
ID   CH471082; SV 1; linear; genomic DNA; CON; HUM; 30328800 BP.
AC   CH471082; AADB02000000;
PR   Project:PRJNA1431;
DT   30-JUL-2005 (Rel. 84, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
DE   Homo sapiens 211000035835546 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
RN   [1]
RP   1-30328800
RX   DOI; 10.1126/science.1058040.
RX   PUBMED; 11181995.
RA   Venter J.C., Adams M.D., Myers E.W., Li P.W., Mural R.J., Sutton G.G.,
RA   Smith H.O., Yandell M., Evans C.A., Holt R.A., Gocayne J.D., Amanatides P.,
RA   Ballew R.M., Huson D.H., Wortman J.R., Zhang Q., Kodira C.D., Zheng X.H.,
RA   Chen L., Skupski M., Subramanian G., Thomas P.D., Zhang J.,
RA   Gabor Miklos G.L., Nelson C., Broder S., Clark A.G., Nadeau J.,
RA   McKusick V.A., Zinder N., Levine A.J., Roberts R.J., Simon M., Slayman C.,
RA   Hunkapiller M., Bolanos R., Delcher A., Dew I., Fasulo D., Flanigan M.,
RA   Florea L., Halpern A., Hannenhalli S., Kravitz S., Levy S., Mobarry C.,
RA   Reinert K., Remington K., Abu-Threideh J., Beasley E., Biddick K.,
RA   Bonazzi V., Brandon R., Cargill M., Chandramouliswaran I., Charlab R.,
RA   Chaturvedi K., Deng Z., Di Francesco V., Dunn P., Eilbeck K.,
RA   Evangelista C., Gabrielian A.E., Gan W., Ge W., Gong F., Gu Z., Guan P.,
RA   Heiman T.J., Higgins M.E., Ji R.R., Ke Z., Ketchum K.A., Lai Z., Lei Y.,
RA   Li Z., Li J., Liang Y., Lin X., Lu F., Merkulov G.V., Milshina N.,
RA   Moore H.M., Naik A.K., Narayan V.A., Neelam B., Nusskern D., Rusch D.B.,
RA   Salzberg S., Shao W., Shue B., Sun J., Wang Z., Wang A., Wang X., Wang J.,
RA   Wei M., Wides R., Xiao C., Yan C., Yao A., Ye J., Zhan M., Zhang W.,
RA   Zhang H., Zhao Q., Zheng L., Zhong F., Zhong W., Zhu S., Zhao S.,
RA   Gilbert D., Baumhueter S., Spier G., Carter C., Cravchik A., Woodage T.,
RA   Ali F., An H., Awe A., Baldwin D., Baden H., Barnstead M., Barrow I.,
RA   Beeson K., Busam D., Carver A., Center A., Cheng M.L., Curry L.,
RA   Danaher S., Davenport L., Desilets R., Dietz S., Dodson K., Doup L.,
RA   Ferriera S., Garg N., Gluecksmann A., Hart B., Haynes J., Haynes C.,
RA   Heiner C., Hladun S., Hostin D., Houck J., Howland T., Ibegwam C.,
RA   Johnson J., Kalush F., Kline L., Koduru S., Love A., Mann F., May D.,
RA   McCawley S., McIntosh T., McMullen I., Moy M., Moy L., Murphy B.,
RA   Nelson K., Pfannkoch C., Pratts E., Puri V., Qureshi H., Reardon M.,
RA   Rodriguez R., Rogers Y.H., Romblad D., Ruhfel B., Scott R., Sitter C.,
RA   Smallwood M., Stewart E., Strong R., Suh E., Thomas R., Tint N.N., Tse S.,
RA   Vech C., Wang G., Wetter J., Williams S., Williams M., Windsor S.,
RA   Winn-Deen E., Wolfe K., Zaveri J., Zaveri K., Abril J.F., Guigo R.,
RA   Campbell M.J., Sjolander K.V., Karlak B., Kejariwal A., Mi H., Lazareva B.,
RA   Hatton T., Narechania A., Diemer K., Muruganujan A., Guo N., Sato S.,
RA   Bafna V., Istrail S., Lippert R., Schwartz R., Walenz B., Yooseph S.,
RA   Allen D., Basu A., Baxendale J., Blick L., Caminha M., Carnes-Stine J.,
RA   Caulk P., Chiang Y.H., Coyne M., Dahlke C., Mays A., Dombroski M.,
RA   Donnelly M., Ely D., Esparham S., Fosler C., Gire H., Glanowski S.,
RA   Glasser K., Glodek A., Gorokhov M., Graham K., Gropman B., Harris M.,
RA   Heil J., Henderson S., Hoover J., Jennings D., Jordan C., Jordan J.,
RA   Kasha J., Kagan L., Kraft C., Levitsky A., Lewis M., Liu X., Lopez J.,
RA   Ma D., Majoros W., McDaniel J., Murphy S., Newman M., Nguyen T., Nguyen N.,
RA   Nodell M., Pan S., Peck J., Peterson M., Rowe W., Sanders R., Scott J.,
RA   Simpson M., Smith T., Sprague A., Stockwell T., Turner R., Venter E.,
RA   Wang M., Wen M., Wu D., Wu M., Xia A., Zandieh A., Zhu X.;
RT   "The sequence of the human genome";
RL   Science, e1252229 291(5507):1304-1351(2001).
RN   [2]
RP   1-30328800
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 514680e6c5ccae3a24f6a988e8fe6239.
DR   ENA; AADB02000000; SET.
DR   ENA; AADB00000000; SET.
DR   ENA-CON; CM000266.
DR   BioSample; SAMN02981219.
DR   Ensembl-Gn; ENSG00000028528; homo_sapiens.
DR   Ensembl-Gn; ENSG00000035664; homo_sapiens.
DR   Ensembl-Gn; ENSG00000047346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000066933; homo_sapiens.
DR   Ensembl-Gn; ENSG00000067221; homo_sapiens.
DR   Ensembl-Gn; ENSG00000067225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000069667; homo_sapiens.
DR   Ensembl-Gn; ENSG00000069869; homo_sapiens.
DR   Ensembl-Gn; ENSG00000069966; homo_sapiens.
DR   Ensembl-Gn; ENSG00000069974; homo_sapiens.
DR   Ensembl-Gn; ENSG00000074410; homo_sapiens.
DR   Ensembl-Gn; ENSG00000074603; homo_sapiens.
DR   Ensembl-Gn; ENSG00000075131; homo_sapiens.
DR   Ensembl-Gn; ENSG00000081014; homo_sapiens.
DR   Ensembl-Gn; ENSG00000090470; homo_sapiens.
DR   Ensembl-Gn; ENSG00000090487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000092439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000103599; homo_sapiens.
DR   Ensembl-Gn; ENSG00000103657; homo_sapiens.
DR   Ensembl-Gn; ENSG00000103671; homo_sapiens.
DR   Ensembl-Gn; ENSG00000103710; homo_sapiens.
DR   Ensembl-Gn; ENSG00000103769; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104064; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104093; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104112; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104131; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104154; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104164; homo_sapiens.
DR   Ensembl-Gn; ENSG00000104177; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128872; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128886; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128915; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128923; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128951; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128973; homo_sapiens.
DR   Ensembl-Gn; ENSG00000128989; homo_sapiens.
DR   Ensembl-Gn; ENSG00000129007; homo_sapiens.
DR   Ensembl-Gn; ENSG00000129028; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137764; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137766; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137767; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137770; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137817; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137818; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137819; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137821; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137831; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137845; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137869; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137876; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137878; homo_sapiens.
DR   Ensembl-Gn; ENSG00000138592; homo_sapiens.
DR   Ensembl-Gn; ENSG00000138593; homo_sapiens.
DR   Ensembl-Gn; ENSG00000138600; homo_sapiens.
DR   Ensembl-Gn; ENSG00000138613; homo_sapiens.
DR   Ensembl-Gn; ENSG00000138617; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140259; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140262; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140274; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140284; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140285; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140297; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140307; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140350; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140416; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140455; homo_sapiens.
DR   Ensembl-Gn; ENSG00000140463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000151575; homo_sapiens.
DR   Ensembl-Gn; ENSG00000156642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157456; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157483; homo_sapiens.
DR   Ensembl-Gn; ENSG00000157734; homo_sapiens.
DR   Ensembl-Gn; ENSG00000159322; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166233; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166710; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166734; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166794; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166797; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166803; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166839; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166855; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166920; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166938; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166949; homo_sapiens.
DR   Ensembl-Gn; ENSG00000167004; homo_sapiens.
DR   Ensembl-Gn; ENSG00000169018; homo_sapiens.
DR   Ensembl-Gn; ENSG00000169032; homo_sapiens.
DR   Ensembl-Gn; ENSG00000169118; homo_sapiens.
DR   Ensembl-Gn; ENSG00000169856; homo_sapiens.
DR   Ensembl-Gn; ENSG00000171877; homo_sapiens.
DR   Ensembl-Gn; ENSG00000171956; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174442; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174444; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174446; homo_sapiens.
DR   Ensembl-Gn; ENSG00000175202; homo_sapiens.
DR   Ensembl-Gn; ENSG00000175318; homo_sapiens.
DR   Ensembl-Gn; ENSG00000182718; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183324; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183578; homo_sapiens.
DR   Ensembl-Gn; ENSG00000184716; homo_sapiens.
DR   Ensembl-Gn; ENSG00000185088; homo_sapiens.
DR   Ensembl-Gn; ENSG00000186198; homo_sapiens.
DR   Ensembl-Gn; ENSG00000189227; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225362; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229474; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234438; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241839; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242028; homo_sapiens.
DR   Ensembl-Gn; ENSG00000255302; homo_sapiens.
DR   Ensembl-Gn; ENSG00000255346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000255529; homo_sapiens.
DR   Ensembl-Gn; ENSG00000260916; homo_sapiens.
DR   Ensembl-Gn; ENSG00000261652; homo_sapiens.
DR   Ensembl-Gn; ENSG00000263155; homo_sapiens.
DR   Ensembl-Gn; ENSG00000273686; homo_sapiens.
DR   Ensembl-Gn; ENSG00000278570; homo_sapiens.
DR   Ensembl-Tr; ENST00000178640; homo_sapiens.
DR   Ensembl-Tr; ENST00000204549; homo_sapiens.
DR   Ensembl-Tr; ENST00000204566; homo_sapiens.
DR   Ensembl-Tr; ENST00000220062; homo_sapiens.
DR   Ensembl-Tr; ENST00000220429; homo_sapiens.
DR   Ensembl-Tr; ENST00000220478; homo_sapiens.
DR   Ensembl-Tr; ENST00000249806; homo_sapiens.
DR   Ensembl-Tr; ENST00000249822; homo_sapiens.
DR   Ensembl-Tr; ENST00000249861; homo_sapiens.
DR   Ensembl-Tr; ENST00000251076; homo_sapiens.
DR   Ensembl-Tr; ENST00000260324; homo_sapiens.
DR   Ensembl-Tr; ENST00000260327; homo_sapiens.
DR   Ensembl-Tr; ENST00000260364; homo_sapiens.
DR   Ensembl-Tr; ENST00000260379; homo_sapiens.
DR   Ensembl-Tr; ENST00000260382; homo_sapiens.
DR   Ensembl-Tr; ENST00000260408; homo_sapiens.
DR   Ensembl-Tr; ENST00000260443; homo_sapiens.
DR   Ensembl-Tr; ENST00000261520; homo_sapiens.
DR   Ensembl-Tr; ENST00000261523; homo_sapiens.
DR   Ensembl-Tr; ENST00000261837; homo_sapiens.
DR   Ensembl-Tr; ENST00000261842; homo_sapiens.
DR   Ensembl-Tr; ENST00000261844; homo_sapiens.
DR   Ensembl-Tr; ENST00000261854; homo_sapiens.
DR   Ensembl-Tr; ENST00000261867; homo_sapiens.
DR   Ensembl-Tr; ENST00000261868; homo_sapiens.
DR   Ensembl-Tr; ENST00000261879; homo_sapiens.
DR   Ensembl-Tr; ENST00000261881; homo_sapiens.
DR   Ensembl-Tr; ENST00000261884; homo_sapiens.
DR   Ensembl-Tr; ENST00000261889; homo_sapiens.
DR   Ensembl-Tr; ENST00000261890; homo_sapiens.
DR   Ensembl-Tr; ENST00000261891; homo_sapiens.
DR   Ensembl-Tr; ENST00000267803; homo_sapiens.
DR   Ensembl-Tr; ENST00000267811; homo_sapiens.
DR   Ensembl-Tr; ENST00000267812; homo_sapiens.
DR   Ensembl-Tr; ENST00000267836; homo_sapiens.
