097,
FT                   6927179..6927207)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_b"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254737.0
FT                   protein_id=hCP1855293.0 isoform=CRA_b"
FT                   /protein_id="EAW95078.1"
FT                   /translation="MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALS
FT                   TIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIE
FT                   HEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSA
FT                   KDLAILQCHGELDPMVPVRFGALTVCCHTCQGPVQDIPGCHAQLLSSGDGSCEGIS"
FT   mRNA            join(6926119..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6927901)
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, transcript variant
FT                   hCT2254733"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254733.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(6926224..6926246,6926354..6926424,6926557..6926630,
FT                   6926721..6926894)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_a"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254733.0
FT                   protein_id=hCP1855295.0 isoform=CRA_a"
FT                   /protein_id="EAW95077.1"
FT                   /translation="MKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIP
FT                   ANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQVNVPTDPPALCVCI
FT                   LVAWGLLQH"
FT   CDS             join(6926580..6926630,6926721..6926822,6926924..6927097,
FT                   6927179..6927229)
FT                   /codon_start=1
FT                   /gene="LYPLA2"
FT                   /locus_tag="hCG_1981746"
FT                   /product="lysophospholipase II, isoform CRA_d"
FT                   /note="gene_id=hCG1981746.0 transcript_id=hCT2254736.0
FT                   protein_id=hCP1855298.0 isoform=CRA_d"
FT                   /protein_id="EAW95080.1"
FT                   /translation="MKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPL
FT                   HRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH
FT                   SSCPQEMAAVKEFLEKLLPPV"
FT   gene            complement(6928096..6933296)
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /note="gene_id=hCG37681.3"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931867..6931937,
FT                   6933213..6933296))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256373"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256373.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931228,6931863..6931937,6933213..6933296))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT1955752"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955752.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931863..6931937,
FT                   6933213..6933296))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT28915"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT28915.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931867..6931937,
FT                   6932361..6932620,6933213..6933274))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256363"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256363.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931867..6931937,
FT                   6932888..6933213))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256371"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256371.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6931231,
FT                   6931388..6931513,6931867..6931937,6932888..6933213))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256364"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256364.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931228,6931863..6931937,6932888..6933213))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT1955755"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955755.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931863..6931937,
FT                   6932888..6933213))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT1955754"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955754.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931867..6932071))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256367"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256367.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928096..6928504,6928648..6928762,
FT                   6929006..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931513,6931863..6932029))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT1955753"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955753.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6928098..6928302,6928345..6928504,
FT                   6928648..6928791,6929054..6929087,6929198..6929283,
FT                   6929377..6929443,6929535..6929648,6930196..6930372,
FT                   6930618..6930731,6931116..6931231,6931388..6931513,
FT                   6931867..6931937,6932361..6932620,6933213..6933274))
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, transcript variant
FT                   hCT2256370"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256370.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/13;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6928446..6928504,6928648..6928791,
FT                   6929054..6929087,6929198..6929283,6929377..6929443,
FT                   6929535..6929648,6930196..6930372,6930618..6930731,
FT                   6931116..6931231,6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_d"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256370.0
FT                   protein_id=hCP1855247.0 isoform=CRA_d"
FT                   /protein_id="EAW95089.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSAKLQL
FT                   PPVLQIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFG
FT                   TQA"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955754.1
FT                   protein_id=hCP1765613.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95083.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256373.0
FT                   protein_id=hCP1855245.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95084.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256363.0
FT                   protein_id=hCP1855235.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95086.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256367.0
FT                   protein_id=hCP1855244.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95090.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT28915.3
FT                   protein_id=hCP47609.3 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95091.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955753.1
FT                   protein_id=hCP1765608.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95092.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931231,
FT                   6931388..6931508))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_a"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256371.0
FT                   protein_id=hCP1855243.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH5"
FT                   /protein_id="EAW95093.1"
FT                   /translation="MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSL
FT                   PESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDY
FT                   YRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFF
FT                   IEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREA
FT                   LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVC
FT                   LEDPHQGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931160))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_b"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955752.1
FT                   protein_id=hCP1765600.1 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB7"
FT                   /protein_id="EAW95085.1"
FT                   /translation="MDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNL
FT                   TGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMI
FT                   RDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFG
FT                   NDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVCLEDPH
FT                   QGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930731,6931116..6931160))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_b"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT1955755.1
FT                   protein_id=hCP1765625.1 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAB7"
FT                   /protein_id="EAW95088.1"
FT                   /translation="MDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNL
FT                   TGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMI
FT                   RDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFG
FT                   NDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVCLEDPH
FT                   QGLRGMDPVQGGGTAGR"
FT   CDS             complement(join(6928728..6928762,6929006..6929087,
FT                   6929198..6929283,6929377..6929443,6929535..6929648,
FT                   6930196..6930372,6930618..6930746))
FT                   /codon_start=1
FT                   /gene="GALE"
FT                   /locus_tag="hCG_37681"
FT                   /product="UDP-galactose-4-epimerase, isoform CRA_c"
FT                   /note="gene_id=hCG37681.3 transcript_id=hCT2256364.0
FT                   protein_id=hCP1855246.0 isoform=CRA_c"
FT                   /protein_id="EAW95087.1"
FT                   /translation="MSPLQYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIM
FT                   KAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTW
FT                   NAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTG
FT                   VRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSGCWVCLEDPHQGLRGMDPVQ
FT                   GGGTAGR"
FT   gene            complement(6934379..6970413)
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /note="gene_id=hCG37683.4"
FT   mRNA            complement(join(6934379..6934596,6946790..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6969875..6969989))
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), transcript variant
FT                   hCT1955761"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT1955761.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6934379..6935065,6936901..6937026,
FT                   6940636..6940824,6943237..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6957858..6957946))
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), transcript variant
FT                   hCT28917"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT28917.2; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(6934388..6935065,6936901..6937026,
FT                   6940636..6940824,6943237..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6958591..6958690,6969857..6970413))
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), transcript variant
FT                   hCT2357817"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT2357817.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(6934407..6934596,6946790..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953078))
FT                   /codon_start=1
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), isoform CRA_c"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT1955761.1
FT                   protein_id=hCP1765607.1 isoform=CRA_c"
FT                   /protein_id="EAW95096.1"
FT                   /translation="MGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSV
FT                   IETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGA
FT                   ASELSTLPWPWGPCSLTSQDTGHGGSSQAGRGHLWKVESYVVAICQLQHLWKISTLNVI
FT                   FENSLCN"
FT   CDS             complement(join(6934964..6935065,6936901..6937026,
FT                   6940636..6940824,6943237..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6957858..6957917))
FT                   /codon_start=1
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), isoform CRA_a"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT28917.2
FT                   protein_id=hCP47611.2 isoform=CRA_a"
FT                   /db_xref="GOA:P35914"
FT                   /db_xref="HGNC:HGNC:5005"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:2CW6"
FT                   /db_xref="PDB:3MP3"
FT                   /db_xref="PDB:3MP4"
FT                   /db_xref="PDB:3MP5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35914"
FT                   /protein_id="EAW95094.1"
FT                   /translation="MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQ
FT                   NEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYP
FT                   VLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANIS
FT                   VRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVM
FT                   QEVPLAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDL
FT                   VYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL"
FT   CDS             complement(join(6934964..6935065,6936901..6937026,
FT                   6940636..6940824,6943237..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953078))
FT                   /codon_start=1
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), isoform CRA_b"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT2357817.0
FT                   protein_id=hCP1923057.0 isoform=CRA_b"
FT                   /db_xref="GOA:B1AK13"
FT                   /db_xref="HGNC:HGNC:5005"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1AK13"
FT                   /protein_id="EAW95095.1"
FT                   /translation="MGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSV
FT                   IETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGA
FT                   ASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEV
FT                   TKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLM
FT                   ALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLLEAGNFI
FT                   CQALNRKTSSKVAQATCKL"
FT   mRNA            complement(join(6942107..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6957858..6957946))
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), transcript variant
FT                   hCT1955764"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT1955764.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6943177..6943300,6946691..6946839,
FT                   6949176..6949271,6949977..6950084,6953010..6953093,
FT                   6957858..6957917))
FT                   /codon_start=1
FT                   /gene="HMGCL"
FT                   /locus_tag="hCG_37683"
FT                   /product="3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase
FT                   (hydroxymethylglutaricaciduria), isoform CRA_d"
FT                   /note="gene_id=hCG37683.4 transcript_id=hCT1955764.1
FT                   protein_id=hCP1765634.1 isoform=CRA_d"
FT                   /protein_id="EAW95097.1"
FT                   /translation="MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQ
FT                   NEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYP
FT                   VLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANIS
FT                   VRGYVSCALGCPYEGKISPAKVAEVCACVRAGGLVRVGHLVCP"
FT   gene            complement(6976882..6999945)
FT                   /gene="FUCA1"
FT                   /locus_tag="hCG_1739246"
FT                   /note="gene_id=hCG1739246.2"
FT   mRNA            complement(join(6976882..6977663,6977882..6977981,
FT                   6980443..6980633,6985924..6986124,6991362..6991467,
FT                   6994697..6994834,6997054..6997188,6999461..6999945))