DR   Ensembl-Tr; ENST00000267842; homo_sapiens.
DR   Ensembl-Tr; ENST00000267843; homo_sapiens.
DR   Ensembl-Tr; ENST00000267853; homo_sapiens.
DR   Ensembl-Tr; ENST00000267996; homo_sapiens.
DR   Ensembl-Tr; ENST00000268057; homo_sapiens.
DR   Ensembl-Tr; ENST00000281282; homo_sapiens.
DR   Ensembl-Tr; ENST00000287196; homo_sapiens.
DR   Ensembl-Tr; ENST00000288207; homo_sapiens.
DR   Ensembl-Tr; ENST00000288235; homo_sapiens.
DR   Ensembl-Tr; ENST00000288398; homo_sapiens.
DR   Ensembl-Tr; ENST00000299638; homo_sapiens.
DR   Ensembl-Tr; ENST00000300026; homo_sapiens.
DR   Ensembl-Tr; ENST00000300030; homo_sapiens.
DR   Ensembl-Tr; ENST00000300035; homo_sapiens.
DR   Ensembl-Tr; ENST00000300107; homo_sapiens.
DR   Ensembl-Tr; ENST00000300289; homo_sapiens.
DR   Ensembl-Tr; ENST00000303052; homo_sapiens.
DR   Ensembl-Tr; ENST00000305901; homo_sapiens.
DR   Ensembl-Tr; ENST00000306917; homo_sapiens.
DR   Ensembl-Tr; ENST00000307102; homo_sapiens.
DR   Ensembl-Tr; ENST00000307179; homo_sapiens.
DR   Ensembl-Tr; ENST00000307897; homo_sapiens.
DR   Ensembl-Tr; ENST00000307961; homo_sapiens.
DR   Ensembl-Tr; ENST00000307979; homo_sapiens.
DR   Ensembl-Tr; ENST00000309157; homo_sapiens.
DR   Ensembl-Tr; ENST00000309731; homo_sapiens.
DR   Ensembl-Tr; ENST00000310958; homo_sapiens.
DR   Ensembl-Tr; ENST00000311755; homo_sapiens.
DR   Ensembl-Tr; ENST00000313478; homo_sapiens.
DR   Ensembl-Tr; ENST00000316634; homo_sapiens.
DR   Ensembl-Tr; ENST00000316848; homo_sapiens.
DR   Ensembl-Tr; ENST00000316900; homo_sapiens.
DR   Ensembl-Tr; ENST00000316911; homo_sapiens.
DR   Ensembl-Tr; ENST00000319194; homo_sapiens.
DR   Ensembl-Tr; ENST00000319212; homo_sapiens.
DR   Ensembl-Tr; ENST00000319327; homo_sapiens.
DR   Ensembl-Tr; ENST00000319359; homo_sapiens.
DR   Ensembl-Tr; ENST00000319622; homo_sapiens.
DR   Ensembl-Tr; ENST00000322954; homo_sapiens.
DR   Ensembl-Tr; ENST00000323030; homo_sapiens.
DR   Ensembl-Tr; ENST00000323544; homo_sapiens.
DR   Ensembl-Tr; ENST00000324324; homo_sapiens.
DR   Ensembl-Tr; ENST00000325881; homo_sapiens.
DR   Ensembl-Tr; ENST00000327367; homo_sapiens.
DR   Ensembl-Tr; ENST00000327536; homo_sapiens.
DR   Ensembl-Tr; ENST00000331200; homo_sapiens.
DR   Ensembl-Tr; ENST00000333725; homo_sapiens.
DR   Ensembl-Tr; ENST00000334287; homo_sapiens.
DR   Ensembl-Tr; ENST00000334895; homo_sapiens.
DR   Ensembl-Tr; ENST00000335181; homo_sapiens.
DR   Ensembl-Tr; ENST00000335670; homo_sapiens.
DR   Ensembl-Tr; ENST00000335894; homo_sapiens.
DR   Ensembl-Tr; ENST00000336787; homo_sapiens.
DR   Ensembl-Tr; ENST00000338963; homo_sapiens.
DR   Ensembl-Tr; ENST00000340965; homo_sapiens.
DR   Ensembl-Tr; ENST00000341861; homo_sapiens.
DR   Ensembl-Tr; ENST00000342683; homo_sapiens.
DR   Ensembl-Tr; ENST00000343827; homo_sapiens.
DR   Ensembl-Tr; ENST00000344300; homo_sapiens.
DR   Ensembl-Tr; ENST00000345330; homo_sapiens.
DR   Ensembl-Tr; ENST00000348370; homo_sapiens.
DR   Ensembl-Tr; ENST00000351217; homo_sapiens.
DR   Ensembl-Tr; ENST00000352903; homo_sapiens.
DR   Ensembl-Tr; ENST00000356056; homo_sapiens.
DR   Ensembl-Tr; ENST00000357790; homo_sapiens.
DR   Ensembl-Tr; ENST00000357980; homo_sapiens.
DR   Ensembl-Tr; ENST00000358278; homo_sapiens.
DR   Ensembl-Tr; ENST00000358767; homo_sapiens.
DR   Ensembl-Tr; ENST00000358784; homo_sapiens.
DR   Ensembl-Tr; ENST00000359031; homo_sapiens.
DR   Ensembl-Tr; ENST00000359750; homo_sapiens.
DR   Ensembl-Tr; ENST00000379887; homo_sapiens.
DR   Ensembl-Tr; ENST00000379983; homo_sapiens.
DR   Ensembl-Tr; ENST00000380258; homo_sapiens.
DR   Ensembl-Tr; ENST00000380290; homo_sapiens.
DR   Ensembl-Tr; ENST00000380324; homo_sapiens.
DR   Ensembl-Tr; ENST00000380343; homo_sapiens.
DR   Ensembl-Tr; ENST00000380557; homo_sapiens.
DR   Ensembl-Tr; ENST00000380565; homo_sapiens.
DR   Ensembl-Tr; ENST00000380877; homo_sapiens.
DR   Ensembl-Tr; ENST00000380902; homo_sapiens.
DR   Ensembl-Tr; ENST00000388866; homo_sapiens.
DR   Ensembl-Tr; ENST00000395407; homo_sapiens.
DR   Ensembl-Tr; ENST00000395465; homo_sapiens.
DR   Ensembl-Tr; ENST00000395476; homo_sapiens.
DR   Ensembl-Tr; ENST00000395589; homo_sapiens.
DR   Ensembl-Tr; ENST00000396024; homo_sapiens.
DR   Ensembl-Tr; ENST00000396057; homo_sapiens.
DR   Ensembl-Tr; ENST00000396060; homo_sapiens.
DR   Ensembl-Tr; ENST00000396061; homo_sapiens.
DR   Ensembl-Tr; ENST00000396063; homo_sapiens.
DR   Ensembl-Tr; ENST00000396065; homo_sapiens.
DR   Ensembl-Tr; ENST00000396307; homo_sapiens.
DR   Ensembl-Tr; ENST00000396402; homo_sapiens.
DR   Ensembl-Tr; ENST00000396404; homo_sapiens.
DR   Ensembl-Tr; ENST00000396444; homo_sapiens.
DR   Ensembl-Tr; ENST00000396464; homo_sapiens.
DR   Ensembl-Tr; ENST00000396650; homo_sapiens.
DR   Ensembl-Tr; ENST00000403994; homo_sapiens.
DR   Ensembl-Tr; ENST00000404484; homo_sapiens.
DR   Ensembl-Tr; ENST00000406925; homo_sapiens.
DR   Ensembl-Tr; ENST00000411926; homo_sapiens.
DR   Ensembl-Tr; ENST00000416889; homo_sapiens.
DR   Ensembl-Tr; ENST00000421017; homo_sapiens.
DR   Ensembl-Tr; ENST00000421977; homo_sapiens.
DR   Ensembl-Tr; ENST00000422263; homo_sapiens.
DR   Ensembl-Tr; ENST00000424560; homo_sapiens.
DR   Ensembl-Tr; ENST00000425574; homo_sapiens.
DR   Ensembl-Tr; ENST00000429662; homo_sapiens.
DR   Ensembl-Tr; ENST00000432196; homo_sapiens.
DR   Ensembl-Tr; ENST00000433215; homo_sapiens.
DR   Ensembl-Tr; ENST00000434605; homo_sapiens.
DR   Ensembl-Tr; ENST00000435532; homo_sapiens.
DR   Ensembl-Tr; ENST00000438423; homo_sapiens.
DR   Ensembl-Tr; ENST00000439724; homo_sapiens.
DR   Ensembl-Tr; ENST00000442196; homo_sapiens.
DR   Ensembl-Tr; ENST00000442995; homo_sapiens.
DR   Ensembl-Tr; ENST00000443425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443617; homo_sapiens.
DR   Ensembl-Tr; ENST00000444347; homo_sapiens.
DR   Ensembl-Tr; ENST00000444904; homo_sapiens.
DR   Ensembl-Tr; ENST00000446801; homo_sapiens.
DR   Ensembl-Tr; ENST00000448060; homo_sapiens.
DR   Ensembl-Tr; ENST00000448182; homo_sapiens.
DR   Ensembl-Tr; ENST00000449901; homo_sapiens.
DR   Ensembl-Tr; ENST00000450403; homo_sapiens.
DR   Ensembl-Tr; ENST00000451270; homo_sapiens.
DR   Ensembl-Tr; ENST00000455271; homo_sapiens.
DR   Ensembl-Tr; ENST00000455873; homo_sapiens.
DR   Ensembl-Tr; ENST00000455976; homo_sapiens.
DR   Ensembl-Tr; ENST00000457488; homo_sapiens.
DR   Ensembl-Tr; ENST00000465139; homo_sapiens.
DR   Ensembl-Tr; ENST00000467889; homo_sapiens.
DR   Ensembl-Tr; ENST00000482852; homo_sapiens.
DR   Ensembl-Tr; ENST00000484674; homo_sapiens.
DR   Ensembl-Tr; ENST00000488175; homo_sapiens.
DR   Ensembl-Tr; ENST00000491993; homo_sapiens.
DR   Ensembl-Tr; ENST00000496660; homo_sapiens.
DR   Ensembl-Tr; ENST00000506154; homo_sapiens.
DR   Ensembl-Tr; ENST00000508342; homo_sapiens.
DR   Ensembl-Tr; ENST00000512104; homo_sapiens.
DR   Ensembl-Tr; ENST00000530028; homo_sapiens.
DR   Ensembl-Tr; ENST00000530406; homo_sapiens.
DR   Ensembl-Tr; ENST00000534964; homo_sapiens.
DR   Ensembl-Tr; ENST00000535141; homo_sapiens.
DR   Ensembl-Tr; ENST00000537194; homo_sapiens.
DR   Ensembl-Tr; ENST00000537232; homo_sapiens.
DR   Ensembl-Tr; ENST00000537840; homo_sapiens.
DR   Ensembl-Tr; ENST00000538696; homo_sapiens.
DR   Ensembl-Tr; ENST00000539562; homo_sapiens.
DR   Ensembl-Tr; ENST00000539962; homo_sapiens.
DR   Ensembl-Tr; ENST00000540479; homo_sapiens.
DR   Ensembl-Tr; ENST00000540797; homo_sapiens.
DR   Ensembl-Tr; ENST00000540846; homo_sapiens.
DR   Ensembl-Tr; ENST00000541638; homo_sapiens.
DR   Ensembl-Tr; ENST00000542355; homo_sapiens.
DR   Ensembl-Tr; ENST00000544960; homo_sapiens.
DR   Ensembl-Tr; ENST00000544974; homo_sapiens.
DR   Ensembl-Tr; ENST00000546225; homo_sapiens.
DR   Ensembl-Tr; ENST00000546305; homo_sapiens.
DR   Ensembl-Tr; ENST00000557835; homo_sapiens.
DR   Ensembl-Tr; ENST00000557843; homo_sapiens.
DR   Ensembl-Tr; ENST00000557901; homo_sapiens.
DR   Ensembl-Tr; ENST00000557945; homo_sapiens.
DR   Ensembl-Tr; ENST00000557998; homo_sapiens.
DR   Ensembl-Tr; ENST00000558008; homo_sapiens.
DR   Ensembl-Tr; ENST00000558181; homo_sapiens.
DR   Ensembl-Tr; ENST00000558373; homo_sapiens.
DR   Ensembl-Tr; ENST00000558401; homo_sapiens.
DR   Ensembl-Tr; ENST00000558422; homo_sapiens.
DR   Ensembl-Tr; ENST00000558813; homo_sapiens.
DR   Ensembl-Tr; ENST00000558966; homo_sapiens.
DR   Ensembl-Tr; ENST00000558996; homo_sapiens.