FT                   /gene="FUCA1"
FT                   /locus_tag="hCG_1739246"
FT                   /product="fucosidase, alpha-L-1, tissue"
FT                   /note="gene_id=hCG1739246.2 transcript_id=hCT1777328.3;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6977523..6977663,6977882..6977981,
FT                   6980443..6980633,6985924..6986124,6991362..6991467,
FT                   6994697..6994834,6997054..6997188,6999461..6999849))
FT                   /codon_start=1
FT                   /gene="FUCA1"
FT                   /locus_tag="hCG_1739246"
FT                   /product="fucosidase, alpha-L-1, tissue"
FT                   /note="gene_id=hCG1739246.2 transcript_id=hCT1777328.3
FT                   protein_id=hCP1713413.3"
FT                   /protein_id="EAW95098.1"
FT                   /translation="MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLD
FT                   SRPLPAWFDEAKFGVFIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYA
FT                   DFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRD
FT                   LVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSY
FT                   KPDLIWSDGEWECPDTYWNSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCED
FT                   KFKPQSLPDHKWEMCTSIDKFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIG
FT                   PTKDGLIVPIFQERLLAVGKWLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIF
FT                   LHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAW
FT                   TIKLTGVK"
FT   gene            complement(7005323..7092687)
FT                   /gene="CNR2"
FT                   /locus_tag="hCG_1739239"
FT                   /note="gene_id=hCG1739239.1"
FT   mRNA            complement(join(7005323..7007226,7083080..7083156,
FT                   7092561..7092687))
FT                   /gene="CNR2"
FT                   /locus_tag="hCG_1739239"
FT                   /product="cannabinoid receptor 2 (macrophage), transcript
FT                   variant hCT1777321"
FT                   /note="gene_id=hCG1739239.1 transcript_id=hCT1777321.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7005323..7007226,7046958..7047076))
FT                   /gene="CNR2"
FT                   /locus_tag="hCG_1739239"
FT                   /product="cannabinoid receptor 2 (macrophage), transcript
FT                   variant hCT2256355"
FT                   /note="gene_id=hCG1739239.1 transcript_id=hCT2256355.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(7006099..7007181)
FT                   /codon_start=1
FT                   /gene="CNR2"
FT                   /locus_tag="hCG_1739239"
FT                   /product="cannabinoid receptor 2 (macrophage), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1739239.1 transcript_id=hCT2256355.0
FT                   protein_id=hCP1855275.0 isoform=CRA_a"
FT                   /db_xref="GOA:P34972"
FT                   /db_xref="HGNC:HGNC:2160"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001551"
FT                   /db_xref="InterPro:IPR002230"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="PDB:2KI9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P34972"
FT                   /protein_id="EAW95099.1"
FT                   /translation="MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGL
FT                   LSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKA
FT                   VFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSAL
FT                   VSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVAS
FT                   LSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAF
FT                   AFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTET
FT                   EADGKITPWPDSRDLDLSDC"
FT   CDS             complement(7006099..7007181)
FT                   /codon_start=1
FT                   /gene="CNR2"
FT                   /locus_tag="hCG_1739239"
FT                   /product="cannabinoid receptor 2 (macrophage), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1739239.1 transcript_id=hCT1777321.2
FT                   protein_id=hCP1713315.2 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH7"
FT                   /protein_id="EAW95100.1"
FT                   /translation="MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGL
FT                   LSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKA
FT                   VFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSAL
FT                   VSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVAS
FT                   LSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAF
FT                   AFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTET
FT                   EADGKITPWPDSRDLDLSDC"
FT   gene            complement(7035150..7037036)
FT                   /pseudo
FT                   /locus_tag="hCG_1739056"
FT                   /note="gene_id=hCG1739056.2"
FT   mRNA            complement(7035150..7037036)
FT                   /pseudo
FT                   /locus_tag="hCG_1739056"
FT                   /note="gene_id=hCG1739056.2 transcript_id=hCT1777134.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(7081849..7083176)
FT                   /pseudo
FT                   /locus_tag="hCG_2041578"
FT                   /note="gene_id=hCG2041578.1"
FT   mRNA            complement(join(7081849..7082025,7082331..7083176))
FT                   /pseudo
FT                   /locus_tag="hCG_2041578"
FT                   /note="gene_id=hCG2041578.1 transcript_id=hCT2346809.1;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 21-JAN-2004"
FT   gene            7092772..7097100
FT                   /gene="PNRC2"
FT                   /locus_tag="hCG_1739047"
FT                   /note="gene_id=hCG1739047.2"
FT   mRNA            join(7092772..7092894,7094567..7094772,7095078..7097100)
FT                   /gene="PNRC2"
FT                   /locus_tag="hCG_1739047"
FT                   /product="proline-rich nuclear receptor coactivator 2,
FT                   transcript variant hCT1955726"
FT                   /note="gene_id=hCG1739047.2 transcript_id=hCT1955726.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7093443..7093636,7094567..7094772,7095078..7097093)
FT                   /gene="PNRC2"
FT                   /locus_tag="hCG_1739047"
FT                   /product="proline-rich nuclear receptor coactivator 2,
FT                   transcript variant hCT1777123"
FT                   /note="gene_id=hCG1739047.2 transcript_id=hCT1777123.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             7095096..7095515
FT                   /codon_start=1
FT                   /gene="PNRC2"
FT                   /locus_tag="hCG_1739047"
FT                   /product="proline-rich nuclear receptor coactivator 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1739047.2 transcript_id=hCT1777123.2
FT                   protein_id=hCP1713321.1 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC2"
FT                   /protein_id="EAW95101.1"
FT                   /translation="MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKER
FT                   GHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSP
FT                   SVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV"
FT   CDS             7095096..7095515
FT                   /codon_start=1
FT                   /gene="PNRC2"
FT                   /locus_tag="hCG_1739047"
FT                   /product="proline-rich nuclear receptor coactivator 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1739047.2 transcript_id=hCT1955726.1
FT                   protein_id=hCP1765689.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC2"
FT                   /protein_id="EAW95102.1"
FT                   /translation="MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKER
FT                   GHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSP
FT                   SVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV"
FT   gene            complement(7097987..7114574)
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /note="gene_id=hCG1982870.1"
FT   mRNA            complement(join(7097987..7101363,7105218..7105271,
FT                   7105495..7105657,7108620..7108726,7112365..7112464,
FT                   7113838..7114108))
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   transcript variant hCT2256352"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256352.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7097987..7101363,7105218..7105271,
FT                   7105495..7105657,7108620..7108726,7111558..7111920,
FT                   7112300..7112464,7113838..7114108))
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   transcript variant hCT2256354"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256354.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7100079..7101363,7105495..7105657,
FT                   7108620..7108726,7112365..7112464,7113838..7114108))
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   transcript variant hCT2256349"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256349.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7100089..7101363,7105218..7105271,
FT                   7105495..7105657,7108620..7108697,7111558..7111920,
FT                   7112300..7112464,7113838..7114574))
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   transcript variant hCT2357805"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2357805.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(7101203..7101363,7105218..7105271,
FT                   7105495..7105624))
FT                   /codon_start=1
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2357805.0
FT                   protein_id=hCP1923046.0 isoform=CRA_d"
FT                   /protein_id="EAW95106.1"
FT                   /translation="MCTVLHAMMIMTDTDVLEAEVMKGGDQEVGLLITTIEDRIVLETV
FT                   DRLEDHGVAEAIPTMIDQTAAGIPSTVLLTTLQERSESGKRTKEGQFKRPKGGWKVLQY
FT                   EYCTNILTLV"
FT   CDS             complement(join(7101303..7101363,7105495..7105657,
FT                   7108620..7108726,7112365..7112417))
FT                   /codon_start=1
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256349.0
FT                   protein_id=hCP1855274.0 isoform=CRA_b"
FT                   /protein_id="EAW95104.1"
FT                   /translation="MCMFHLISTLAVQEDLLITFEDVRDAEDALHNLDRKWICGRQIEI
FT                   QFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSY
FT                   SPRKPNCSWNTQYSSAYYTSRKI"
FT   CDS             complement(join(7101303..7101363,7105218..7105271,
FT                   7105495..7105657,7108620..7108726,7112365..7112417))
FT                   /codon_start=1
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256352.0
FT                   protein_id=hCP1855272.0 isoform=CRA_c"
FT                   /protein_id="EAW95105.1"
FT                   /translation="MCMFHLISTLAVQEDLLITFEDVRDAEDALHNLDRKWICGRQIEI
FT                   QFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSY
FT                   SPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI"
FT   CDS             complement(join(7101303..7101363,7105218..7105271,
FT                   7105495..7105646))
FT                   /codon_start=1
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256354.0
FT                   protein_id=hCP1855273.0 isoform=CRA_e"
FT                   /protein_id="EAW95107.1"
FT                   /translation="MKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
FT                   SYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI"
FT   mRNA            complement(join(7102267..7105084,7105218..7105271,
FT                   7105495..7105657,7108620..7108726,7112365..7112464,
FT                   7113838..7114108))
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   transcript variant hCT2256351"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256351.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(7104787..7105084,7105218..7105271,
FT                   7105495..7105657,7108620..7108726,7112365..7112417))
FT                   /codon_start=1
FT                   /gene="FUSIP1"
FT                   /locus_tag="hCG_1982870"
FT                   /product="FUS interacting protein (serine/arginine-rich) 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1982870.1 transcript_id=hCT2256351.0
FT                   protein_id=hCP1855271.0 isoform=CRA_a"
FT                   /protein_id="EAW95103.1"
FT                   /translation="MCMFHLISTLAVQEDLLITFEDVRDAEDALHNLDRKWICGRQIEI
FT                   QFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSY
FT                   SPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSAS
FT                   HTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS
FT                   GH"
FT   gene            complement(7140443..7141083)
FT                   /pseudo
FT                   /locus_tag="hCG_1791922"
FT                   /note="gene_id=hCG1791922.2"
FT   mRNA            complement(join(7140443..7140520,7140821..7141083))
FT                   /pseudo
FT                   /locus_tag="hCG_1791922"
FT                   /note="gene_id=hCG1791922.2 transcript_id=hCT1831182.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 29-JAN-2004"
FT   gene            complement(7188788..7244608)
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /note="gene_id=hCG1812034.3"
FT   mRNA            complement(join(7188788..7190380,7191677..7191732,
FT                   7193813..7193835,7194026..7194062,7194699..7194862,
FT                   7195877..7195985,7196243..7196281,7196823..7196910,
FT                   7198642..7198752,7199772..7199839,7200721..7200780,
FT                   7200974..7201118,7203867..7204003,7204719..7204763,
FT                   7206908..7207017,7208062..7208218,7208902..7209016,
FT                   7212441..7212619,7213755..7213881,7214426..7214613,
FT                   7215018..7215139,7216893..7217064,7219069..7219252,
FT                   7221963..7222090,7222490..7222543,7223222..7223421,
FT                   7224599..7224740,7225372..7225533,7227278..7227415,
FT                   7227867..7227911,7230348..7230436,7232105..7232200,
FT                   7238345..7238502,7239498..7239657,7240418..7240498,
FT                   7240901..7241079,7244454..7244607))
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, transcript variant
FT                   hCT2256346"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT2256346.0;
FT                   splice donor-acceptor pairs covered / total pairs = 36/36;
FT                   created on 06-MAR-2003"
FT   mRNA            complement(join(7188788..7190380,7191677..7191732,
FT                   7193813..7193835,7194026..7194062,7194699..7194862,
FT                   7195877..7195985,7196243..7196281,7196823..7196910,
FT                   7198642..7198752,7198858..7199330))
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, transcript variant
FT                   hCT1955728"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT1955728.2;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 06-MAR-2003"
FT   CDS             complement(join(7190117..7190380,7191677..7191732,
FT                   7193813..7193835,7194026..7194062,7194699..7194862,
FT                   7195877..7195985,7196243..7196281,7196823..7196910,
FT                   7198642..7198752,7199772..7199839,7200721..7200780,
FT                   7200974..7201118,7203867..7204003,7204719..7204763,
FT                   7206908..7207017,7208062..7208218,7208902..7209016,
FT                   7212441..7212619,7213755..7213881,7214426..7214613,
FT                   7215018..7215139,7216893..7217064,7219069..7219252,
FT                   7221963..7222090,7222490..7222543,7223222..7223421,