DR   Ensembl-Tr; ENST00000559014; homo_sapiens.
DR   Ensembl-Tr; ENST00000559209; homo_sapiens.
DR   Ensembl-Tr; ENST00000559228; homo_sapiens.
DR   Ensembl-Tr; ENST00000559233; homo_sapiens.
DR   Ensembl-Tr; ENST00000559397; homo_sapiens.
DR   Ensembl-Tr; ENST00000559471; homo_sapiens.
DR   Ensembl-Tr; ENST00000559556; homo_sapiens.
DR   Ensembl-Tr; ENST00000559844; homo_sapiens.
DR   Ensembl-Tr; ENST00000559878; homo_sapiens.
DR   Ensembl-Tr; ENST00000559916; homo_sapiens.
DR   Ensembl-Tr; ENST00000559950; homo_sapiens.
DR   Ensembl-Tr; ENST00000560270; homo_sapiens.
DR   Ensembl-Tr; ENST00000560289; homo_sapiens.
DR   Ensembl-Tr; ENST00000560369; homo_sapiens.
DR   Ensembl-Tr; ENST00000560508; homo_sapiens.
DR   Ensembl-Tr; ENST00000560581; homo_sapiens.
DR   Ensembl-Tr; ENST00000560585; homo_sapiens.
DR   Ensembl-Tr; ENST00000560668; homo_sapiens.
DR   Ensembl-Tr; ENST00000560691; homo_sapiens.
DR   Ensembl-Tr; ENST00000560765; homo_sapiens.
DR   Ensembl-Tr; ENST00000560780; homo_sapiens.
DR   Ensembl-Tr; ENST00000560825; homo_sapiens.
DR   Ensembl-Tr; ENST00000560955; homo_sapiens.
DR   Ensembl-Tr; ENST00000561026; homo_sapiens.
DR   Ensembl-Tr; ENST00000561153; homo_sapiens.
DR   Ensembl-Tr; ENST00000561186; homo_sapiens.
DR   Ensembl-Tr; ENST00000561292; homo_sapiens.
DR   Ensembl-Tr; ENST00000561349; homo_sapiens.
DR   Ensembl-Tr; ENST00000561424; homo_sapiens.
DR   Ensembl-Tr; ENST00000561650; homo_sapiens.
DR   Ensembl-Tr; ENST00000562411; homo_sapiens.
DR   Ensembl-Tr; ENST00000562924; homo_sapiens.
DR   Ensembl-Tr; ENST00000563277; homo_sapiens.
DR   Ensembl-Tr; ENST00000563480; homo_sapiens.
DR   Ensembl-Tr; ENST00000563566; homo_sapiens.
DR   Ensembl-Tr; ENST00000563691; homo_sapiens.
DR   Ensembl-Tr; ENST00000564609; homo_sapiens.
DR   Ensembl-Tr; ENST00000564777; homo_sapiens.
DR   Ensembl-Tr; ENST00000565154; homo_sapiens.
DR   Ensembl-Tr; ENST00000565184; homo_sapiens.
DR   Ensembl-Tr; ENST00000565216; homo_sapiens.
DR   Ensembl-Tr; ENST00000565443; homo_sapiens.
DR   Ensembl-Tr; ENST00000565627; homo_sapiens.
DR   Ensembl-Tr; ENST00000566347; homo_sapiens.
DR   Ensembl-Tr; ENST00000566423; homo_sapiens.
DR   Ensembl-Tr; ENST00000566432; homo_sapiens.
DR   Ensembl-Tr; ENST00000566753; homo_sapiens.
DR   Ensembl-Tr; ENST00000567669; homo_sapiens.
DR   Ensembl-Tr; ENST00000568196; homo_sapiens.
DR   Ensembl-Tr; ENST00000568459; homo_sapiens.
DR   Ensembl-Tr; ENST00000568588; homo_sapiens.
DR   Ensembl-Tr; ENST00000568597; homo_sapiens.
DR   Ensembl-Tr; ENST00000568606; homo_sapiens.
DR   Ensembl-Tr; ENST00000569205; homo_sapiens.
DR   Ensembl-Tr; ENST00000569281; homo_sapiens.
DR   Ensembl-Tr; ENST00000569493; homo_sapiens.
DR   Ensembl-Tr; ENST00000569534; homo_sapiens.
DR   Ensembl-Tr; ENST00000569691; homo_sapiens.
DR   Ensembl-Tr; ENST00000569795; homo_sapiens.
DR   Ensembl-Tr; ENST00000569896; homo_sapiens.
DR   Ensembl-Tr; ENST00000606225; homo_sapiens.
DR   Ensembl-Tr; ENST00000613446; homo_sapiens.
DR   Ensembl-Tr; ENST00000614567; homo_sapiens.
DR   Ensembl-Tr; ENST00000616065; homo_sapiens.
DR   Ensembl-Tr; ENST00000617575; homo_sapiens.
DR   Ensembl-Tr; ENST00000617605; homo_sapiens.
DR   Ensembl-Tr; ENST00000618556; homo_sapiens.
DR   Ensembl-Tr; ENST00000619572; homo_sapiens.
DR   Ensembl-Tr; ENST00000621098; homo_sapiens.
DR   Ensembl-Tr; ENST00000625619; homo_sapiens.
DR   Ensembl-Tr; ENST00000629425; homo_sapiens.
DR   Ensembl-Tr; ENST00000631573; homo_sapiens.
DR   Ensembl-Tr; ENST00000631728; homo_sapiens.
DR   Ensembl-Tr; ENST00000633158; homo_sapiens.
DR   Ensembl-Tr; ENST00000635699; homo_sapiens.
DR   PubMed; 11181995.
DR   PubMed; 14769938.
CC   This is the November 2001 combined whole genome shotgun assembly
CC   applied to the 27 million reads of Celera's whole genome shotgun
CC   data and 16 million  reads of shredded GenBank data from other
CC   human genome projects (Nature 2001. 409:860-921). It relied on
CC   Celera's paired reads and BAC end reads from TIGR for long range
CC   order and orientation. Its scaffolds were mapped to chromosomes
CC   using STS maps. For more detailed information about whole genome
CC   sequencing and Celera's assembly process, please refer to Venter,
CC   J.C. et al. Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was created in
CC   April 2002 from the whole-genome mapping of transcript and protein
CC   sequences on the Celera human genome assembly
CC   (http://www.ncbi.nlm.nih.gov/genome/guide/human/release_notes.html)
CC   by Celera Chromosome Team, Content Systems and Informatics
CC   Research. The data sets used by this annotation process were
CC   collected in 2001 and include RefSeq (NM_) sequences, manually
CC   annotated transcripts from previous Celera assemblies, GenBank mRNA
CC   and dbEST sequences, Celera internal EST and full-insert sequences
CC   of cDNA clones (unpublished), mammalian SwissProt sequences, NRAA
CC   sequences, and International Protein Index (IPI) sequences (all
CC   human unless noted otherwise).  The CDS of each transcript was
CC   computationally defined by either the longest ATG-to-Stop or the
CC   longest open reading frame. All CDSs corresponding to the longest
CC   open reading frames with no starting ATG were flagged as partial.
CC   In addition, some of the genes were manually curated between 2002
CC   and 2005. Coverage analysis of splice junction donor/acceptor pairs
CC   and single-exon transcripts was done by Applied Biosystems in
CC   August 2006, based on Dec 2005 versions of human cDNA (RefSeq,
CC   Genbank mRNA and dbEST, Celera internal EST and full insert
CC   sequences) and human SwissProt sequences.
FH   Key             Location/Qualifiers
FT   source          1..30328800
FT                   /organism="Homo sapiens"
FT                   /chromosome="15"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            complement(6548..26782)
FT                   /locus_tag="hCG_2004190"
FT                   /note="gene_id=hCG2004190.0"
FT   mRNA            complement(join(6548..6689,8143..8307,8660..8869,
FT                   11294..11351,11680..11779,11994..12172,14907..15025,
FT                   15632..15787,16313..16485,23629..23697,23873..24046,
FT                   24500..24648,26625..26782))
FT                   /locus_tag="hCG_2004190"
FT                   /product="hCG2004190, transcript variant hCT2290110"
FT                   /note="gene_id=hCG2004190.0 transcript_id=hCT2290110.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/12;
FT                   created on 07-OCT-2003"
FT   mRNA            complement(join(6548..6689,8143..8307,8660..8875,
FT                   11294..11351,11680..11779,11994..12172,14907..15025,
FT                   15632..15787,16313..16485,23629..23697,23873..24046,
FT                   24500..24645,25526..25740))
FT                   /locus_tag="hCG_2004190"
FT                   /product="hCG2004190, transcript variant hCT2349452"
FT                   /note="gene_id=hCG2004190.0 transcript_id=hCT2349452.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/12;
FT                   created on 07-OCT-2003"
FT   CDS             complement(join(11330..11351,11680..11779,11994..12172,
FT                   14907..15025,15632..15787,16313..16485,23629..23697,
FT                   23873..24023))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2004190"
FT                   /product="hCG2004190, isoform CRA_a"
FT                   /note="gene_id=hCG2004190.0 transcript_id=hCT2290110.0
FT                   protein_id=hCP1878829.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5T3"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028747"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T3"
FT                   /protein_id="EAW77232.1"
FT   CDS             complement(join(11330..11351,11680..11779,11994..12172,
FT                   14907..15025,15632..15787,16313..16485,23629..23697,
FT                   23873..24023))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2004190"
FT                   /product="hCG2004190, isoform CRA_a"
FT                   /note="gene_id=hCG2004190.0 transcript_id=hCT2349452.0
FT                   protein_id=hCP1914702.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5T3"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028747"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T3"
FT                   /protein_id="EAW77233.1"
FT   gene            25871..52100
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /note="gene_id=hCG38001.3"
FT   mRNA            join(25871..26184,33301..33379,36126..36243,40901..41008,
FT                   42554..42683,44927..45043,45364..45489,46205..46387,
FT                   47966..48074,48995..49123,49727..49806,50000..50057,
FT                   50582..52100)
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   transcript variant hCT29238"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT29238.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 26-AUG-2002"
FT   mRNA            join(25894..26095,26171..26184,33301..33379,36126..36243,
FT                   40901..41008,42554..42683,44927..45043,45364..45489,
FT                   46205..46387,47966..48074,48995..49123,49727..49806,
FT                   50000..50057,50582..51014)
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   transcript variant hCT2355689"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT2355689.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   mRNA            join(25931..26184,31061..31235,33301..33379,36126..36243,
FT                   40901..41008,42554..42683,44927..45043,45364..45489,
FT                   46205..46387,47966..48074,48995..49123,49727..49806,
FT                   50000..50057,50582..51014)
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   transcript variant hCT2355690"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT2355690.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   CDS             join(26018..26184,33301..33379,36126..36243,40901..41008,
FT                   42554..42683,44927..45043,45364..45489,46205..46387,
FT                   47966..48074,48995..49123,49727..49806,50000..50057,
FT                   50582..50695)
FT                   /codon_start=1
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT29238.3
FT                   protein_id=hCP47906.2 isoform=CRA_c"
FT                   /db_xref="GOA:V9HVY3"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:V9HVY3"
FT                   /protein_id="EAW77236.1"
FT   CDS             join(26018..26095,26171..26184,33301..33379,36126..36243,
FT                   40901..41008,42554..42683,44927..45043,45364..45489,
FT                   46205..46387,47966..48074,48995..49123,49727..49806,
FT                   50000..50057,50582..50695)
FT                   /codon_start=1
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT2355689.0
FT                   protein_id=hCP1920940.0 isoform=CRA_a"
FT                   /protein_id="EAW77234.1"
FT   CDS             join(31129..31235,33301..33379,36126..36243,40901..41008,
FT                   42554..42683,44927..45043,45364..45489,46205..46387,
FT                   47966..48074,48995..49123,49727..49806,50000..50057,
FT                   50582..50695)
FT                   /codon_start=1
FT                   /gene="PDIA3"
FT                   /locus_tag="hCG_38001"
FT                   /product="protein disulfide isomerase family A, member 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG38001.3 transcript_id=hCT2355690.0
FT                   protein_id=hCP1920941.0 isoform=CRA_b"
FT                   /protein_id="EAW77235.1"
FT   gene            complement(51323..56792)
FT                   /gene="ELL3"
FT                   /locus_tag="hCG_37998"
FT                   /note="gene_id=hCG37998.3"
FT   mRNA            complement(join(51323..52703,52781..52825,53659..53830,
FT                   53953..53995,54073..54250,54783..54858,55002..55087,
FT                   55199..55400,55516..55628,55986..56021,56247..56441,
FT                   56593..56792))
FT                   /gene="ELL3"
FT                   /locus_tag="hCG_37998"
FT                   /product="elongation factor RNA polymerase II-like 3,
FT                   transcript variant hCT2290108"
FT                   /note="gene_id=hCG37998.3 transcript_id=hCT2290108.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(51323..52703,52781..52825,53659..53830,
FT                   53953..53995,54073..54250,54783..54858,55002..55087,
FT                   55199..55400,55516..55628,55986..56021,56247..56555))
FT                   /gene="ELL3"
FT                   /locus_tag="hCG_37998"
FT                   /product="elongation factor RNA polymerase II-like 3,
FT                   transcript variant hCT29235"
FT                   /note="gene_id=hCG37998.3 transcript_id=hCT29235.3; splice
FT                   donor-acceptor pairs covered / total pairs = 10/10; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(52593..52703,52781..52825,53659..53830,
FT                   53953..53995,54073..54250,54783..54858,55002..55087,
FT                   55199..55400,55516..55628,55986..56021,56247..56441,
FT                   56593..56619))
FT                   /codon_start=1
FT                   /gene="ELL3"
FT                   /locus_tag="hCG_37998"
FT                   /product="elongation factor RNA polymerase II-like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG37998.3 transcript_id=hCT2290108.0
FT                   protein_id=hCP1878828.0 isoform=CRA_a"
FT                   /protein_id="EAW77237.1"
FT   CDS             complement(join(52593..52703,52781..52825,53659..53830,
FT                   53953..53995,54073..54250,54783..54858,55002..55087,
FT                   55199..55400,55516..55628,55986..56021,56247..56378))
FT                   /codon_start=1
FT                   /gene="ELL3"
FT                   /locus_tag="hCG_37998"
FT                   /product="elongation factor RNA polymerase II-like 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG37998.3 transcript_id=hCT29235.3
FT                   protein_id=hCP47907.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9HB65"
FT                   /db_xref="HGNC:HGNC:23113"
FT                   /db_xref="InterPro:IPR010844"
FT                   /db_xref="InterPro:IPR019464"
FT                   /db_xref="InterPro:IPR031175"
FT                   /db_xref="InterPro:IPR031176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HB65"
FT                   /protein_id="EAW77238.1"
FT   gene            56573..82046
FT                   /locus_tag="hCG_2003792"
FT                   /note="gene_id=hCG2003792.0"