FT                   7224599..7224740,7225372..7225533,7227278..7227415,
FT                   7227867..7227911,7230348..7230436,7232105..7232200,
FT                   7238345..7238502,7239498..7239657,7240418..7240498,
FT                   7240901..7241061))
FT                   /codon_start=1
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, isoform CRA_c"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT2256346.0
FT                   protein_id=hCP1855259.0 isoform=CRA_c"
FT                   /protein_id="EAW95110.1"
FT                   /translation="MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSS
FT                   VRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGF
FT                   GNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSH
FT                   AVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAI
FT                   EDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVF
FT                   AREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE
FT                   GLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDT
FT                   RGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP
FT                   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYV
FT                   VLAWEEPSPRGRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVR
FT                   AMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYI
FT                   YSRKVGTSEWQTVNNKPIQGTRFTVPRLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK
FT                   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQP
FT                   IPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE
FT                   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS
FT                   YVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF
FT                   QWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE
FT                   ELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFS
FT                   SPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKA
FT                   DAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYD
FT                   PETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIGALSAT
FT                   PLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPK
FT                   DSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAIIEKNRAKVVRGLPDV
FT                   ATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGTEVTITIEKVNSEDS
FT                   GRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM"
FT   CDS             complement(join(7190117..7190380,7191677..7191732,
FT                   7193813..7193835,7194026..7194062,7194699..7194862,
FT                   7195877..7195985,7196243..7196281,7196823..7196910,
FT                   7198642..7198752,7198858..7198959))
FT                   /codon_start=1
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, isoform CRA_a"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT1955728.2
FT                   protein_id=hCP1765649.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5VTT5"
FT                   /db_xref="HGNC:HGNC:26679"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5VTT5"
FT                   /protein_id="EAW95108.1"
FT                   /translation="MDISKKNRVRQGSRGRGKTISKNSESRGQQRRHMVTNTKKETRFQ
FT                   WFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDA
FT                   IFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTG
FT                   TTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKTLAII
FT                   EKNRAKVVRGLPDVATIMEDKTLCLTCIVSGDPTPEISWLKNDQPVTFLDRYRMEVRGT
FT                   EVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM"
FT   mRNA            complement(join(7198399..7198752,7199772..7199839,
FT                   7200721..7200780,7200974..7201118,7203867..7204003,
FT                   7204719..7204763,7206908..7207017,7208062..7208218,
FT                   7208902..7209016,7212441..7212619,7213755..7213881,
FT                   7214426..7214613,7215018..7215139,7216893..7217064,
FT                   7219069..7219252,7221963..7222090,7222490..7222543,
FT                   7223222..7223421,7224599..7224740,7225372..7225533,
FT                   7227278..7227415,7227867..7227911,7230348..7230436,
FT                   7232105..7232200,7238345..7238502,7239498..7239657,
FT                   7240418..7240498,7240901..7241079,7244454..7244608))
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, transcript variant
FT                   hCT2357798"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT2357798.0;
FT                   splice donor-acceptor pairs covered / total pairs = 28/28;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(7198537..7198752,7199772..7199839,
FT                   7200721..7200780,7200974..7201118,7203867..7204003,
FT                   7204719..7204763,7206908..7207017,7208062..7208218,
FT                   7208902..7209016,7212441..7212619,7213755..7213881,
FT                   7214426..7214613,7215018..7215139,7216893..7217064,
FT                   7219069..7219252,7221963..7222090,7222490..7222543,
FT                   7223222..7223421,7224599..7224740,7225372..7225533,
FT                   7227278..7227415,7227867..7227911,7230348..7230436,
FT                   7232105..7232200,7238345..7238502,7239498..7239657,
FT                   7240418..7240498,7240901..7241061))
FT                   /codon_start=1
FT                   /gene="MYOM3"
FT                   /locus_tag="hCG_1812034"
FT                   /product="myomesin family, member 3, isoform CRA_b"
FT                   /note="gene_id=hCG1812034.3 transcript_id=hCT2357798.0
FT                   protein_id=hCP1923041.0 isoform=CRA_b"
FT                   /protein_id="EAW95109.1"
FT                   /translation="MTLPHSLGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSS
FT                   VRRRTFRSSEEEHEFSAADYALAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGF
FT                   GNDWERTEIAFLQTHRLLRQRRDWKTLRRRTEEKVQEAKELRELCYGRGPWFWIPLRSH
FT                   AVWEHTTVLLTCTVQASPPPQVTWYKNDTRIDPRLFRAGKYRITNNYGLLSLEIRRCAI
FT                   EDSATYTVRVKNAHGQASSFAKVLVRTYLGKDAGFDSEIFKRSTFGPSVEFTSVLKPVF
FT                   AREKEPFSLSCLFSEDVLDAESIQWFRDGSLLRSSRRRKILYTDRQASLKVSCTYKEDE
FT                   GLYMVRVPSPFGPREQSTYVLVRDAEAENPGAPGSPLNVRCLDVNRDCLILTWAPPSDT
FT                   RGNPITAYTIERCQGESGEWIACHEAPGGTCRCPIQGLVEGQSYRFRVRAISRVGSSVP
FT                   SKASELVVMGDHDAARRKTEIPFDLGNKITISTDAFEDTVTIPSPPTNVHASEIREAYV
FT                   VLAWEEPSPRGRAPLTYSLEKSVIGSGTWEAISSESPVRSPRFAVLDLEKKKSYVFRVR
FT                   AMNQYGLSDPSEPSEPIALRGPPATLPPPAQVQAFRDTQTSVSLTWDPVKDPELLGYYI
FT                   YSRKVGTSEWQTVNNKPIQGTRFTVPRLRTGKEYEFCVRSVSEAGVGESSAATEPIRVK
FT                   QALATPSAPYGFALLNCGKNEMVIGWKPPKRRGGGKILGYFLDQHDSEELDWHAVNQQP
FT                   IPTRVCKVSDLHEGHFYEFRARAANWAGVGELSAPSSLFECKEWTMPQPGPPYDVRASE
FT                   VRATSLVLQWEPPLYMGAGPVTGYHVSFQEEGSEQWKPVTPGPISGTHLRVSDLQPGKS
FT                   YVFQVQAMNSAGLGQPSMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEF
FT                   QWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEE
FT                   ELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFS
FT                   SPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKA
FT                   DAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYD
FT                   PETGTGLLCIEEASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG"
FT   gene            complement(7252190..7275582)
FT                   /gene="IL22RA1"
FT                   /locus_tag="hCG_1739048"
FT                   /note="gene_id=hCG1739048.1"
FT   mRNA            complement(join(7252190..7254159,7255724..7255845,
FT                   7260563..7260701,7266632..7266807,7269547..7269725,
FT                   7270998..7271130,7275456..7275582))
FT                   /gene="IL22RA1"
FT                   /locus_tag="hCG_1739048"
FT                   /product="interleukin 22 receptor, alpha 1"
FT                   /note="gene_id=hCG1739048.1 transcript_id=hCT1777126.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(7253227..7254159,7255724..7255845,
FT                   7260563..7260701,7266632..7266807,7269547..7269725,
FT                   7270998..7271130,7275456..7275498))
FT                   /codon_start=1
FT                   /gene="IL22RA1"
FT                   /locus_tag="hCG_1739048"
FT                   /product="interleukin 22 receptor, alpha 1"
FT                   /note="gene_id=hCG1739048.1 transcript_id=hCT1777126.1
FT                   protein_id=hCP1713344.1"
FT                   /db_xref="GOA:Q8N6P7"
FT                   /db_xref="HGNC:HGNC:13700"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3DGC"
FT                   /db_xref="PDB:3DLQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N6P7"
FT                   /protein_id="EAW95111.1"
FT                   /translation="MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGP
FT                   EGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGR
FT                   SATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDL
FT                   FYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTL
FT                   PDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEH
FT                   VLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNV
FT                   PPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSW
FT                   PPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEES
FT                   QEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPS
FT                   GPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES"
FT   gene            <7283950..7290185
FT                   /locus_tag="hCG_2041611"
FT                   /note="gene_id=hCG2041611.0"
FT   mRNA            join(<7283950..7284153,7287427..7287607,7289670..7290185)
FT                   /locus_tag="hCG_2041611"
FT                   /product="hCG2041611"
FT                   /note="gene_id=hCG2041611.0 transcript_id=hCT2346842.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-JUN-2003"
FT   CDS             join(<7284095..7284153,7287427..7287607,7289670..7290095)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041611"
FT                   /product="hCG2041611"
FT                   /note="gene_id=hCG2041611.0 transcript_id=hCT2346842.0
FT                   protein_id=hCP1912674.0"
FT                   /protein_id="EAW95112.1"
FT                   /translation="RSGKTKESRFRLPKEGPLRSYLHEAARLVPERTSVQVWEFPWELA
FT                   PSHSPPQLRSLFVLPLLGSIIWTSLTAGKTPGETQGCFPSRRSVSEEKLGVPQGPDSAP
FT                   VVRCPRWPRRRGYLLGALPGNPSPWRIQVVGEILGAHPHPALGLAPSQPNSQRTQPCPR
FT                   RSPQCWPSFCLKNPKQRSLRLGPEEPWASLSPPHQPPSALEPGALAPGKKVVQCRAGS"
FT   gene            complement(7286572..7320387)
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /note="gene_id=hCG1982865.0"
FT   mRNA            complement(join(7286572..7290306,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301988,
FT                   7313119..7313242,7320186..7320387))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2256344"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2256344.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 12-MAR-2003"
FT   mRNA            complement(join(7286572..7290306,7291889..7292048,
FT                   7293956..7294098,7301804..7301988,7313119..7313242,
FT                   7319577..7319647))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2341117"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341117.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 12-MAR-2003"
FT   mRNA            complement(join(7286572..7290219,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319647))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2341116"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341116.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 12-MAR-2003"
FT   mRNA            complement(join(7286572..7290306,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319647))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2341114"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341114.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 12-MAR-2003"
FT   CDS             complement(join(7289545..7290219,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319634))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_b"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341116.0
FT                   protein_id=hCP1907700.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8IU57"
FT                   /db_xref="HGNC:HGNC:18584"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3OG4"
FT                   /db_xref="PDB:3OG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IU57"
FT                   /protein_id="EAW95114.1"
FT                   /translation="MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLP
FT                   GLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVS
FT                   PSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFW
FT                   KEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEV
FT                   PEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALELTRGVRPTPRVRA
FT                   PATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFLGQEHQAPGHSEAGGVDSGR
FT                   PRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDGHQESLPPP
FT                   EFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEAR
FT                   ESEIEDSDAGSWGAESTQRTEDRGRTLGHYMAR"
FT   CDS             complement(join(7289545..7290306,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319634))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_e"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341114.0
FT                   protein_id=hCP1907698.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8IU57"
FT                   /db_xref="HGNC:HGNC:18584"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3OG4"
FT                   /db_xref="PDB:3OG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IU57"
FT                   /protein_id="EAW95117.1"
FT                   /translation="MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLP
FT                   GLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVS
FT                   PSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFW
FT                   KEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEV
FT                   PEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQP
FT                   SRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSF
FT                   QPYIEPPSFLGQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWD
FT                   RAGSSGYLAEKGPGQGPGGDGHQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEP
FT                   NLVPGGPPVSLQTLTFCWESSPEEEEEARESEIEDSDAGSWGAESTQRTEDRGRTLGHY
FT                   MAR"
FT   CDS             complement(join(7289545..7290306,7291467..7291597,
FT                   7291889..7292048,7293956..7294098,7301804..7301921))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_a"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2256344.0
FT                   protein_id=hCP1855258.0 isoform=CRA_a"
FT                   /protein_id="EAW95113.1"
FT                   /translation="MMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPP
FT                   VLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQ
FT                   PAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGG
FT                   VIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKELTRGVRPT
FT                   PRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFLGQEHQAPGHSEAGG
FT                   VDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDGHQE
FT                   SLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEE
FT                   EEEARESEIEDSDAGSWGAESTQRTEDRGRTLGHYMAR"
FT   CDS             complement(join(7290242..7290306,7291889..7292048,
FT                   7293956..7294098,7301804..7301988,7313119..7313242,
FT                   7319577..7319634))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_f"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341117.0
FT                   protein_id=hCP1907701.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q8IU57"
FT                   /db_xref="HGNC:HGNC:18584"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3OG4"
FT                   /db_xref="PDB:3OG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IU57"
FT                   /protein_id="EAW95118.1"
FT                   /translation="MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLP
FT                   GLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVS
FT                   PSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFW
FT                   KEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEV
FT                   PGLFWTHTPCGNLSAQQTRVRE"
FT   mRNA            complement(join(<7291466..7291597,7291889..7292048,
FT                   7293956..7294098,7301804..7301988,7319577..7319628))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2357814"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2357814.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(<7291466..7291597,7291889..7292048,
FT                   7293956..7294098,7301804..7301921))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_d"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2357814.0
FT                   protein_id=hCP1923045.0 isoform=CRA_d"
FT                   /protein_id="EAW95116.1"
FT                   /translation="MMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPP
FT                   VLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQ
FT                   PAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGG
FT                   VIWKTLMGNPWFQRAKMPRAL"
FT   mRNA            complement(join(7293792..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319647))
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), transcript variant hCT2341115"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341115.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 12-MAR-2003"
FT   CDS             complement(join(7293830..7294098,7301804..7301988,
FT                   7313119..7313242,7319577..7319634))
FT                   /codon_start=1
FT                   /gene="IL28RA"
FT                   /locus_tag="hCG_1982865"
FT                   /product="interleukin 28 receptor, alpha (interferon,
FT                   lambda receptor), isoform CRA_c"
FT                   /note="gene_id=hCG1982865.0 transcript_id=hCT2341115.0
FT                   protein_id=hCP1907699.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8IU57"
FT                   /db_xref="HGNC:HGNC:18584"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3OG4"
FT                   /db_xref="PDB:3OG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IU57"
FT                   /protein_id="EAW95115.1"
FT                   /translation="MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLP
FT                   GLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVS
FT                   PSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFW
FT                   KEGAGNKVGSSFPAPRLGPLLHPFLLRFFSPSQPAPAPLLQEVFPVHS"
FT   gene            complement(7437582..7451924)
FT                   /locus_tag="hCG_2045610"
FT                   /note="gene_id=hCG2045610.0"
FT   mRNA            complement(join(7437582..7437806,7438204..7438341,
FT                   7440700..7440842,7441904..7442017,7451689..7451924))
FT                   /locus_tag="hCG_2045610"
FT                   /product="hCG2045610"
FT                   /note="gene_id=hCG2045610.0 transcript_id=hCT2360445.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 16-AUG-2004"
FT   CDS             complement(join(7440738..7440842,7441904..7442017,
FT                   7451689..7451802))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045610"
FT                   /product="hCG2045610"
FT                   /note="gene_id=hCG2045610.0 transcript_id=hCT2360445.0
FT                   protein_id=hCP1925675.0"
FT                   /protein_id="EAW95119.1"
FT                   /translation="MLLRDQPSKCRLTPGAWPPGGRGWSSGPHLGAHSCSCQEPARTGG
FT                   SQGEGSQGEHSLSPGRRGPAGKNRTQLSWPQMWKLRLKEAMKLDQVMQRQRTQGGISTQ
FT                   TVWLQS"
FT   gene            7449414..7494552
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /note="gene_id=hCG1813420.3"
FT   mRNA            join(7449414..7449591,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7494259..7494552)
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), transcript
FT                   variant hCT1813422"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT1813422.3;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 16-JAN-2004"
FT   mRNA            join(7449414..7449591,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7484450..7485393)
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), transcript
FT                   variant hCT2348170"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348170.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 16-JAN-2004"
FT   CDS             join(7449575..7449591,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7494259..7494445)
FT                   /codon_start=1
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT1813422.3
FT                   protein_id=hCP1768967.3 isoform=CRA_a"
FT                   /protein_id="EAW95120.1"
FT                   /translation="MSNELDFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPLTAATK
FT                   AMMRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLE
FT                   SPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSY
FT                   LLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPE
FT                   DYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVKS
FT                   VVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSF
FT                   VWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIF
FT                   CDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVL
FT                   FIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLL
FT                   YVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGETSLLHPRLSR
FT                   HPPPDCLECSHPVTQVRNMGFGDGFWRQRDLDSNPSPTTVNSLHFTVNSE"
FT   CDS             join(7449575..7449591,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7484450..7484564)
FT                   /codon_start=1
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348170.1
FT                   protein_id=hCP1913422.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8TE85"
FT                   /db_xref="HGNC:HGNC:25839"
FT                   /db_xref="InterPro:IPR007604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TE85"
FT                   /protein_id="EAW95121.1"
FT                   /translation="MSNELDFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPLTAATK
FT                   AMMRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLE
FT                   SPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSY
FT                   LLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPE
FT                   DYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVKS
FT                   VVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSF
FT                   VWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIF
FT                   CDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVL
FT                   FIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLL
FT                   YVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNNIIQ
FT                   HYSNHVAFLLDMGELDGKIQIILKEL"
FT   mRNA            join(7449589..7449770,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7484450..7485393)
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), transcript
FT                   variant hCT2348172"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348172.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 16-JAN-2004"
FT   mRNA            join(7453063..7453140,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7484450..7485393)
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), transcript
FT                   variant hCT2348171"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348171.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 16-JAN-2004"
FT   CDS             join(7453109..7453140,7461449..7461635,7464668..7464729,
FT                   7466506..7466851,7467102..7467175,7467660..7467813,
FT                   7468016..7468127,7469692..7469786,7472139..7472297,
FT                   7472718..7472796,7472916..7473049,7474921..7474955,
FT                   7476628..7476716,7477543..7477628,7480133..7480197,
FT                   7484450..7484564)
FT                   /codon_start=1
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348171.0
FT                   protein_id=hCP1913420.0 isoform=CRA_c"
FT                   /protein_id="EAW95122.1"
FT                   /translation="MWMNSILPIFLFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPL
FT                   TAATKAMMRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETD
FT                   LTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAG
FT                   SVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPDILKTSPE
FT                   PPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSS
FT                   NKVKSVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAY
FT                   NALSFVWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVC
FT                   QIKIFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLE
FT                   TPPVLFIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDL
FT                   QRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMD
FT                   NNIIQHYSNHVAFLLDMGELDGKIQIILKEL"
FT   CDS             join(7461573..7461635,7464668..7464729,7466506..7466851,
FT                   7467102..7467175,7467660..7467813,7468016..7468127,
FT                   7469692..7469786,7472139..7472297,7472718..7472796,
FT                   7472916..7473049,7474921..7474955,7476628..7476716,
FT                   7477543..7477628,7480133..7480197,7484450..7484564)
FT                   /codon_start=1
FT                   /gene="GRHL3"
FT                   /locus_tag="hCG_1813420"
FT                   /product="grainyhead-like 3 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=hCG1813420.3 transcript_id=hCT2348172.0
FT                   protein_id=hCP1913421.0 isoform=CRA_d"
FT                   /protein_id="EAW95123.1"
FT                   /translation="MRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYH
FT                   GMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAG
FT                   PSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPD
FT                   ILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGG
FT                   KGLALSSNKVKSVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVE
FT                   HIEEVAYNALSFVWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTER
FT                   LVHRAVCQIKIFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYL
FT                   RPETDLETPPVLFIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSK
FT                   QAKEGDLQRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKR
FT                   GILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIILKEL"
FT   gene            complement(7487075..7546239)
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /note="gene_id=hCG20010.2"
FT   mRNA            complement(join(7487075..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7531407..7531544,7544997..7545470))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT2256340"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2256340.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7487075..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7521639..7521757,7531407..7531544,
FT                   7543759..7543857))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT11082"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT11082.2; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(7487075..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7531407..7531544,7540789..7540903,
FT                   7543759..7543809))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT1955745"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT1955745.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7487076..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7521639..7521757,7531407..7531544,
FT                   7544997..7545186))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT2357812"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2357812.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(7487081..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7521639..7521757,7522003..7522146,
FT                   7531407..7531544,7543759..7543831))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT2357811"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2357811.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(7488617..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7531407..7531544,7544997..7545143))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2256340.0
FT                   protein_id=hCP1855251.0 isoform=CRA_d"
FT                   /protein_id="EAW95128.1"
FT                   /translation="MKKCHLGLDINNEKEAVLVSDRGAEKAPWEHGRGTSWCIVETARR
FT                   PAGLVLRRTCSRTFHQTNGTRHRILLTWTTLHRKMNALANIPDVPVKYRKNDIPGPGFY
FT                   NVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIVSKYPAANAYTIPSDFISKRDFSNSCS
FT                   SMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPP
FT                   GHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNP
FT                   ILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAAPPQPGLPG
FT                   PATYKPELPGKQSFLYNEDKKWIPVL"
FT   CDS             complement(join(7488617..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7521639..7521757,7531407..7531476))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT11082.2
FT                   protein_id=hCP37691.3 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC8"
FT                   /protein_id="EAW95125.1"
FT                   /translation="MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIP
FT                   ESEKKGFNSQAKRFPHKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTI
FT                   VSKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQR
FT                   NNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLT
FT                   STGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPR
FT                   KHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL"
FT   CDS             complement(join(7488617..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7521639..7521757,7531407..7531476))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2357812.0
FT                   protein_id=hCP1923049.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAC8"
FT                   /protein_id="EAW95127.1"
FT                   /translation="MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIP
FT                   ESEKKGFNSQAKRFPHKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTI
FT                   VSKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQR
FT                   NNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLT
FT                   STGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPR
FT                   KHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL"
FT   CDS             complement(join(7488617..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7514079,7531407..7531454))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT1955745.1
FT                   protein_id=hCP1765687.1 isoform=CRA_a"
FT                   /protein_id="EAW95124.1"
FT                   /translation="MNALANIPDVPVKYRKNDIPGPGFYNVIHQSPVSNSVSLSKKGTC
FT                   MFPSMCARLDTIVSKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPN
FT                   YYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSC
FT                   FKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGP
FT                   GQYEIVDYLGPRKHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDK
FT                   KWIPVL"
FT   CDS             complement(join(7488617..7488693,7490925..7491115,
FT                   7499748..7499913,7503777..7503885,7509728..7509898,
FT                   7513978..7513992))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2357811.0
FT                   protein_id=hCP1923048.0 isoform=CRA_e"
FT                   /protein_id="EAW95129.1"
FT                   /translation="MFPSMCARLDTIVSKYPAANAYTIPSDFISKRDFSNSCSSMFQLP
FT                   SFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDIN
FT                   ESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSA
FT                   QPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAAPPQPGLPGPATYKP
FT                   ELPGKQSFLYNEDKKWIPVL"
FT   mRNA            complement(join(<7490889..7491115,7499748..7499913,
FT                   7503777..7503885,7509728..7509898,7513978..7514079,
FT                   7521639..7521757,7531407..7531544,7546089..7546239))
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, transcript
FT                   variant hCT2256341"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2256341.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<7490889..7491115,7499748..7499913,
FT                   7503777..7503885,7509728..7509898,7513978..7514079,
FT                   7521639..7521757,7531407..7531476))
FT                   /codon_start=1
FT                   /gene="C1orf201"
FT                   /locus_tag="hCG_20010"
FT                   /product="chromosome 1 open reading frame 201, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG20010.2 transcript_id=hCT2256341.0
FT                   protein_id=hCP1855252.0 isoform=CRA_c"
FT                   /protein_id="EAW95126.1"
FT                   /translation="MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIP
FT                   ESEKKGFNSQAKRFPHKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTI
FT                   VSKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQR
FT                   NNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLT
FT                   STGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPR
FT                   KHFISSASFVSNTSRWTAAPPQPGLPGPGQRIVLNDCKNQ"
FT   gene            7545872..7603082
FT                   /gene="NPAL3"
FT                   /locus_tag="hCG_20009"
FT                   /note="gene_id=hCG20009.4"
FT   mRNA            join(7545872..7545990,7549377..7549726,7570265..7570333,
FT                   7572148..7572319,7575279..7575338,7579575..7579720,
FT                   7583503..7583599,7586232..7586367,7588982..7589070,
FT                   7590575..7590638,7594120..7594214,7599093..7603082)
FT                   /gene="NPAL3"
FT                   /locus_tag="hCG_20009"
FT                   /product="NIPA-like domain containing 3"
FT                   /note="gene_id=hCG20009.4 transcript_id=hCT11081.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             join(7549634..7549726,7570265..7570333,7572148..7572319,
FT                   7575279..7575338,7579575..7579720,7583503..7583599,
FT                   7586232..7586367,7588982..7589070,7590575..7590638,
FT                   7594120..7594214,7599093..7599292)
FT                   /codon_start=1
FT                   /gene="NPAL3"
FT                   /locus_tag="hCG_20009"
FT                   /product="NIPA-like domain containing 3"
FT                   /note="gene_id=hCG20009.4 transcript_id=hCT11081.3
FT                   protein_id=hCP37692.1"
FT                   /db_xref="GOA:Q6P499"
FT                   /db_xref="HGNC:HGNC:25233"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P499"
FT                   /protein_id="EAW95130.1"
FT                   /translation="MDGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHL
FT                   VVSIALNLQKYCHIRLAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVP
FT                   LSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMT
FT                   GENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLGSMTVVTVKA
FT                   VAGMLVLSIQGNLQLDYPIFYVMFVCMVATAVYQAAFLSQASQMYDSSLIASVGYILST
FT                   TIAITAGAIFYLDFIGEDVLHICMFALGCLIAFLGVFLITRNRKKPIPFEPYISMDAMP
FT                   GMQNMHDKGMTVQPELKASFSYGALENNDNISEIYAPATLPVMQEEHGSRSASGVPYRV
FT                   LEHTKKE"
FT   gene            complement(7626387..7632489)
FT                   /locus_tag="hCG_1812040"
FT                   /note="gene_id=hCG1812040.1"
FT   mRNA            complement(join(7626387..7626713,7629770..7629828,
FT                   7632463..7632489))
FT                   /locus_tag="hCG_1812040"
FT                   /product="hCG1812040"
FT                   /note="gene_id=hCG1812040.1 transcript_id=hCT1955742.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(7626459..7626629)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812040"
FT                   /product="hCG1812040"
FT                   /note="gene_id=hCG1812040.1 transcript_id=hCT1955742.0
FT                   protein_id=hCP1765682.0"
FT                   /db_xref="UniProtKB/TrEMBL:E3W6F2"
FT                   /protein_id="EAW95131.1"
FT                   /translation="MVNPKDEEPVSPVTPELPYQPWVPPSILPSYGKEIFLDLVRCLLQ
FT                   PNTIPTDIHCK"
FT   gene            7633008..7667053
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /note="gene_id=hCG19368.2"
FT   mRNA            join(7633008..7633265,7644425..7644678,7661310..7661483,
FT                   7663175..7663346,7665185..7667053)
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   transcript variant hCT10437"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT10437.3; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   mRNA            join(7633008..7633265,7644425..7644678,7661310..7661483,
FT                   7663175..7663346,7665185..7665461,7665875..7665953)
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   transcript variant hCT2253281"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT2253281.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7633008..7633265,7644425..7644678,7661310..7661483,
FT                   7663205..7663346,7665185..7665461,7665875..7665953)
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   transcript variant hCT2253282"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT2253282.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             join(7644484..7644678,7661310..7661483,7663175..7663346,
FT                   7665185..7665369)
FT                   /codon_start=1
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT2253281.0
FT                   protein_id=hCP1855345.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9UKA8"
FT                   /db_xref="HGNC:HGNC:3042"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UKA8"
FT                   /protein_id="EAW95133.1"
FT                   /translation="MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDL
FT                   PTSLFACSVHEAVFEAREQKERFEALFTIYDDQVTFQLFKSFRRVRINFSKPEAAARAR
FT                   IELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDA
FT                   MPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTR
FT                   RPDPPTAALNEPQTFDCAL"
FT   CDS             join(7644484..7644678,7661310..7661483,7663175..7663346,
FT                   7665185..7665369)
FT                   /codon_start=1
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT10437.3
FT                   protein_id=hCP37693.2 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH2"
FT                   /protein_id="EAW95134.1"
FT                   /translation="MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDL
FT                   PTSLFACSVHEAVFEAREQKERFEALFTIYDDQVTFQLFKSFRRVRINFSKPEAAARAR
FT                   IELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDA
FT                   MPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTR
FT                   RPDPPTAALNEPQTFDCAL"
FT   CDS             join(7644484..7644678,7661310..7661483,7663205..7663346,
FT                   7665185..7665369)
FT                   /codon_start=1
FT                   /gene="DSCR1L2"
FT                   /locus_tag="hCG_19368"
FT                   /product="Down syndrome critical region gene 1-like 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG19368.2 transcript_id=hCT2253282.0
FT                   protein_id=hCP1855344.0 isoform=CRA_a"
FT                   /protein_id="EAW95132.1"
FT                   /translation="MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDL
FT                   PTSLFACSVHEAVFEAREQKERFEALFTIYDDQVTFQLFKSFRRVRINFSKPEAAARAR
FT                   IELHETDFNGQKLKLYFAQSYLLPPQPVKQFLISPPASPPVGWKQSEDAMPVINYDLLC
FT                   AVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTAALN
FT                   EPQTFDCAL"
FT   gene            complement(7666740..7686100)
FT                   /locus_tag="hCG_1812928"
FT                   /note="gene_id=hCG1812928.1"
FT   mRNA            complement(join(7666740..7666981,7668795..7669967,
FT                   7681972..7682132,7685900..7686100))
FT                   /locus_tag="hCG_1812928"
FT                   /product="hCG1812928"
FT                   /note="gene_id=hCG1812928.1 transcript_id=hCT1958304.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(7669078..7669401)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1812928"
FT                   /product="hCG1812928"
FT                   /note="gene_id=hCG1812928.1 transcript_id=hCT1958304.1
FT                   protein_id=hCP1765673.0"
FT                   /protein_id="EAW95135.1"
FT                   /translation="MMRFFLFTVSHQGKKNPPTSCLFFFLMPGISIHCLFKRPMQKKVE
FT                   KALAQELGLPVVVPGLPCWGCLSQCHNLSFSNLCNMGIEYMISKVTFTSVIEPLRKPNL
FT                   FTL"
FT   gene            7730296..7737909
FT                   /gene="C1orf130"
FT                   /locus_tag="hCG_1980797"
FT                   /note="gene_id=hCG1980797.0"
FT   mRNA            join(7730296..7731105,7735687..7737909)
FT                   /gene="C1orf130"
FT                   /locus_tag="hCG_1980797"
FT                   /product="chromosome 1 open reading frame 130"
FT                   /note="gene_id=hCG1980797.0 transcript_id=hCT2253290.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(7730939..7731105,7735687..7735828)
FT                   /codon_start=1
FT                   /gene="C1orf130"
FT                   /locus_tag="hCG_1980797"
FT                   /product="chromosome 1 open reading frame 130"
FT                   /note="gene_id=hCG1980797.0 transcript_id=hCT2253290.0
FT                   protein_id=hCP1855353.0"
FT                   /protein_id="EAW95136.1"
FT                   /translation="MSGATAGRPPGLRSVCTFTVSASLLSVGSGAIVAAVVVVVIIIFT
FT                   VVLILLKMYNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVETR"
FT   gene            <7740290..7761865
FT                   /locus_tag="hCG_2041612"
FT                   /note="gene_id=hCG2041612.0"
FT   mRNA            join(<7740290..7740412,7761726..7761865)
FT                   /locus_tag="hCG_2041612"
FT                   /product="hCG2041612"
FT                   /note="gene_id=hCG2041612.0 transcript_id=hCT2346843.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<7740299..7740412,7761726..7761824)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041612"
FT                   /product="hCG2041612"
FT                   /note="gene_id=hCG2041612.0 transcript_id=hCT2346843.0
FT                   protein_id=hCP1912675.0"
FT                   /protein_id="EAW95137.1"
FT                   /translation="RGQILLLPESLAARVRDMTWTSANQTDQTLLPWTLDLKSQSFALL
FT                   SRLVSNSWIQVSHPPWPPKVLGLQI"
FT   gene            7763154..7803571
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /note="gene_id=hCG96287.2"
FT   mRNA            join(7763154..7763187,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783120,7784943..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7796903..7797013,7799211..7799675,7800208..7800403,
FT                   7801474..7801553,7801619..7801683,7802270..7803034,
FT                   7803098..7803183)
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, transcript
FT                   variant hCT2253296"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT2253296.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/18;
FT                   created on 26-AUG-2002"
FT   CDS             join(7763170..7763187,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783120,7784943..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7796903..7797013,7799211..7799675,7800208..7800403,
FT                   7801474..7801553,7801619..7801683,7802270..7802277)
FT                   /codon_start=1
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT2253296.0
FT                   protein_id=hCP1855357.0 isoform=CRA_b"
FT                   /protein_id="EAW95139.1"
FT                   /translation="MDQTLKGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLE
FT                   VIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGEL
FT                   WPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSRE
FT                   KRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPEL
FT                   PEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSRS
FT                   KSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRS
FT                   RSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHR
FT                   PSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRK
FT                   VELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVG
FT                   RRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPP
FT                   RRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVS
FT                   HSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSS
FT                   SPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVS
FT                   GSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKK
FT                   KKDKKHKKDKKHKNHCSCHNHISTGRASGSARAEEGD"
FT   mRNA            join(7773188..7773435,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783120,7784943..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7796903..7797013,7799211..7799675,7800208..7800403,
FT                   7801474..7801683,7802270..7803571)
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, transcript
FT                   variant hCT2253294"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT2253294.0;
FT                   splice donor-acceptor pairs covered / total pairs = 16/16;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7773188..7773435,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783112,7784926..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7793271..7793312,7796903..7797013,7799211..7799675,