FT   mRNA            join(56573..56979,64887..65011,71453..71860,72452..72560,
FT                   73187..73413,78346..78584,78835..79370,79825..80261,
FT                   80609..80664,80995..81046,81188..82046)
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, transcript variant hCT2289507"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289507.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   mRNA            join(56573..56979,64887..65011,71453..71860,72452..72560,
FT                   78346..78584,79096..79370,79825..80261,80609..80664,
FT                   80995..81046,81188..82046)
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, transcript variant hCT2289509"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289509.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            join(56573..56979,64887..65011,71453..71860,72452..72560,
FT                   73187..74124,74573..74751)
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, transcript variant hCT2289508"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289508.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(56573..56979,64887..65011,71453..71860,72452..72560,
FT                   73187..74586)
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, transcript variant hCT2289512"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289512.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(<72527..72560,79972..80261,80609..80664,80995..81046,
FT                   81188..82046)
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, transcript variant hCT2289510"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289510.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(72527..72560,79972..80261,80609..80664,80995..81046,
FT                   81188..81283)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, isoform CRA_c"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289510.0
FT                   protein_id=hCP1878850.0 isoform=CRA_c"
FT                   /protein_id="EAW77243.1"
FT                   GNVVEALIALTN"
FT   CDS             join(72527..72560,73187..73449)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, isoform CRA_a"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289508.0
FT                   protein_id=hCP1878852.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S0"
FT                   /protein_id="EAW77239.1"
FT   CDS             join(72527..72560,73187..73449)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, isoform CRA_a"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289512.0
FT                   protein_id=hCP1878848.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S0"
FT                   /protein_id="EAW77240.1"
FT   gene            complement(73651..79961)
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /note="gene_id=hCG1821273.1"
FT   mRNA            complement(join(73651..74690,74865..75018,75165..75213,
FT                   75632..75704,76117..76219,76322..76417,76622..76833,
FT                   77397..77490,77902..77981,78436..78614,78787..78963,
FT                   79362..79961))
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, transcript variant
FT                   hCT2290105"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT2290105.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(73651..74690,74865..75018,75165..75213,
FT                   75632..75704,76093..76219,76322..76417,76622..76833,
FT                   77397..77490,77902..77981,78436..78614,78787..78963,
FT                   79362..79961))
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, transcript variant
FT                   hCT1971920"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT1971920.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(73754..74690,74865..75018,75165..75213,
FT                   75632..75704,76093..76219,76322..76417,77397..77490,
FT                   77902..77981,78436..78614,78787..79004,79362..79574))
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, transcript variant
FT                   hCT2355700"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT2355700.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(74477..74690,74865..75018,75165..75213,
FT                   75632..75704,76117..76219,76322..76417,76622..76833,
FT                   77397..77490,77902..77981,78436..78614,78787..78963,
FT                   79362..79463))
FT                   /codon_start=1
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, isoform CRA_c"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT2290105.0
FT                   protein_id=hCP1878823.0 isoform=CRA_c"
FT                   /protein_id="EAW77246.1"
FT   CDS             complement(join(74477..74690,74865..75018,75165..75213,
FT                   75632..75704,76093..76219,76322..76417,76622..76833,
FT                   77397..77490,77902..77981,78436..78614,78787..78963,
FT                   79362..79463))
FT                   /codon_start=1
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, isoform CRA_a"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT1971920.1
FT                   protein_id=hCP1784455.1 isoform=CRA_a"
FT                   /db_xref="GOA:A6NH21"
FT                   /db_xref="HGNC:HGNC:32237"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="InterPro:IPR029563"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6NH21"
FT                   /protein_id="EAW77244.1"
FT                   V"
FT   CDS             complement(join(74477..74690,74865..75018,75165..75213,
FT                   75632..75704,76093..76219,76322..76417,77397..77490,
FT                   77902..77919))
FT                   /codon_start=1
FT                   /gene="SERINC4"
FT                   /locus_tag="hCG_1821273"
FT                   /product="serine incorporator 4, isoform CRA_b"
FT                   /note="gene_id=hCG1821273.1 transcript_id=hCT2355700.0
FT                   protein_id=hCP1920923.0 isoform=CRA_b"
FT                   /db_xref="GOA:A6NH21"
FT                   /db_xref="HGNC:HGNC:32237"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="InterPro:IPR029563"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6NH21"
FT                   /protein_id="EAW77245.1"
FT   CDS             join(80076..80261,80609..80664,80995..81046,81188..81283)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, isoform CRA_b"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289507.0
FT                   protein_id=hCP1878849.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Q1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q1"
FT                   /protein_id="EAW77241.1"
FT   CDS             join(80076..80261,80609..80664,80995..81046,81188..81283)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2003792"
FT                   /product="hCG2003792, isoform CRA_b"
FT                   /note="gene_id=hCG2003792.0 transcript_id=hCT2289509.0
FT                   protein_id=hCP1878851.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Q1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q1"
FT                   /protein_id="EAW77242.1"
FT   gene            complement(83769..104228)
FT                   /gene="MFAP1"
FT                   /locus_tag="hCG_37732"
FT                   /note="gene_id=hCG37732.3"
FT   mRNA            complement(join(83769..84752,84852..84941,89231..89390,
FT                   92463..92623,92725..92833,93976..94163,94420..94549,
FT                   96704..96923,103966..104228))
FT                   /gene="MFAP1"
FT                   /locus_tag="hCG_37732"
FT                   /product="microfibrillar-associated protein 1"
FT                   /note="gene_id=hCG37732.3 transcript_id=hCT28966.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(84570..84752,84852..84941,89231..89390,
FT                   92463..92623,92725..92833,93976..94163,94420..94549,
FT                   96704..96923,103966..104044))
FT                   /codon_start=1
FT                   /gene="MFAP1"
FT                   /locus_tag="hCG_37732"
FT                   /product="microfibrillar-associated protein 1"
FT                   /note="gene_id=hCG37732.3 transcript_id=hCT28966.3
FT                   protein_id=hCP47904.2"
FT                   /db_xref="GOA:P55081"
FT                   /db_xref="HGNC:HGNC:7032"
FT                   /db_xref="InterPro:IPR009730"
FT                   /db_xref="InterPro:IPR033194"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55081"
FT                   /protein_id="EAW77247.1"
FT   gene            106460..638274
FT                   /gene="WDR76"
FT                   /locus_tag="hCG_38000"
FT                   /note="gene_id=hCG38000.4"
FT   mRNA            join(106460..106567,107440..107841,114534..114623,
FT                   115637..115692,119080..119203,121890..121991,
FT                   122103..122146,123376..123529,130562..130720,
FT                   136421..136638,138145..138297,140807..140860,
FT                   145603..146171,149807..149907,180195..180232,
FT                   184754..184825,186292..186379,638253..638274)
FT                   /gene="WDR76"
FT                   /locus_tag="hCG_38000"
FT                   /product="WD repeat domain 76"
FT                   /note="gene_id=hCG38000.4 transcript_id=hCT29237.4; splice
FT                   donor-acceptor pairs covered / total pairs = 13/17; created
FT                   on 07-OCT-2003"
FT   CDS             join(106508..106567,107440..107841,114534..114623,
FT                   115637..115692,119080..119203,121890..121991,
FT                   122103..122146,123376..123529,130562..130720,
FT                   136421..136638,138145..138297,140807..140860,
FT                   145603..145867)
FT                   /codon_start=1
FT                   /gene="WDR76"
FT                   /locus_tag="hCG_38000"
FT                   /product="WD repeat domain 76"
FT                   /note="gene_id=hCG38000.4 transcript_id=hCT29237.4
FT                   protein_id=hCP47905.2"
FT                   /protein_id="EAW77248.1"
FT   gene            complement(152373..474757)
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /note="gene_id=hCG1644657.3"
FT   mRNA            complement(join(152373..153412,153592..153935,
FT                   163176..163282,164200..164268,165154..165228,
FT                   167648..167739,168282..168345,171454..171542,
FT                   181648..181735,185302..185425,189354..189451,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474550,474656..474757))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2290091"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290091.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(152373..153935,163176..163282,
FT                   164200..164268,165154..165228,167648..167739,
FT                   168282..168345,171454..171542,181648..181735,
FT                   185302..185425,189354..189451,198474..198776,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474550,474656..474757))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT1644784"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT1644784.3;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(152373..153935,163176..163282,
FT                   164200..164268,165141..165228,167648..167739,
FT                   168282..168345,171454..171542,181648..181735,
FT                   185302..185425,189354..189451,198474..198776,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474550,474656..474757))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2290092"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290092.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(152373..153935,163176..163282,
FT                   164200..164268,165141..165228,167648..167739,
FT                   168282..168345,171454..171542,181648..181735,
FT                   185302..185425,189354..189451,198474..198776,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474737))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2290090"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290090.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(152749..153935,163176..163282,
FT                   164200..164268,165154..165228,167648..167739,
FT                   168282..168345,181648..181735,185302..185425,
FT                   189354..189451,197221..197325,198474..198776,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474553))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2355745"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355745.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(152749..153412,153592..153935,
FT                   163176..163282,164200..164268,165154..165228,
FT                   167648..167739,168297..168345,171454..171542,
FT                   181648..181735,185302..185425,189354..189451,
FT                   198955..199033,199263..199305,203701..203805,
FT                   380964..381035,473734..473953))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2355744"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355744.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(153006..153935,163176..163282,
FT                   164200..164268,165154..165228,167648..167739,
FT                   168282..168345,171454..171542,181648..181735,
FT                   185302..185425,189354..189451,198955..199033,
FT                   199263..199305,203701..203805,474460..474738))
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, transcript variant
FT                   hCT2355746"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355746.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(153358..153935,163176..163282,
FT                   164200..164268,165154..165228,167648..167739,
FT                   168282..168345,171454..171542,181648..181735,
FT                   185302..185425,189354..189451,198955..199033,
FT                   199263..199305,203701..203805,474460..474561))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_c"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355746.0
FT                   protein_id=hCP1920978.0 isoform=CRA_c"
FT                   /protein_id="EAW77252.1"
FT   CDS             complement(join(153358..153935,163176..163282,
FT                   164200..164268,165154..165228,167648..167739,
FT                   168282..168345,181648..181673))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_e"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355745.0
FT                   protein_id=hCP1920977.0 isoform=CRA_e"
FT                   /db_xref="GOA:A0A087WVP2"