FT                   7800208..7800403,7801474..7801683,7802270..7803571)
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, transcript
FT                   variant hCT87587"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT87587.3; splice
FT                   donor-acceptor pairs covered / total pairs = 16/17; created
FT                   on 26-AUG-2002"
FT   CDS             join(7773415..7773435,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783120,7784943..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7796903..7797013,7799211..7799675,7800208..7800403,
FT                   7801474..7801683,7802270..7802374)
FT                   /codon_start=1
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT2253294.0
FT                   protein_id=hCP1855355.0 isoform=CRA_a"
FT                   /protein_id="EAW95138.1"
FT                   /translation="MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNL
FT                   EVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGE
FT                   LWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSR
FT                   EKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPE
FT                   LPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSR
FT                   SKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRR
FT                   SRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRH
FT                   RPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPR
FT                   KVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEV
FT                   GRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPP
FT                   PRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRV
FT                   SHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTS
FT                   SSPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSV
FT                   SGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKK
FT                   KKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAATTTLAQEEPVAAPEPKKE
FT                   TESEAEDNLDDLEKHLREKALRSMRKAQVSPQS"
FT   CDS             join(7773415..7773435,7776072..7776161,7776755..7776877,
FT                   7778947..7779117,7780059..7780174,7781497..7781700,
FT                   7782522..7782716,7783001..7783112,7784926..7785217,
FT                   7790807..7790887,7791398..7791484,7792748..7792892,
FT                   7793271..7793312,7796903..7797013,7799211..7799675,
FT                   7800208..7800403,7801474..7801683,7802270..7802374)
FT                   /codon_start=1
FT                   /gene="SRRM1"
FT                   /locus_tag="hCG_96287"
FT                   /product="serine/arginine repetitive matrix 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG96287.2 transcript_id=hCT87587.3
FT                   protein_id=hCP201155.3 isoform=CRA_c"
FT                   /protein_id="EAW95140.1"
FT                   /translation="MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNL
FT                   EVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGE
FT                   LWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSR
FT                   EKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPE
FT                   LPEPSVKVKEPSVQEATSTSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKTRPRSRSR
FT                   SKSRSRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRR
FT                   SRSPNTLFHRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPR
FT                   RRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAP
FT                   KPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKN
FT                   GEVGRRRRHSPSRSASPSPRKRQKETSPRMQMGKRWQSPVTKSGRRRRSPSPPPTRRRR
FT                   SPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPP
FT                   PPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQ
FT                   PNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKA
FT                   ASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKAKSPTPS
FT                   PSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAAAAAAVTPAAIAAAT
FT                   TTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS"
FT   gene            complement(7834999..>7837830)
FT                   /locus_tag="hCG_2038843"
FT                   /note="gene_id=hCG2038843.0"
FT   mRNA            complement(join(7834999..7836303,7837717..>7837830))
FT                   /locus_tag="hCG_2038843"
FT                   /product="hCG2038843"
FT                   /note="gene_id=hCG2038843.0 transcript_id=hCT2343269.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 07-APR-2003"
FT   CDS             complement(join(7836017..7836303,7837717..>7837804))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038843"
FT                   /product="hCG2038843"
FT                   /note="gene_id=hCG2038843.0 transcript_id=hCT2343269.0
FT                   protein_id=hCP1908740.0"
FT                   /protein_id="EAW95141.1"
FT                   /translation="FVDGGWGSCIAMQLCTDNLKLNIRFILLRSDPPTSASQSARITGV
FT                   SHRTWLQRYSFSVWRAVSFSLGNAPLVQSSLDRWGNRVRERERGFSRSHSKLDAQQRLE
FT                   LRFFSPSPAPPLWSVDSFKD"
FT   gene            7875344..7971899
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /note="gene_id=hCG24047.3"
FT   mRNA            join(7875344..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7968954,
FT                   7969017..7970320,7970786..7971899)
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, transcript
FT                   variant hCT15161"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT15161.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            join(7875344..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7968954,
FT                   7969017..7969855,7969880..7970345,7970810..7971623)
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, transcript
FT                   variant hCT2253303"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253303.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7875344..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7968954,
FT                   7969020..7969855,7969880..7970345,7970810..7971623)
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, transcript
FT                   variant hCT2253301"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253301.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7875344..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7968954,
FT                   7969020..7970501)
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, transcript
FT                   variant hCT2253304"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253304.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(7875524..7875564,7927735..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7968954,
FT                   7969017..7970324,7970786..7971899)
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, transcript
FT                   variant hCT2253300"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253300.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(7875593..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7967993)
FT                   /codon_start=1
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, isoform CRA_b"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253304.0
FT                   protein_id=hCP1855341.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6FIC5"
FT                   /db_xref="InterPro:IPR002946"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIC5"
FT                   /protein_id="EAW95143.1"
FT                   /translation="MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMIL
FT                   WLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKY
FT                   LKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEI
FT                   DENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLT
FT                   NAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK"
FT   CDS             join(7875593..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7967993)
FT                   /codon_start=1
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, isoform CRA_b"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253301.0
FT                   protein_id=hCP1855338.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6FIC5"
FT                   /db_xref="InterPro:IPR002946"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIC5"
FT                   /protein_id="EAW95144.1"
FT                   /translation="MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMIL
FT                   WLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKY
FT                   LKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEI
FT                   DENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLT
FT                   NAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK"
FT   CDS             join(7875593..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7967993)
FT                   /codon_start=1
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, isoform CRA_b"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253303.0
FT                   protein_id=hCP1855337.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6FIC5"
FT                   /db_xref="InterPro:IPR002946"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIC5"
FT                   /protein_id="EAW95145.1"
FT                   /translation="MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMIL
FT                   WLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKY
FT                   LKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEI
FT                   DENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLT
FT                   NAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK"
FT   CDS             join(7875593..7875664,7927747..7927856,7943957..7944082,
FT                   7956992..7957098,7966916..7967097,7967829..7967993)
FT                   /codon_start=1
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, isoform CRA_b"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT15161.3
FT                   protein_id=hCP41361.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q6FIC5"
FT                   /db_xref="InterPro:IPR002946"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIC5"
FT                   /protein_id="EAW95146.1"
FT                   /translation="MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMIL
FT                   WLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKY
FT                   LKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEI
FT                   DENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLT
FT                   NAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK"
FT   CDS             join(7927801..7927856,7943957..7944082,7956992..7957098,
FT                   7966916..7967097,7967829..7967993)
FT                   /codon_start=1
FT                   /gene="CLIC4"
FT                   /locus_tag="hCG_24047"
FT                   /product="chloride intracellular channel 4, isoform CRA_a"
FT                   /note="gene_id=hCG24047.3 transcript_id=hCT2253300.0
FT                   protein_id=hCP1855336.0 isoform=CRA_a"
FT                   /protein_id="EAW95142.1"
FT                   /translation="MILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTD
FT                   VNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLK
FT                   TLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKY
FT                   RNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK"
FT   gene            complement(8027185..8092792)
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /note="gene_id=hCG1812030.1"
FT   mRNA            complement(join(8027185..8030285,8034878..8035036,
FT                   8046859..8046963,8055193..8055349,8057206..8057471,
FT                   8092133..8092198,8092639..8092792))
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, transcript
FT                   variant hCT1955718"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT1955718.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8027185..8030285,8034878..8035036,
FT                   8046859..8046963,8055193..8055349,8057206..8057741))
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, transcript
FT                   variant hCT1955719"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT1955719.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8029001..8029073,8029129..8030285,
FT                   8034878..8035036,8046859..8046963,8055193..8055349,
FT                   8057206..8057471,8092133..8092198,8092639..8092792))
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, transcript
FT                   variant hCT2254122"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT2254122.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(8029741..8030285,8034878..8035036,
FT                   8046859..8046963,8055193..8055349,8057206..8057471,
FT                   8092133..8092190))
FT                   /codon_start=1
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT2254122.0
FT                   protein_id=hCP1855334.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q13761"
FT                   /db_xref="HGNC:HGNC:10473"
FT                   /db_xref="InterPro:IPR000040"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR012346"
FT                   /db_xref="InterPro:IPR013524"
FT                   /db_xref="InterPro:IPR013711"
FT                   /db_xref="InterPro:IPR016554"
FT                   /db_xref="InterPro:IPR027384"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13761"
FT                   /protein_id="EAW95148.1"
FT                   /translation="MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGE
FT                   NSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLP
FT                   VAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKS
FT                   FTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRV
FT                   TPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPR
FT                   MHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQAN
FT                   PSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS
FT                   DGVEADGSHSNSPTALSTPGRMDEAVWRPY"
FT   CDS             complement(join(8029741..8030285,8034878..8035036,
FT                   8046859..8046963,8055193..8055349,8057206..8057471,
FT                   8092133..8092190))
FT                   /codon_start=1
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT1955718.1
FT                   protein_id=hCP1765676.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH4"
FT                   /protein_id="EAW95149.1"
FT                   /translation="MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGE
FT                   NSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLP
FT                   VAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKS
FT                   FTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRV
FT                   TPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPR
FT                   MHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQAN
FT                   PSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS
FT                   DGVEADGSHSNSPTALSTPGRMDEAVWRPY"
FT   CDS             complement(join(8029741..8030285,8034878..8035036,
FT                   8046859..8046963,8055193..8055349,8057206..8057487))
FT                   /codon_start=1
FT                   /gene="RUNX3"
FT                   /locus_tag="hCG_1812030"
FT                   /product="runt-related transcription factor 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1812030.1 transcript_id=hCT1955719.1
FT                   protein_id=hCP1765655.0 isoform=CRA_a"
FT                   /protein_id="EAW95147.1"
FT                   /translation="MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPG
FT                   GRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDG
FT                   TVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQV
FT                   ATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTT
FT                   SHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYS
FT                   ATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGS
FT                   YQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPT
FT                   ALSTPGRMDEAVWRPY"
FT   gene            complement(<8171375..8240606)
FT                   /locus_tag="hCG_1817578"
FT                   /note="gene_id=hCG1817578.1"
FT   mRNA            complement(join(<8171375..8171504,8231307..8231425,
FT                   8240366..8240606))
FT                   /locus_tag="hCG_1817578"
FT                   /product="hCG1817578"
FT                   /note="gene_id=hCG1817578.1 transcript_id=hCT1959922.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<8171375..8171504,8231307..8231411))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1817578"
FT                   /product="hCG1817578"
FT                   /note="gene_id=hCG1817578.1 transcript_id=hCT1959922.0
FT                   protein_id=hCP1770627.0"
FT                   /protein_id="EAW95150.1"
FT                   /translation="MCWRALNPRSFTPRALQIYPWSLTSQHESVTQSFQMDAGGVGAGG
FT                   KGDVMTEAEIGAMHFEMEEEATSQGMQVPLESD"
FT   gene            complement(8252408..8252967)
FT                   /pseudo
FT                   /locus_tag="hCG_1644341"
FT                   /note="gene_id=hCG1644341.2"
FT   mRNA            complement(8252408..8252967)
FT                   /pseudo
FT                   /locus_tag="hCG_1644341"
FT                   /note="gene_id=hCG1644341.2 transcript_id=hCT1644468.3;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   gene            <8335629..>8336361
FT                   /locus_tag="hCG_2041824"
FT                   /note="gene_id=hCG2041824.0"
FT   mRNA            join(<8335629..8335712,8336024..>8336361)
FT                   /locus_tag="hCG_2041824"
FT                   /product="hCG2041824"
FT                   /note="gene_id=hCG2041824.0 transcript_id=hCT2347055.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             <8336077..>8336361
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041824"
FT                   /product="hCG2041824"
FT                   /note="gene_id=hCG2041824.0 transcript_id=hCT2347055.0
FT                   protein_id=hCP1912677.0"
FT                   /protein_id="EAW95151.1"
FT                   /translation="YHSINTCYYLPRREQFTVDHVRSCISTNLKTSPLEFRAAAFLLEA
FT                   QAQVLFSLFIWIHSSHTGLLAASQNTPASFLYLVLCFCFAIALKTFGHSI"
FT   gene            complement(8349762..8360014)
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /note="gene_id=hCG24045.3"
FT   mRNA            complement(join(8349762..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8356488..8356613,
FT                   8359594..8359701,8359934..8360014))
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), transcript variant hCT15159"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT15159.3; splice
FT                   donor-acceptor pairs covered / total pairs = 6/6; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(8349762..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8356488..8356613,
FT                   8359594..8359922))
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), transcript variant hCT1955747"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT1955747.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8350171..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8359594..8359701,
FT                   8359934..8360002))
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), transcript variant hCT2357799"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT2357799.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(8350756..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8359594..8359701,
FT                   8359934..8359957))
FT                   /codon_start=1
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), isoform CRA_d"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT2357799.0
FT                   protein_id=hCP1923052.0 isoform=CRA_d"
FT                   /protein_id="EAW95155.1"
FT                   /translation="MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRE
FT                   CAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDM
FT                   ETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDD
FT                   ADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV"
FT   CDS             complement(join(8350756..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8356488..8356613,
FT                   8359594..8359701,8359934..8359957))
FT                   /codon_start=1
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT15159.3
FT                   protein_id=hCP41359.2 isoform=CRA_a"
FT                   /protein_id="EAW95152.1"
FT                   /translation="MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRN
FT                   EARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEIS
FT                   AEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPT
FT                   SNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKA
FT                   ERFYGKYTAEIKQNLERGTAV"
FT   CDS             complement(join(8350756..8350921,8352492..8352590,
FT                   8354932..8355022,8355608..8355725,8356488..8356613,
FT                   8359594..8359599))
FT                   /codon_start=1
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT1955747.0
FT                   protein_id=hCP1765698.0 isoform=CRA_c"
FT                   /protein_id="EAW95154.1"
FT                   /translation="MRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKE
FT                   CAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDM
FT                   ETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDD
FT                   ADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV"
FT   mRNA            complement(join(8359099..8359701,8359934..8360014))
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), transcript variant hCT2254116"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT2254116.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(8359501..8359701,8359934..8359957))
FT                   /codon_start=1
FT                   /gene="SYF2"
FT                   /locus_tag="hCG_24045"
FT                   /product="SYF2 homolog, RNA splicing factor (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=hCG24045.3 transcript_id=hCT2254116.0
FT                   protein_id=hCP1855316.0 isoform=CRA_b"
FT                   /protein_id="EAW95153.1"
FT                   /translation="MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRV
FT                   SSLGGRLRSVIWPSLCAFVEGTRKPHHCV"
FT   gene            <8367071..8368719
FT                   /locus_tag="hCG_2041823"
FT                   /note="gene_id=hCG2041823.0"
FT   mRNA            join(<8367071..8367365,8368545..8368719)
FT                   /locus_tag="hCG_2041823"
FT                   /product="hCG2041823"
FT                   /note="gene_id=hCG2041823.0 transcript_id=hCT2347054.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<8367182..8367365,8368545..8368621)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2041823"
FT                   /product="hCG2041823"
FT                   /note="gene_id=hCG2041823.0 transcript_id=hCT2347054.0
FT                   protein_id=hCP1912676.0"
FT                   /protein_id="EAW95156.1"
FT                   /translation="EAEIIAHCVLASPAQVRVSPPNAPAHRPSPVGRSPGLPGVGIAWV
FT                   PQEGPGYVRKSEARGSNQPDQHGQTPSLLKIQACNPSYLGG"
FT   gene            complement(8369739..8374985)
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /note="gene_id=hCG1981326.0"
FT   mRNA            complement(join(8369739..8370195,8371040..8371123,
FT                   8372641..8372792,8373935..8374520,8374800..8374985))
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, transcript
FT                   variant hCT2254138"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254138.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8369739..8370195,8371040..8371123,
FT                   8372641..8372792,8373935..8374454,8374800..8374968))
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, transcript
FT                   variant hCT2254136"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254136.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8369740..8370195,8371040..8372792,
FT                   8373935..8374520,8374800..8374985))
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, transcript
FT                   variant hCT2357821"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2357821.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(8369748..8369916,8370029..8370195,
FT                   8371040..8371123,8372641..8372792,8373935..8374454,
FT                   8374800..8374968))
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, transcript
FT                   variant hCT2254139"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254139.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8369748..8369916,8370029..8370195,
FT                   8371040..8372792,8373935..8374454,8374800..8374968))
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, transcript
FT                   variant hCT2254137"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254137.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(8370079..8370195,8371040..8371123,
FT                   8372641..8372792,8373935..8374454))
FT                   /codon_start=1
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254139.0
FT                   protein_id=hCP1855311.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH6"
FT                   /protein_id="EAW95158.1"
FT                   /translation="MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRS
FT                   HSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRY
FT                   YRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSR
FT                   SRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAK
FT                   PELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKK
FT                   SPYGLWIPI"
FT   CDS             complement(join(8370079..8370195,8371040..8371123,
FT                   8372641..8372792,8373935..8374454))
FT                   /codon_start=1
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254136.0
FT                   protein_id=hCP1855310.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH6"
FT                   /protein_id="EAW95159.1"
FT                   /translation="MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRS
FT                   HSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRY
FT                   YRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSR
FT                   SRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAK
FT                   PELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKK
FT                   SPYGLWIPI"
FT   CDS             complement(join(8370079..8370195,8371040..8371123,
FT                   8372641..8372792,8373935..8374454))
FT                   /codon_start=1
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254138.0
FT                   protein_id=hCP1855309.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAH6"
FT                   /protein_id="EAW95161.1"
FT                   /translation="MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRS
FT                   HSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRY
FT                   YRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSR
FT                   SRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAK
FT                   PELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKK
FT                   SPYGLWIPI"
FT   CDS             complement(join(8372584..8372792,8373935..8374454))
FT                   /codon_start=1
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2357821.0
FT                   protein_id=hCP1923043.0 isoform=CRA_a"
FT                   /db_xref="HGNC:HGNC:25234"
FT                   /db_xref="InterPro:IPR029656"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BUV0"
FT                   /protein_id="EAW95157.1"
FT                   /translation="MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRS
FT                   HSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRY
FT                   YRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSR
FT                   SRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAK
FT                   PEVSILGLSEQNFQKANCQI"
FT   CDS             complement(join(8372584..8372792,8373935..8374454))
FT                   /codon_start=1
FT                   /gene="C1orf63"
FT                   /locus_tag="hCG_1981326"
FT                   /product="chromosome 1 open reading frame 63, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1981326.0 transcript_id=hCT2254137.0
FT                   protein_id=hCP1855313.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAI0"
FT                   /protein_id="EAW95160.1"
FT                   /translation="MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRS
FT                   HSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRY
FT                   YRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSR
FT                   SRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAK
FT                   PEVSILGLSEQNFQKANCQI"
FT   gene            8427206..8462227
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /note="gene_id=hCG1738461.2"
FT   mRNA            join(8427206..8427362,8427789..8427955,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8461766,8461803..8461872)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT2253324"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253324.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(8427227..8427362,8427789..8427955,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8461056)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_d"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253324.0
FT                   protein_id=hCP1855347.0 isoform=CRA_d"
FT                   /protein_id="EAW95165.1"
FT                   /translation="MNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAML
FT                   GALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYV
FT                   HSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPGCCNRVLGIPHSSIMG
FT                   YNFSLLGLLGEIIYIVLLVLDTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLL
FT                   NLKIWKAPHVAKYFDDQVFWKFPHLAVGF"
FT   mRNA            join(8431290..8431609,8432688..8432854,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8462227)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT1776527"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT1776527.2;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(8431290..8431609,8432688..8432854,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8461766,8461803..8461872)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT2253322"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253322.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(8431290..8431609,8432688..8432854,8434490..8434627,
FT                   8448153..8448232,8453041..8453114,8461030..8461766,