FT                   /db_xref="HGNC:HGNC:28214"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014847"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WVP2"
FT                   /protein_id="EAW77255.1"
FT   CDS             complement(join(153358..153935,163176..163282,
FT                   164200..164246))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_a"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290092.0
FT                   protein_id=hCP1878838.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8K1U8"
FT                   /db_xref="UniProtKB/TrEMBL:A8K1U8"
FT                   /protein_id="EAW77249.1"
FT   CDS             complement(join(153358..153935,163176..163282,
FT                   164200..164246))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_a"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT1644784.3
FT                   protein_id=hCP1631904.2 isoform=CRA_a"
FT                   /db_xref="GOA:A8K1U8"
FT                   /db_xref="UniProtKB/TrEMBL:A8K1U8"
FT                   /protein_id="EAW77250.1"
FT   CDS             complement(join(153358..153935,163176..163282,
FT                   164200..164246))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_a"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290090.0
FT                   protein_id=hCP1878835.0 isoform=CRA_a"
FT                   /db_xref="GOA:A8K1U8"
FT                   /db_xref="UniProtKB/TrEMBL:A8K1U8"
FT                   /protein_id="EAW77253.1"
FT   CDS             complement(join(153365..153412,153592..153935,
FT                   163176..163282,164200..164268,165154..165228,
FT                   167648..167739,168282..168345,171454..171542,
FT                   181648..181735,185302..185425,189354..189451,
FT                   198955..199033,199263..199305,203701..203805,
FT                   474460..474546))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_d"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2290091.0
FT                   protein_id=hCP1878837.0 isoform=CRA_d"
FT                   /protein_id="EAW77254.1"
FT   CDS             complement(join(153365..153412,153592..153935,
FT                   163176..163282,164200..164268,165154..165228,
FT                   167648..167739,168297..168345,171454..171542,
FT                   181648..181735,185302..185425,189354..189451,
FT                   198955..199016))
FT                   /codon_start=1
FT                   /gene="FRMD5"
FT                   /locus_tag="hCG_1644657"
FT                   /product="FERM domain containing 5, isoform CRA_b"
FT                   /note="gene_id=hCG1644657.3 transcript_id=hCT2355744.0
FT                   protein_id=hCP1920976.0 isoform=CRA_b"
FT                   /db_xref="GOA:H0YKW6"
FT                   /db_xref="HGNC:HGNC:28214"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014847"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="UniProtKB/TrEMBL:H0YKW6"
FT                   /protein_id="EAW77251.1"
FT                   AMVCLQNPLSGEPAH"
FT   gene            complement(155303..157644)
FT                   /locus_tag="hCG_1789710"
FT                   /note="gene_id=hCG1789710.3"
FT   mRNA            complement(155303..157644)
FT                   /locus_tag="hCG_1789710"
FT                   /product="hCG1789710"
FT                   /note="gene_id=hCG1789710.3 transcript_id=hCT1828956.3;
FT                   overlap evidence=yes; created on 29-JAN-2004"
FT   CDS             complement(155322..155717)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1789710"
FT                   /product="hCG1789710"
FT                   /note="gene_id=hCG1789710.3 transcript_id=hCT1828956.3
FT                   protein_id=hCP1736791.3"
FT                   /protein_id="EAW77256.1"
FT   gene            complement(268476..269730)
FT                   /pseudo
FT                   /locus_tag="hCG_1786710"
FT                   /note="gene_id=hCG1786710.2"
FT   mRNA            complement(268476..269730)
FT                   /pseudo
FT                   /locus_tag="hCG_1786710"
FT                   /note="gene_id=hCG1786710.2 transcript_id=hCT1825756.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            342746..343825
FT                   /pseudo
FT                   /locus_tag="hCG_39322"
FT                   /note="gene_id=hCG39322.3"
FT   mRNA            342746..343825
FT                   /pseudo
FT                   /locus_tag="hCG_39322"
FT                   /note="gene_id=hCG39322.3 transcript_id=hCT30573.3; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   gene            568466..696258
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /note="gene_id=hCG2003796.1"
FT   mRNA            join(568466..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   659470..659568,660586..660756,682667..682834,
FT                   693116..695537)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2289520"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289520.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 12-MAY-2003"
FT   mRNA            join(568466..569136,602745..602799,608465..608567,
FT                   617543..617687,618017..618097,659470..659568,
FT                   660586..660756,682667..682834,693116..695537)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2289516"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289516.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 12-MAY-2003"
FT   mRNA            join(568466..569136,617543..617687,618017..618097,
FT                   660586..660756,682667..682834,693116..695533)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2289517"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289517.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/5;
FT                   created on 12-MAY-2003"
FT   mRNA            join(568466..569136,602745..602799,608465..608567,
FT                   617543..617687,618017..618097,628323..628680)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2289519"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289519.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 12-MAY-2003"
FT   mRNA            join(568518..569136,587018..588316)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2345169"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345169.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 27-MAY-2003"
FT   mRNA            join(568681..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   659470..659568,660586..660756,693116..695537)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2345166"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345166.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 12-MAY-2003"
FT   mRNA            join(568681..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   625655..625928)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2345167"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345167.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 12-MAY-2003"
FT   CDS             join(568810..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   659470..659568,660586..660756,682667..682834,
FT                   693116..693186)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_b"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289520.1
FT                   protein_id=hCP1878869.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6P4E1"
FT                   /db_xref="HGNC:HGNC:24892"
FT                   /db_xref="InterPro:IPR026139"
FT                   /db_xref="InterPro:IPR026141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P4E1"
FT                   /protein_id="EAW77258.1"
FT   CDS             join(568810..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   659470..659568,660586..660756,693116..693186)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_c"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345166.0
FT                   protein_id=hCP1910455.0 isoform=CRA_c"
FT                   /protein_id="EAW77259.1"
FT   CDS             join(568810..569136,617543..617687,618017..618097,
FT                   660586..660756,682667..682834,693116..693186)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_f"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289517.0
FT                   protein_id=hCP1878867.0 isoform=CRA_f"
FT                   /protein_id="EAW77263.1"
FT   CDS             join(568810..569136,602745..602799,608465..608567,
FT                   611768..611858,617543..617687,618017..618097,
FT                   625655..625674)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_e"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345167.0
FT                   protein_id=hCP1910456.0 isoform=CRA_e"
FT                   /protein_id="EAW77262.1"
FT   CDS             join(568810..569136,602745..602799,608465..608567,
FT                   617543..617591)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_a"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289516.1
FT                   protein_id=hCP1878870.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S2"
FT                   /db_xref="InterPro:IPR026139"
FT                   /db_xref="InterPro:IPR026141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S2"
FT                   /protein_id="EAW77257.1"
FT                   RPKRFNQMMERNWI"
FT   CDS             join(568810..569136,602745..602799,608465..608567,
FT                   617543..617591)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_a"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2289519.0
FT                   protein_id=hCP1878865.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S2"
FT                   /db_xref="InterPro:IPR026139"
FT                   /db_xref="InterPro:IPR026141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S2"
FT                   /protein_id="EAW77260.1"
FT                   RPKRFNQMMERNWI"
FT   CDS             join(568810..569136,587018..587200)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_g"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345169.0
FT                   protein_id=hCP1910453.0 isoform=CRA_g"
FT                   /db_xref="GOA:Q8N7K6"
FT                   /db_xref="InterPro:IPR026139"
FT                   /db_xref="InterPro:IPR026141"
FT                   /db_xref="UniProtKB/TrEMBL:Q8N7K6"
FT                   /protein_id="EAW77264.1"
FT                   DGVSQC"
FT   mRNA            join(568885..569136,608465..608567,611768..611858,
FT                   617543..617687,618017..618097,659470..659568,
FT                   660586..660756,682667..682834,693116..696258)
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, transcript
FT                   variant hCT2345168"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345168.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 12-MAY-2003"
FT   CDS             join(611787..611858,617543..617687,618017..618097,
FT                   659470..659568,660586..660756,682667..682834,
FT                   693116..693186)
FT                   /codon_start=1
FT                   /gene="CASC4"
FT                   /locus_tag="hCG_2003796"
FT                   /product="cancer susceptibility candidate 4, isoform CRA_d"
FT                   /note="gene_id=hCG2003796.1 transcript_id=hCT2345168.0
FT                   protein_id=hCP1910454.0 isoform=CRA_d"
FT                   /protein_id="EAW77261.1"
FT   gene            707013..808047
FT                   /gene="CTDSPL2"
FT                   /locus_tag="hCG_37787"
FT                   /note="gene_id=hCG37787.3"
FT   mRNA            join(707013..707266,707321..707472,738765..738974,
FT                   763996..764134,766323..766472,770556..770771,
FT                   776152..776230,776799..776910,779499..779585,
FT                   794369..794431,794536..794615,798940..799066,
FT                   801082..801177,803880..808047)
FT                   /gene="CTDSPL2"
FT                   /locus_tag="hCG_37787"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase like 2, transcript variant
FT                   hCT1958152"
FT                   /note="gene_id=hCG37787.3 transcript_id=hCT1958152.1;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 26-AUG-2002"
FT   mRNA            join(707321..707552,738765..738974,763996..764134,
FT                   766323..766472,770556..770771,776152..776230,
FT                   776799..776910,779499..779585,794369..794431,
FT                   794536..794615,798940..799066,801082..801177,
FT                   803880..808047)
FT                   /gene="CTDSPL2"
FT                   /locus_tag="hCG_37787"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase like 2, transcript variant
FT                   hCT29021"
FT                   /note="gene_id=hCG37787.3 transcript_id=hCT29021.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 26-AUG-2002"
FT   gene            complement(727349..729118)
FT                   /pseudo
FT                   /locus_tag="hCG_1641664"
FT                   /note="gene_id=hCG1641664.2"
FT   mRNA            complement(727349..729118)
FT                   /pseudo
FT                   /locus_tag="hCG_1641664"
FT                   /note="gene_id=hCG1641664.2 transcript_id=hCT1641791.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             join(738789..738974,763996..764134,766323..766472,
FT                   770556..770771,776152..776230,776799..776910,
FT                   779499..779585,794369..794431,794536..794615,
FT                   798940..799066,801082..801177,803880..803945)
FT                   /codon_start=1
FT                   /gene="CTDSPL2"
FT                   /locus_tag="hCG_37787"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase like 2, isoform CRA_a"
FT                   /note="gene_id=hCG37787.3 transcript_id=hCT1958152.1
FT                   protein_id=hCP1764815.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q05D32"
FT                   /db_xref="HGNC:HGNC:26936"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05D32"
FT                   /protein_id="EAW77265.1"
FT                   LHDLLPPD"
FT   CDS             join(738789..738974,763996..764134,766323..766472,
FT                   770556..770771,776152..776230,776799..776910,
FT                   779499..779585,794369..794431,794536..794615,
FT                   798940..799066,801082..801177,803880..803945)
FT                   /codon_start=1
FT                   /gene="CTDSPL2"
FT                   /locus_tag="hCG_37787"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase like 2, isoform CRA_a"
FT                   /note="gene_id=hCG37787.3 transcript_id=hCT29021.3
FT                   protein_id=hCP49176.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5Q8"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q8"
FT                   /protein_id="EAW77266.1"
FT                   LHDLLPPD"
FT   gene            complement(814283..>816696)
FT                   /locus_tag="hCG_1786715"
FT                   /note="gene_id=hCG1786715.2"
FT   mRNA            complement(join(814283..815245,815814..>816696))
FT                   /locus_tag="hCG_1786715"
FT                   /product="hCG1786715"
FT                   /note="gene_id=hCG1786715.2 transcript_id=hCT1968265.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(816320..>816694)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786715"
FT                   /product="hCG1786715"
FT                   /note="gene_id=hCG1786715.2 transcript_id=hCT1968265.1
FT                   protein_id=hCP1782658.1"
FT                   /protein_id="EAW77267.1"
FT   gene            816820..843242
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /note="gene_id=hCG39324.4"
FT   mRNA            join(816820..817008,817095..817198,830644..830698,
FT                   831199..831290,834321..834435,837257..837418,
FT                   840017..840090,840786..843242)
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, transcript variant hCT30575"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT30575.4; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            join(816820..817008,817095..817198,830644..830698,
FT                   831199..831290,834321..834435,837257..837418,
FT                   840017..840090,840786..841039,841106..843071)
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, transcript variant hCT1971218"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT1971218.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            join(816820..817008,817095..817188,834321..834435,
FT                   837257..837418,840017..840090,840786..841039,
FT                   841106..843071)
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, transcript variant hCT1971219"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT1971219.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(816820..817008,817095..817198,830644..830698,
FT                   831199..831239,834321..834435,837257..837418,
FT                   840017..840090,840796..842047)
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, transcript variant hCT2289527"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT2289527.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(816966..817008,817095..817198,830644..830698,
FT                   831199..831290,834321..834435,837257..837418,
FT                   840017..840090,840786..840917)
FT                   /codon_start=1
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, isoform CRA_a"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT1971218.1
FT                   protein_id=hCP1783337.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S5"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S5"
FT                   /protein_id="EAW77268.1"
FT   CDS             join(816966..817008,817095..817198,830644..830698,
FT                   831199..831290,834321..834435,837257..837418,
FT                   840017..840090,840786..840917)
FT                   /codon_start=1
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, isoform CRA_a"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT30575.4
FT                   protein_id=hCP49181.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S5"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S5"
FT                   /protein_id="EAW77270.1"
FT   CDS             join(816966..817008,817095..817198,830644..830698,
FT                   831199..831239,834321..834435,837257..837418,
FT                   840017..840090,840796..840837)
FT                   /codon_start=1
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, isoform CRA_c"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT2289527.0
FT                   protein_id=hCP1878859.0 isoform=CRA_c"
FT                   /protein_id="EAW77271.1"
FT   CDS             join(837289..837418,840017..840090,840786..840917)
FT                   /codon_start=1
FT                   /gene="EIF3S1"
FT                   /locus_tag="hCG_39324"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 1 alpha, 35kDa, isoform CRA_b"
FT                   /note="gene_id=hCG39324.4 transcript_id=hCT1971219.1
FT                   protein_id=hCP1783294.1 isoform=CRA_b"
FT                   /protein_id="EAW77269.1"
FT                   QDYEDFM"
FT   gene            complement(841320..943422)
FT                   /gene="KIAA1840"
FT                   /locus_tag="hCG_2004168"
FT                   /note="gene_id=hCG2004168.0"
FT   mRNA            complement(join(841320..843069,844315..844466,
FT                   845622..845777,845985..846073,847192..847360,
FT                   849166..849273,850293..850426,852451..852588,
FT                   853315..853513,854670..854809,863580..864324,
FT                   865403..865617,869018..869180,872097..872204,
FT                   875025..875225,875849..876121,876549..876708,
FT                   878030..878138,878396..878601,880232..880397,
FT                   885790..885856,888209..888370,890605..890750,
FT                   895129..895332,899956..900169,901525..901700,
FT                   901986..902113,902494..902565,906097..906273,
FT                   908435..908610,908999..909154,913271..913403,
FT                   928633..928778,931258..931706,931896..932033,
FT                   936862..937063,938846..939070,940199..940383,
FT                   943158..943422))
FT                   /gene="KIAA1840"
FT                   /locus_tag="hCG_2004168"
FT                   /product="KIAA1840, transcript variant hCT2290083"
FT                   /note="gene_id=hCG2004168.0 transcript_id=hCT2290083.0;
FT                   splice donor-acceptor pairs covered / total pairs = 37/38;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(841320..843069,844315..844466,
FT                   845622..845777,845985..846073,847192..847360,
FT                   849166..849273,850293..850426,852451..852588,
FT                   853315..853513,854670..854809,863580..864324,
FT                   865403..865617,868333..868404,869018..869180,
FT                   872097..872204,875025..875225,875849..876121,
FT                   876549..876708,878030..878138,878396..878601,
FT                   880232..880397,885790..885856,888209..888370,
FT                   890605..890750,893196..893302,895129..895332,
FT                   899956..900169,901525..901700,901986..902113,
FT                   902494..902565,906097..906273,908435..908610,
FT                   908999..909154,913271..913403,928633..928778,
FT                   931258..931706,931896..932033,936862..937063,
FT                   938846..939070,940199..940383,943158..943422))
FT                   /gene="KIAA1840"
FT                   /locus_tag="hCG_2004168"
FT                   /product="KIAA1840, transcript variant hCT2290081"
FT                   /note="gene_id=hCG2004168.0 transcript_id=hCT2290081.0;
FT                   splice donor-acceptor pairs covered / total pairs = 40/40;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(842889..843069,844315..844466,
FT                   845622..845777,845985..846073,847192..847360,
FT                   849166..849273,850293..850426,852451..852588,
FT                   853315..853513,854670..854809,863580..864324,
FT                   865403..865617,869018..869180,872097..872204,
FT                   875025..875225,875849..876121,876549..876708,
FT                   878030..878138,878396..878601,880232..880397,
FT                   885790..885856,888209..888370,890605..890750,
FT                   895129..895150))
FT                   /codon_start=1
FT                   /gene="KIAA1840"
FT                   /locus_tag="hCG_2004168"
FT                   /product="KIAA1840, isoform CRA_b"
FT                   /note="gene_id=hCG2004168.0 transcript_id=hCT2290083.0
FT                   protein_id=hCP1878843.0 isoform=CRA_b"
FT                   /protein_id="EAW77273.1"
FT                   "
FT   CDS             complement(join(868391..868404,869018..869180,
FT                   872097..872204,875025..875225,875849..876121,
FT                   876549..876708,878030..878138,878396..878601,
FT                   880232..880397,885790..885856,888209..888370,
FT                   890605..890750,893196..893302,895129..895332,
FT                   899956..900169,901525..901700,901986..902113,
FT                   902494..902565,906097..906273,908435..908610,
FT                   908999..909154,913271..913403,928633..928778,
FT                   931258..931706,931896..932033,936862..937063,
FT                   938846..939070,940199..940383,943158..943414))
FT                   /codon_start=1
FT                   /gene="KIAA1840"
FT                   /locus_tag="hCG_2004168"
FT                   /product="KIAA1840, isoform CRA_a"
FT                   /note="gene_id=hCG2004168.0 transcript_id=hCT2290081.0
FT                   protein_id=hCP1878842.0 isoform=CRA_a"
FT                   /protein_id="EAW77272.1"
FT                   D"
FT   gene            complement(945499..956331)
FT                   /locus_tag="hCG_39323"
FT                   /note="gene_id=hCG39323.4"
FT   mRNA            complement(join(945499..945738,946159..946308,
FT                   946873..946970,948109..948249,948747..948906,
FT                   949047..949180,949277..949330,949544..949641,
FT                   949734..949854,951782..951923,952155..952223,
FT                   953002..953144,953916..953992,955224..955476))
FT                   /locus_tag="hCG_39323"
FT                   /product="hCG39323, transcript variant hCT30574"
FT                   /note="gene_id=hCG39323.4 transcript_id=hCT30574.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/13; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(945504..945738,946159..946308,
FT                   946873..946970,948109..948249,948747..948906,
FT                   949047..949180,949277..949330,949544..949641,
FT                   949734..949854,951782..952006,952155..952223,
FT                   953002..953144,954059..954177,956241..956331))
FT                   /locus_tag="hCG_39323"
FT                   /product="hCG39323, transcript variant hCT2355679"
FT                   /note="gene_id=hCG39323.4 transcript_id=hCT2355679.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(945720..945738,946159..946308,
FT                   946873..946970,948109..948249,948747..948906,
FT                   949047..949180,949277..949330,949544..949641,
FT                   949734..949854,951782..951923,952155..952223,
FT                   953002..953144,953916..953992,955224..955233))
FT                   /codon_start=1
FT                   /locus_tag="hCG_39323"
FT                   /product="hCG39323, isoform CRA_b"
FT                   /note="gene_id=hCG39323.4 transcript_id=hCT30574.3
FT                   protein_id=hCP49180.3 isoform=CRA_b"
FT                   /protein_id="EAW77275.1"
FT                   QQLEARMEFAWIY"
FT   CDS             complement(join(945720..945738,946159..946308,
FT                   946873..946970,948109..948249,948747..948906,
FT                   949047..949180,949277..949330,949544..949641,
FT                   949734..949854,951782..951871))
FT                   /codon_start=1
FT                   /locus_tag="hCG_39323"
FT                   /product="hCG39323, isoform CRA_a"
FT                   /note="gene_id=hCG39323.4 transcript_id=hCT2355679.0
FT                   protein_id=hCP1920946.0 isoform=CRA_a"
FT                   /db_xref="HGNC:HGNC:33630"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniProtKB/TrEMBL:H0YMQ2"
FT                   /protein_id="EAW77274.1"
FT                   VQQLEARMEFAWIY"
FT   gene            991282..998652
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /note="gene_id=hCG1786707.4"
FT   mRNA            join(991282..991385,995195..995473,996101..996128,
FT                   997379..998652)
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, transcript variant
FT                   hCT1825753"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT1825753.4;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-FEB-2003"
FT   mRNA            join(991282..991385,995206..995473,996101..996128,
FT                   997379..998652)
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, transcript variant
FT                   hCT1971070"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT1971070.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-FEB-2003"
FT   CDS             join(991319..991385,995195..995473,996101..996114)
FT                   /codon_start=1
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, isoform CRA_b"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT1825753.4
FT                   protein_id=hCP1733445.1 isoform=CRA_b"
FT                   /db_xref="GOA:P61769"
FT                   /db_xref="HGNC:HGNC:914"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015707"
FT                   /db_xref="PDB:1A1M"
FT                   /db_xref="PDB:1A1N"
FT                   /db_xref="PDB:1A1O"
FT                   /db_xref="PDB:1A6Z"
FT                   /db_xref="PDB:1A9B"
FT                   /db_xref="PDB:1A9E"
FT                   /db_xref="PDB:1AGB"
FT                   /db_xref="PDB:1AGC"
FT                   /db_xref="PDB:1AGD"
FT                   /db_xref="PDB:1AGE"
FT                   /db_xref="PDB:1AGF"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1C16"
FT                   /db_xref="PDB:1CE6"
FT                   /db_xref="PDB:1CG9"
FT                   /db_xref="PDB:1DE4"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1E27"
FT                   /db_xref="PDB:1E28"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1EFX"
FT                   /db_xref="PDB:1EXU"
FT                   /db_xref="PDB:1GZP"
FT                   /db_xref="PDB:1GZQ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1HSB"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1IM9"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1JNJ"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1KPR"
FT                   /db_xref="PDB:1KTL"
FT                   /db_xref="PDB:1LDS"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1M05"
FT                   /db_xref="PDB:1M6O"
FT                   /db_xref="PDB:1MHE"
FT                   /db_xref="PDB:1MI5"