FT                   8461803..8461872)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT2253321"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253321.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(8431290..8431609,8432688..8432854,8448153..8448232,
FT                   8453041..8453114,8461030..8461766,8461803..8461872)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT2253319"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253319.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(8431290..8431609,8453041..8453114,8461030..8461766,
FT                   8461803..8461872)
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, transcript variant
FT                   hCT2253325"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253325.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(8431474..8431609,8432688..8432854,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8461056)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_b"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253322.0
FT                   protein_id=hCP1855349.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE0"
FT                   /protein_id="EAW95163.1"
FT                   /translation="MNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAML
FT                   GALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYV
FT                   HSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPGCCNRVLGIPHSSIMG
FT                   YNFSLLGLLGEIIYIVLLVLDTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLL
FT                   NLKIWKAPHVAKYFDDQVFWKFPHLAVGF"
FT   CDS             join(8431474..8431609,8432688..8432854,8434490..8434627,
FT                   8437757..8437890,8448153..8448232,8453041..8453114,
FT                   8461030..8461056)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_b"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT1776527.2
FT                   protein_id=hCP1713462.2 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RAE0"
FT                   /protein_id="EAW95166.1"
FT                   /translation="MNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAML
FT                   GALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYV
FT                   HSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPGCCNRVLGIPHSSIMG
FT                   YNFSLLGLLGEIIYIVLLVLDTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLL
FT                   NLKIWKAPHVAKYFDDQVFWKFPHLAVGF"
FT   CDS             join(8431474..8431609,8453041..8453114,8461030..8461056)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_c"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253325.0
FT                   protein_id=hCP1855348.0 isoform=CRA_c"
FT                   /protein_id="EAW95164.1"
FT                   /translation="MNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAML
FT                   GLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF"
FT   CDS             join(8431474..8431609,8432688..8432854,8434490..8434627,
FT                   8448153..8448232,8453041..8453086)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_a"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253321.0
FT                   protein_id=hCP1855351.0 isoform=CRA_a"
FT                   /protein_id="EAW95162.1"
FT                   /translation="MNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAML
FT                   GALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYV
FT                   HSAVLAGGVAVGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPDWLPGPPQHWGTQLGH
FT                   RDSSHVWSPDRFAPKSQNMESTSCG"
FT   CDS             join(8431474..8431609,8432688..8432854,8448153..8448232,
FT                   8453041..8453086)
FT                   /codon_start=1
FT                   /gene="RHCE"
FT                   /locus_tag="hCG_1738461"
FT                   /product="Rh blood group, CcEe antigens, isoform CRA_e"
FT                   /note="gene_id=hCG1738461.2 transcript_id=hCT2253319.0
FT                   protein_id=hCP1855350.0 isoform=CRA_e"
FT                   /protein_id="EAW95167.1"
FT                   /translation="MNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAML
FT                   GALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMDWL
FT                   PGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG"
FT   gene            complement(8460553..8491784)
FT                   /gene="TMEM50A"
FT                   /locus_tag="hCG_23247"
FT                   /note="gene_id=hCG23247.3"
FT   mRNA            complement(join(8460553..8462923,8470610..8470702,
FT                   8471891..8471958,8480511..8480623,8483006..8483111,
FT                   8485129..8485516,8491260..8491407,8491709..8491784))
FT                   /gene="TMEM50A"
FT                   /locus_tag="hCG_23247"
FT                   /product="transmembrane protein 50A, transcript variant
FT                   hCT1955746"
FT                   /note="gene_id=hCG23247.3 transcript_id=hCT1955746.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8460553..8462923,8466731..8466791,
FT                   8470610..8470702,8471891..8471958,8480511..8480623,
FT                   8483006..8483111,8485129..8485516,8491260..8491407,
FT                   8491709..8491784))
FT                   /gene="TMEM50A"
FT                   /locus_tag="hCG_23247"
FT                   /product="transmembrane protein 50A, transcript variant
FT                   hCT2254135"
FT                   /note="gene_id=hCG23247.3 transcript_id=hCT2254135.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/8;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(8462868..8462923,8470610..8470702,
FT                   8471891..8471958,8480511..8480623,8483006..8483098))
FT                   /codon_start=1
FT                   /gene="TMEM50A"
FT                   /locus_tag="hCG_23247"
FT                   /product="transmembrane protein 50A, isoform CRA_b"
FT                   /note="gene_id=hCG23247.3 transcript_id=hCT1955746.1
FT                   protein_id=hCP1765693.0 isoform=CRA_b"
FT                   /protein_id="EAW95169.1"
FT                   /translation="MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVI
FT                   YPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLA
FT                   FGSLIASMWILFGGYVAKEGWFLSLAALKTYGSEHI"
FT   CDS             complement(join(8462878..8462923,8466731..8466791,
FT                   8470610..8470702,8471891..8471958,8480511..8480623,
FT                   8483006..8483098))
FT                   /codon_start=1
FT                   /gene="TMEM50A"
FT                   /locus_tag="hCG_23247"
FT                   /product="transmembrane protein 50A, isoform CRA_a"
FT                   /note="gene_id=hCG23247.3 transcript_id=hCT2254135.0
FT                   protein_id=hCP1855321.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q7RU07"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7RU07"
FT                   /protein_id="EAW95168.1"
FT                   /translation="MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVI
FT                   YPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLA
FT                   FGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ"
FT   gene            complement(8493138..8494693)
FT                   /locus_tag="hCG_1981324"
FT                   /note="gene_id=hCG1981324.0"
FT   mRNA            complement(join(8493138..8494452,8494552..8494693))
FT                   /locus_tag="hCG_1981324"
FT                   /product="hCG1981324"
FT                   /note="gene_id=hCG1981324.0 transcript_id=hCT2254132.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(8494025..8494153)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1981324"
FT                   /product="hCG1981324"
FT                   /note="gene_id=hCG1981324.0 transcript_id=hCT2254132.0
FT                   protein_id=hCP1855319.0"
FT                   /protein_id="EAW95170.1"
FT                   /translation="MGFHHVGQADLKLLTSSDLPASASQSAGTTGLSHCAQPCLLF"
FT   assembly_gap    17481..17921
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    25169..25188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    35751..35770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    38801..41625
FT                   /estimated_length=2825
FT                   /gap_type="unknown"
FT   assembly_gap    53969..54304
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    57288..57545
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    671716..671806
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    817500..818736
FT                   /estimated_length=1237
FT                   /gap_type="unknown"
FT   assembly_gap    1103243..1103262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1182672..1183211
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    1920687..1920728
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1927047..1927066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1933935..1956556
FT                   /estimated_length=22622
FT                   /gap_type="unknown"
FT   assembly_gap    1985792..1989084
FT                   /estimated_length=3293
FT                   /gap_type="unknown"
FT   assembly_gap    2845941..2847046
FT                   /estimated_length=1106
FT                   /gap_type="unknown"
FT   assembly_gap    2859142..2859244
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    2862020..2862103
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    3062036..3062719
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   assembly_gap    3124919..3134921
FT                   /estimated_length=10003
FT                   /gap_type="unknown"
FT   assembly_gap    3508601..3508620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589916..3590271
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    3779536..3779876
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    4117142..4117161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4210492..4210954
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    4275197..4275289
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    4292712..4292735
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    4296627..4296646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4492634..4492653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4534604..4537081
FT                   /estimated_length=2478
FT                   /gap_type="unknown"
FT   assembly_gap    4550195..4556784
FT                   /estimated_length=6590
FT                   /gap_type="unknown"
FT   assembly_gap    4605415..4610831
FT                   /estimated_length=5417
FT                   /gap_type="unknown"
FT   assembly_gap    4634290..4634882
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    4814215..4814234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4922283..4922365
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    5062852..5063460
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    5119065..5119746
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   assembly_gap    5461840..5462484
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    5556207..5556226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5559965..5559984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5582048..5582121
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    5806362..5806381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5882092..5883361
FT                   /estimated_length=1270
FT                   /gap_type="unknown"
FT   assembly_gap    6382673..6383071
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    6405986..6406082
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    6968229..6968248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6971721..6971892
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    6984740..6985471
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    7143480..7143773
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    7338476..7342417
FT                   /estimated_length=3942
FT                   /gap_type="unknown"
FT   assembly_gap    7917480..7917499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7929840..7930726
FT                   /estimated_length=887
FT                   /gap_type="unknown"
FT   assembly_gap    7934291..7934456
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    7954498..7954923
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    7965849..7965921
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    7968995..7969014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7970763..7970782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7973377..7973495
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    7976764..7977177
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    8195923..8195942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8221406..8225663
FT                   /estimated_length=4258
FT                   /gap_type="unknown"
FT   assembly_gap    8398447..8401536
FT                   /estimated_length=3090
FT                   /gap_type="unknown"
FT   assembly_gap    8405212..8424496
FT                   /estimated_length=19285
FT                   /gap_type="unknown"
FT   assembly_gap    8428299..8428318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(AADB02000205.1:1..17480,gap(441),AADB02000206.1:1..7247,gap(20),
CO   AADB02000207.1:1..10562,gap(20),AADB02000208.1:1..3030,gap(2825),
CO   AADB02000209.1:1..12343,gap(336),AADB02000210.1:1..2983,gap(258),
CO   AADB02000211.1:1..614170,gap(91),complement(AADB02000212.1:1..145693),
CO   gap(1237),AADB02000213.1:1..284506,gap(20),
CO   complement(AADB02000214.1:1..79409),gap(540),AADB02000215.1:1..737475,
CO   gap(42),complement(AADB02000216.1:1..6318),gap(20),
CO   complement(AADB02000217.1:1..6868),gap(22622),AADB02000218.1:1..29235,
CO   gap(3293),AADB02000219.1:1..856856,gap(1106),AADB02000220.1:1..12095,
CO   gap(103),complement(AADB02000221.1:1..2775),gap(84),
CO   complement(AADB02000222.1:1..199932),gap(684),AADB02000223.1:1..62199,
CO   gap(10003),AADB02000224.1:1..373679,gap(20),
CO   complement(AADB02000225.1:1..81295),gap(356),AADB02000226.1:1..189264,
CO   gap(341),AADB02000227.1:1..337265,gap(20),AADB02000228.1:1..93330,gap(463),
CO   AADB02000229.1:1..64242,gap(93),complement(AADB02000230.1:1..17422),
CO   gap(24),complement(AADB02000231.1:1..3891),gap(20),
CO   AADB02000232.1:1..195987,gap(20),AADB02000233.1:1..41950,gap(2478),
CO   AADB02000234.1:1..13113,gap(6590),AADB02000235.1:1..48630,gap(5417),
CO   AADB02000236.1:1..23458,gap(593),AADB02000237.1:1..179332,gap(20),
CO   AADB02000238.1:1..108048,gap(83),AADB02000239.1:1..140486,gap(609),
CO   AADB02000240.1:1..55604,gap(682),AADB02000241.1:1..342093,gap(645),
CO   AADB02000242.1:1..93722,gap(20),complement(AADB02000243.1:1..3738),gap(20),
CO   AADB02000244.1:1..22063,gap(74),AADB02000245.1:1..224240,gap(20),
CO   complement(AADB02000246.1:1..75710),gap(1270),AADB02000247.1:1..499311,
CO   gap(399),AADB02000248.1:1..22914,gap(97),AADB02000249.1:1..562146,gap(20),
CO   complement(AADB02000250.1:1..3472),gap(172),AADB02000251.1:1..12847,
CO   gap(732),AADB02000252.1:1..158008,gap(294),AADB02000253.1:1..194702,
CO   gap(3942),AADB02000254.1:1..575062,gap(20),AADB02000255.1:1..12340,
CO   gap(887),AADB02000256.1:1..3564,gap(166),AADB02000257.1:1..20041,gap(426),
CO   AADB02000258.1:1..10925,gap(73),AADB02000259.1:1..3073,gap(20),
CO   AADB02000260.1:1..1748,gap(20),AADB02000261.1:1..2594,gap(119),
CO   AADB02000262.1:1..3268,gap(414),AADB02000263.1:1..218745,gap(20),
CO   AADB02000264.1:1..25463,gap(4258),AADB02000265.1:1..172783,gap(3090),
CO   AADB02000266.1:1..3675,gap(19285),complement(AADB02000267.1:1..3802),
CO   gap(20),AADB02000268.1:1..66842)
//


spacer
spacer