FT                   /db_xref="PDB:1N2R"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ONQ"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1PY4"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QLF"
FT                   /db_xref="PDB:1QQD"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1R3H"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1SYS"
FT                   /db_xref="PDB:1SYV"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TMC"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UQS"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1VGK"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:1XH3"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:1XZ0"
FT                   /db_xref="PDB:1YDP"
FT                   /db_xref="PDB:1YPZ"
FT                   /db_xref="PDB:1ZHK"
FT                   /db_xref="PDB:1ZHL"
FT                   /db_xref="PDB:1ZS8"
FT                   /db_xref="PDB:1ZSD"
FT                   /db_xref="PDB:1ZT4"
FT                   /db_xref="PDB:1ZVS"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2AK4"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2AXF"
FT                   /db_xref="PDB:2AXG"
FT                   /db_xref="PDB:2BCK"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:2BVO"
FT                   /db_xref="PDB:2BVP"
FT                   /db_xref="PDB:2BVQ"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CII"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2D31"
FT                   /db_xref="PDB:2D4D"
FT                   /db_xref="PDB:2D4F"
FT                   /db_xref="PDB:2DYP"
FT                   /db_xref="PDB:2E8D"
FT                   /db_xref="PDB:2ESV"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2F74"
FT                   /db_xref="PDB:2F8O"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2H26"
FT                   /db_xref="PDB:2H6P"
FT                   /db_xref="PDB:2HJK"
FT                   /db_xref="PDB:2HJL"
FT                   /db_xref="PDB:2HLA"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2NW3"
FT                   /db_xref="PDB:2NX5"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PO6"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2RFX"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VB5"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:2X89"
FT                   /db_xref="PDB:2XKS"
FT                   /db_xref="PDB:2XKU"
FT                   /db_xref="PDB:2XPG"
FT                   /db_xref="PDB:2YPK"
FT                   /db_xref="PDB:2YPL"
FT                   /db_xref="PDB:2YXF"
FT                   /db_xref="PDB:2Z9T"
FT                   /db_xref="PDB:3AM8"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3BVN"
FT                   /db_xref="PDB:3BW9"
FT                   /db_xref="PDB:3BWA"
FT                   /db_xref="PDB:3BXN"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="PDB:3CIQ"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D2U"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3DBX"
FT                   /db_xref="PDB:3DHJ"
FT                   /db_xref="PDB:3DHM"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3DX6"
FT                   /db_xref="PDB:3DX7"
FT                   /db_xref="PDB:3DX8"
FT                   /db_xref="PDB:3DXA"
FT                   /db_xref="PDB:3EKC"
FT                   /db_xref="PDB:3FFC"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3HG1"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3HUJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3I6L"
FT                   /db_xref="PDB:3IB4"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3JTS"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3KPL"
FT                   /db_xref="PDB:3KPM"
FT                   /db_xref="PDB:3KPN"
FT                   /db_xref="PDB:3KPO"
FT                   /db_xref="PDB:3KPP"
FT                   /db_xref="PDB:3KPQ"
FT                   /db_xref="PDB:3KPR"
FT                   /db_xref="PDB:3KPS"
FT                   /db_xref="PDB:3KWW"
FT                   /db_xref="PDB:3KXF"
FT                   /db_xref="PDB:3KYN"
FT                   /db_xref="PDB:3KYO"
FT                   /db_xref="PDB:3L3D"
FT                   /db_xref="PDB:3L3G"
FT                   /db_xref="PDB:3L3I"
FT                   /db_xref="PDB:3L3J"
FT                   /db_xref="PDB:3L3K"
FT                   /db_xref="PDB:3LKN"
FT                   /db_xref="PDB:3LKO"
FT                   /db_xref="PDB:3LKP"
FT                   /db_xref="PDB:3LKQ"
FT                   /db_xref="PDB:3LKR"
FT                   /db_xref="PDB:3LKS"
FT                   /db_xref="PDB:3LN4"
FT                   /db_xref="PDB:3LN5"
FT                   /db_xref="PDB:3LOW"
FT                   /db_xref="PDB:3LOZ"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:3M17"
FT                   /db_xref="PDB:3M1B"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MV7"
FT                   /db_xref="PDB:3MV8"
FT                   /db_xref="PDB:3MV9"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3MYZ"
FT                   /db_xref="PDB:3MZT"
FT                   /db_xref="PDB:3NA4"
FT                   /db_xref="PDB:3NFN"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3OV6"
FT                   /db_xref="PDB:3OX8"
FT                   /db_xref="PDB:3OXR"
FT                   /db_xref="PDB:3OXS"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDA"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3QZW"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3RL1"
FT                   /db_xref="PDB:3RL2"
FT                   /db_xref="PDB:3RWJ"
FT                   /db_xref="PDB:3S6C"
FT                   /db_xref="PDB:3SDX"
FT                   /db_xref="PDB:3SJV"
FT                   /db_xref="PDB:3SKM"
FT                   /db_xref="PDB:3SKO"
FT                   /db_xref="PDB:3SPV"
FT                   /db_xref="PDB:3T8X"
FT                   /db_xref="PDB:3TID"
FT                   /db_xref="PDB:3TIE"
FT                   /db_xref="PDB:3TLR"
FT                   /db_xref="PDB:3TM6"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3TZV"
FT                   /db_xref="PDB:3U0P"
FT                   /db_xref="PDB:3UPR"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:3VCL"
FT                   /db_xref="PDB:3VFM"
FT                   /db_xref="PDB:3VFN"
FT                   /db_xref="PDB:3VFO"
FT                   /db_xref="PDB:3VFP"
FT                   /db_xref="PDB:3VFR"
FT                   /db_xref="PDB:3VFS"
FT                   /db_xref="PDB:3VFT"
FT                   /db_xref="PDB:3VFU"
FT                   /db_xref="PDB:3VFV"
FT                   /db_xref="PDB:3VFW"
FT                   /db_xref="PDB:3VH8"
FT                   /db_xref="PDB:3VRI"
FT                   /db_xref="PDB:3VRJ"
FT                   /db_xref="PDB:3VWJ"
FT                   /db_xref="PDB:3VWK"
FT                   /db_xref="PDB:3VXM"
FT                   /db_xref="PDB:3VXN"
FT                   /db_xref="PDB:3VXO"
FT                   /db_xref="PDB:3VXP"
FT                   /db_xref="PDB:3VXR"
FT                   /db_xref="PDB:3VXS"
FT                   /db_xref="PDB:3VXU"
FT                   /db_xref="PDB:3W0W"
FT                   /db_xref="PDB:3W39"
FT                   /db_xref="PDB:3WL9"
FT                   /db_xref="PDB:3WLB"
FT                   /db_xref="PDB:3WUW"
FT                   /db_xref="PDB:3X11"
FT                   /db_xref="PDB:3X12"
FT                   /db_xref="PDB:3X13"
FT                   /db_xref="PDB:3X14"
FT                   /db_xref="PDB:4E0K"
FT                   /db_xref="PDB:4E0L"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EN3"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4F7M"
FT                   /db_xref="PDB:4F7P"
FT                   /db_xref="PDB:4F7T"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4FXL"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4GUP"
FT                   /db_xref="PDB:4HKJ"
FT                   /db_xref="PDB:4HWZ"
FT                   /db_xref="PDB:4HX1"
FT                   /db_xref="PDB:4I48"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4JQV"
FT                   /db_xref="PDB:4JQX"
FT                   /db_xref="PDB:4JRX"
FT                   /db_xref="PDB:4JRY"
FT                   /db_xref="PDB:4K71"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4KDT"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4L4T"
FT                   /db_xref="PDB:4L4V"
FT                   /db_xref="PDB:4LCW"
FT                   /db_xref="PDB:4LCY"
FT                   /db_xref="PDB:4LHU"
FT                   /db_xref="PDB:4LNR"
FT                   /db_xref="PDB:4M8V"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4MJI"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="PDB:4N0F"
FT                   /db_xref="PDB:4N0U"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4NNX"
FT                   /db_xref="PDB:4NNY"
FT                   /db_xref="PDB:4NO0"
FT                   /db_xref="PDB:4NO2"
FT                   /db_xref="PDB:4NO3"
FT                   /db_xref="PDB:4NO5"
FT                   /db_xref="PDB:4NQC"
FT                   /db_xref="PDB:4NQD"
FT                   /db_xref="PDB:4NQE"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="PDB:4NT6"
FT                   /db_xref="PDB:4O2C"
FT                   /db_xref="PDB:4O2E"
FT                   /db_xref="PDB:4O2F"
FT                   /db_xref="PDB:4ONO"
FT                   /db_xref="PDB:4PJ5"
FT                   /db_xref="PDB:4PJ7"
FT                   /db_xref="PDB:4PJ8"
FT                   /db_xref="PDB:4PJ9"
FT                   /db_xref="PDB:4PJA"
FT                   /db_xref="PDB:4PJB"
FT                   /db_xref="PDB:4PJC"
FT                   /db_xref="PDB:4PJD"
FT                   /db_xref="PDB:4PJE"
FT                   /db_xref="PDB:4PJF"
FT                   /db_xref="PDB:4PJG"
FT                   /db_xref="PDB:4PJH"
FT                   /db_xref="PDB:4PJI"
FT                   /db_xref="PDB:4PJX"
FT                   /db_xref="PDB:4PR5"
FT                   /db_xref="PDB:4PRA"
FT                   /db_xref="PDB:4PRB"
FT                   /db_xref="PDB:4PRD"
FT                   /db_xref="PDB:4PRE"
FT                   /db_xref="PDB:4PRH"
FT                   /db_xref="PDB:4PRI"
FT                   /db_xref="PDB:4PRN"
FT                   /db_xref="PDB:4PRP"
FT                   /db_xref="PDB:4QOK"
FT                   /db_xref="PDB:4QRP"
FT                   /db_xref="PDB:4QRQ"
FT                   /db_xref="PDB:4QRR"
FT                   /db_xref="PDB:4QRS"
FT                   /db_xref="PDB:4QRT"
FT                   /db_xref="PDB:4QRU"
FT                   /db_xref="PDB:4R9H"
FT                   /db_xref="PDB:4RA3"
FT                   /db_xref="PDB:4RAH"
FT                   /db_xref="PDB:4RMQ"
FT                   /db_xref="PDB:4RMR"
FT                   /db_xref="PDB:4RMS"
FT                   /db_xref="PDB:4RMT"
FT                   /db_xref="PDB:4RMU"
FT                   /db_xref="PDB:4RMV"
FT                   /db_xref="PDB:4RMW"
FT                   /db_xref="PDB:4U1H"
FT                   /db_xref="PDB:4U1I"
FT                   /db_xref="PDB:4U1J"
FT                   /db_xref="PDB:4U1K"
FT                   /db_xref="PDB:4U1L"
FT                   /db_xref="PDB:4U1M"
FT                   /db_xref="PDB:4U1N"
FT                   /db_xref="PDB:4U1S"
FT                   /db_xref="PDB:4U6X"
FT                   /db_xref="PDB:4U6Y"
FT                   /db_xref="PDB:4UQ2"
FT                   /db_xref="PDB:4UQ3"
FT                   /db_xref="PDB:4WDI"
FT                   /db_xref="PDB:4WJ5"
FT                   /db_xref="PDB:4WO4"
FT                   /db_xref="PDB:4WU5"
FT                   /db_xref="PDB:4WU7"
FT                   /db_xref="PDB:4WUU"
FT                   /db_xref="PDB:4WW2"
FT                   /db_xref="PDB:4WWK"
FT                   /db_xref="PDB:4X6C"
FT                   /db_xref="PDB:4X6D"
FT                   /db_xref="PDB:4X6E"
FT                   /db_xref="PDB:4X6F"
FT                   /db_xref="PDB:4XXC"
FT                   /db_xref="PDB:4Z76"
FT                   /db_xref="PDB:4Z77"
FT                   /db_xref="PDB:4Z78"
FT                   /db_xref="PDB:4ZEZ"
FT                   /db_xref="PDB:5B38"
FT                   /db_xref="PDB:5B39"
FT                   /db_xref="PDB:5BRZ"
FT                   /db_xref="PDB:5BS0"
FT                   /db_xref="PDB:5BXF"
FT                   /db_xref="PDB:5C07"
FT                   /db_xref="PDB:5C08"
FT                   /db_xref="PDB:5C09"
FT                   /db_xref="PDB:5C0A"
FT                   /db_xref="PDB:5C0B"
FT                   /db_xref="PDB:5C0C"
FT                   /db_xref="PDB:5C0D"
FT                   /db_xref="PDB:5C0E"
FT                   /db_xref="PDB:5C0F"
FT                   /db_xref="PDB:5C0G"
FT                   /db_xref="PDB:5C0H"
FT                   /db_xref="PDB:5C0I"
FT                   /db_xref="PDB:5C0J"
FT                   /db_xref="PDB:5C9J"
FT                   /db_xref="PDB:5CFH"
FT                   /db_xref="PDB:5CKA"
FT                   /db_xref="PDB:5CKG"
FT                   /db_xref="PDB:5CS7"
FT                   /db_xref="PDB:5CSB"
FT                   /db_xref="PDB:5CSG"
FT                   /db_xref="PDB:5D2L"
FT                   /db_xref="PDB:5D2N"
FT                   /db_xref="PDB:5D5M"
FT                   /db_xref="PDB:5D7I"
FT                   /db_xref="PDB:5D7J"
FT                   /db_xref="PDB:5D7L"
FT                   /db_xref="PDB:5D9S"
FT                   /db_xref="PDB:5DDH"
FT                   /db_xref="PDB:5DEF"
FT                   /db_xref="PDB:5DEG"
FT                   /db_xref="PDB:5E9D"
FT                   /db_xref="PDB:5EO0"
FT                   /db_xref="PDB:5EO1"
FT                   /db_xref="PDB:5EU3"
FT                   /db_xref="PDB:5EU4"
FT                   /db_xref="PDB:5EU5"
FT                   /db_xref="PDB:5EU6"
FT                   /db_xref="PDB:5HGA"
FT                   /db_xref="PDB:5HGB"
FT                   /db_xref="PDB:5HGD"
FT                   /db_xref="PDB:5HGH"
FT                   /db_xref="PDB:5HHM"
FT                   /db_xref="PDB:5HHN"
FT                   /db_xref="PDB:5HHO"
FT                   /db_xref="PDB:5HHP"
FT                   /db_xref="PDB:5HHQ"
FT                   /db_xref="PDB:5HYJ"
FT                   /db_xref="PDB:5IRO"
FT                   /db_xref="PDB:5J1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61769"
FT                   /protein_id="EAW77277.1"
FT                   VTLSQPKIVKWDRDM"
FT   CDS             join(991319..991385,995206..995294)
FT                   /codon_start=1
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, isoform CRA_a"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT1971070.2
FT                   protein_id=hCP1783295.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q16446"
FT                   /db_xref="HGNC:HGNC:914"
FT                   /db_xref="UniProtKB/TrEMBL:Q16446"
FT                   /protein_id="EAW77276.1"
FT                   VSSIRH"
FT   mRNA            join(991699..991792,995195..995473,996101..996128,
FT                   997379..998652)
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, transcript variant
FT                   hCT2340882"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT2340882.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-FEB-2003"
FT   CDS             995312..995434
FT                   /codon_start=1
FT                   /gene="B2M"
FT                   /locus_tag="hCG_1786707"
FT                   /product="beta-2-microglobulin, isoform CRA_c"
FT                   /note="gene_id=hCG1786707.4 transcript_id=hCT2340882.0
FT                   protein_id=hCP1907466.0 isoform=CRA_c"
FT                   /protein_id="EAW77278.1"
FT   gene            <1007373..1047590
FT                   /locus_tag="hCG_39321"
FT                   /note="gene_id=hCG39321.2"
FT   mRNA            join(<1007373..1007407,1008983..1009125,1011496..1011743,
FT                   1034674..1035150,1036142..1036237,1038393..1038575,
FT                   1039412..1039434,1039520..1039644,1046992..1047590)
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, transcript variant hCT30572"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT30572.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/8; created
FT                   on 26-AUG-2002"
FT   mRNA            join(<1007373..1007407,1008983..1009125,1011496..1011743,
FT                   1034674..1035150,1036142..1036237,1039412..1039434,
FT                   1039520..1039644,1046992..1047590)
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, transcript variant hCT2286497"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286497.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(1007373..1007407,1008983..1009125,1011496..1011743,
FT                   1034674..1035150,1036142..1036237,1038393..1038575,
FT                   1039412..1039434,1039520..1039644,1046992..1047533)
FT                   /codon_start=1
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, isoform CRA_b"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT30572.2
FT                   protein_id=hCP49178.2 isoform=CRA_b"
FT                   /protein_id="EAW77280.1"
FT   CDS             join(1007373..1007407,1008983..1009125,1011496..1011743,
FT                   1034674..1035150,1036142..1036237,1039412..1039434,
FT                   1039520..1039644,1046992..1047533)
FT                   /codon_start=1
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, isoform CRA_d"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286497.0
FT                   protein_id=hCP1878919.0 isoform=CRA_d"
FT                   /protein_id="EAW77282.1"
FT   mRNA            join(1016141..1016489,1034674..1035150,1036142..1036237,
FT                   1038393..1038575,1039412..1039434,1039520..1039644,
FT                   1046992..1047590)
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, transcript variant hCT2286500"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286500.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1016304..1016489,1036142..1036237,1038385..1038626,
FT                   1039412..1039434,1039520..1039644,1046992..1047590)
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, transcript variant hCT2286496"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286496.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             join(1016484..1016489,1034674..1035150,1036142..1036237,
FT                   1038393..1038575,1039412..1039434,1039520..1039644,
FT                   1046992..1047533)
FT                   /codon_start=1
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, isoform CRA_c"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286500.0
FT                   protein_id=hCP1878918.0 isoform=CRA_c"
FT                   /protein_id="EAW77281.1"
FT   CDS             join(1038426..1038626,1039412..1039434,1039520..1039644,
FT                   1046992..1047533)
FT                   /codon_start=1
FT                   /locus_tag="hCG_39321"
FT                   /product="hCG39321, isoform CRA_a"
FT                   /note="gene_id=hCG39321.2 transcript_id=hCT2286496.0
FT                   protein_id=hCP1878916.0 isoform=CRA_a"
FT                   /protein_id="EAW77279.1"
FT                   DGGENKEPLHILHPQ"
FT   assembly_gap    1102571..1114042
FT                   /estimated_length=11472
FT                   /gap_type="unknown"
FT   assembly_gap    1127664..1132690
FT                   /estimated_length=5027
FT                   /gap_type="unknown"
FT   gene            1238317..1260836
FT                   /gene="C15orf43"
FT                   /locus_tag="hCG_1786516"
FT                   /note="gene_id=hCG1786516.3"
FT   mRNA            join(1238317..1238397,1238511..1238592,1239988..1240127,
FT                   1243138..1243199,1247773..1247858,1255482..1255570,
FT                   1260104..1260836)
FT                   /gene="C15orf43"
FT                   /locus_tag="hCG_1786516"
FT                   /product="chromosome 15 open reading frame 43"
FT                   /note="gene_id=hCG1786516.3 transcript_id=hCT1825554.3;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 07-OCT-2003"
FT   CDS             join(1238334..1238397,1238511..1238592,1239988..1240127,
FT                   1243138..1243199,1247773..1247858,1255482..1255570,
FT                   1260104..1260243)
FT                   /codon_start=1
FT                   /gene="C15orf43"
FT                   /locus_tag="hCG_1786516"
FT                   /product="chromosome 15 open reading frame 43"
FT                   /note="gene_id=hCG1786516.3 transcript_id=hCT1825554.3
FT                   protein_id=hCP1733548.3"
FT                   /protein_id="EAW77283.1"
FT   assembly_gap    1268900..1270871
FT                   /estimated_length=1972
FT                   /gap_type="unknown"
FT   gene            1304205..1356286
FT                   /gene="SORD"
FT                   /locus_tag="hCG_2001996"
FT                   /note="gene_id=hCG2001996.0"
FT   mRNA            join(1304205..1304447,1321493..1321526,1342513..1342672,
FT                   1346718..1346836,1349628..1349693,1350324..1350499,
FT                   1353764..1353885,1354811..1356286)
FT                   /gene="SORD"
FT                   /locus_tag="hCG_2001996"
FT                   /product="sorbitol dehydrogenase, transcript variant
FT                   hCT2286510"
FT                   /note="gene_id=hCG2001996.0 transcript_id=hCT2286510.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/7;
FT                   created on 19-JUN-2003"
FT   CDS             join(1304382..1304447,1321493..1321526,1342513..1342672,
FT                   1346718..1346836,1349628..1349693,1350324..1350499,
FT                   1353764..1353885,1354811..1354976)
FT                   /codon_start=1
FT                   /gene="SORD"
FT                   /locus_tag="hCG_2001996"
FT                   /product="sorbitol dehydrogenase, isoform CRA_a"
FT                   /note="gene_id=hCG2001996.0 transcript_id=hCT2286510.1
FT                   protein_id=hCP1878893.1 isoform=CRA_a"
FT                   /protein_id="EAW77284.1"
FT   mRNA            join(1317373..1317441,1321493..1321526,1342513..1342672,
FT                   1346718..1346836,1349628..1349693,1350324..1350499,
FT                   1353764..1353885,1354811..1356286)
FT                   /gene="SORD"
FT                   /locus_tag="hCG_2001996"
FT                   /product="sorbitol dehydrogenase, transcript variant
FT                   hCT2286508"
FT                   /note="gene_id=hCG2001996.0 transcript_id=hCT2286508.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 19-JUN-2003"
FT   CDS             join(1317439..1317441,1321493..1321526,1342513..1342672,
FT                   1346718..1346836,1349628..1349693,1350324..1350499,
FT                   1353764..1353885,1354811..1354976)
FT                   /codon_start=1
FT                   /gene="SORD"
FT                   /locus_tag="hCG_2001996"
FT                   /product="sorbitol dehydrogenase, isoform CRA_b"
FT                   /note="gene_id=hCG2001996.0 transcript_id=hCT2286508.1
FT                   protein_id=hCP1878895.1 isoform=CRA_b"
FT                   /protein_id="EAW77285.1"
FT                   "
FT   assembly_gap    1324332..1326152
FT                   /estimated_length=1821
FT                   /gap_type="unknown"
FT   gene            1334160..1335072
FT                   /pseudo
FT                   /locus_tag="hCG_1786517"
FT                   /note="gene_id=hCG1786517.2"
FT   mRNA            1334160..1335072
FT                   /pseudo
FT                   /locus_tag="hCG_1786517"
FT                   /note="gene_id=hCG1786517.2 transcript_id=hCT1825555.2;
FT                   overlap evidence=no; created on 17-MAR-2003"
FT   gene            1356459..1358627
FT                   /locus_tag="hCG_2037015"
FT                   /note="gene_id=hCG2037015.0"
FT   mRNA            1356459..1358627
FT                   /locus_tag="hCG_2037015"
FT                   /product="hCG2037015, transcript variant hCT2341396"
FT                   /note="gene_id=hCG2037015.0 transcript_id=hCT2341396.0;
FT                   overlap evidence=yes; created on 17-MAR-2003"
FT   mRNA            join(1356459..1357299,1358062..1358625)
FT                   /locus_tag="hCG_2037015"
FT                   /product="hCG2037015, transcript variant hCT2341397"
FT                   /note="gene_id=hCG2037015.0 transcript_id=hCT2341397.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 17-MAR-2003"
FT   CDS             1356478..1356732
FT                   /codon_start=1
FT                   /locus_tag="hCG_2037015"
FT                   /product="hCG2037015, isoform CRA_a"
FT                   /note="gene_id=hCG2037015.0 transcript_id=hCT2341396.0
FT                   protein_id=hCP1907980.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q2"
FT                   /protein_id="EAW77286.1"
FT   CDS             1356478..1356732
FT                   /codon_start=1
FT                   /locus_tag="hCG_2037015"
FT                   /product="hCG2037015, isoform CRA_a"
FT                   /note="gene_id=hCG2037015.0 transcript_id=hCT2341397.0
FT                   protein_id=hCP1907981.0 isoform=CRA_a"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q2"
FT                   /protein_id="EAW77287.1"
FT   gene            complement(1374094..1395794)
FT                   /gene="DUOX2"
FT                   /locus_tag="hCG_38703"
FT                   /note="gene_id=hCG38703.3"
FT   mRNA            complement(join(1374094..1375716,1376007..1376135,
FT                   1376380..1376535,1376881..1377039,1377272..1377504,
FT                   1378682..1378835,1379058..1379185,1379453..1379502,
FT                   1380827..1380926,1381106..1381336,1381494..1381672,
FT                   1382199..1382282,1382649..1382718,1383237..1383433,
FT                   1385404..1385497,1385584..1385809,1387087..1387272,
FT                   1387569..1387771,1387972..1388085,1388276..1388413,
FT                   1388789..1388907,1389497..1389672,1390239..1390402,
FT                   1390974..1391076,1391340..1391430,1391878..1391974,
FT                   1392100..1392160,1392561..1392727,1392834..1393035,
FT                   1393218..1393405,1394004..1394168,1394437..1394522,
FT                   1394788..1394875,1395423..1395794))
FT                   /gene="DUOX2"
FT                   /locus_tag="hCG_38703"
FT                   /product="dual oxidase 2"
FT                   /note="gene_id=hCG38703.3 transcript_id=hCT29947.3; splice
FT                   donor-acceptor pairs covered / total pairs = 33/33; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(1375594..1375716,1376007..1376135,
FT                   1376380..1376535,1376881..1377039,1377272..1377504,
FT                   1378682..1378835,1379058..1379185,1379453..1379502,
FT                   1380827..1380926,1381106..1381336,1381494..1381672,
FT                   1382199..1382282,1382649..1382718,1383237..1383433,
FT                   1385404..1385497,1385584..1385809,1387087..1387272,
FT                   1387569..1387771,1387972..1388085,1388276..1388413,
FT                   1388789..1388907,1389497..1389672,1390239..1390402,
FT                   1390974..1391076,1391340..1391430,1391878..1391974,
FT                   1392100..1392160,1392561..1392727,1392834..1393035,
FT                   1393218..1393405,1394004..1394168,1394437..1394522,
FT                   1394788..1394861))
FT                   /codon_start=1
FT                   /gene="DUOX2"
FT                   /locus_tag="hCG_38703"
FT                   /product="dual oxidase 2"
FT                   /note="gene_id=hCG38703.3 transcript_id=hCT29947.3
FT                   protein_id=hCP48834.2"
FT                   /protein_id="EAW77288.1"
FT   gene            1395791..1399551
FT                   /gene="LOC405753"
FT                   /locus_tag="hCG_39002"
FT                   /note="gene_id=hCG39002.3"
FT   mRNA            join(1395791..1396202,1396816..1397306,1397574..1397708,
FT                   1397966..1398179,1398541..1398755,1399166..1399551)
FT                   /gene="LOC405753"
FT                   /locus_tag="hCG_39002"
FT                   /product="similar to Numb-interacting homolog gene"
FT                   /note="gene_id=hCG39002.3 transcript_id=hCT30249.3; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 22-AUG-2003"
FT   CDS             join(1396056..1396202,1396816..1397034)
FT                   /codon_start=1
FT                   /gene="LOC405753"
FT                   /locus_tag="hCG_39002"
FT                   /product="similar to Numb-interacting homolog gene"
FT                   /note="gene_id=hCG39002.3 transcript_id=hCT30249.3
FT                   protein_id=hCP48829.4"
FT                   /db_xref="GOA:Q1HG44"
FT                   /db_xref="HGNC:HGNC:32698"
FT                   /db_xref="InterPro:IPR018469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1HG44"
FT                   /protein_id="EAW77289.1"
FT                   VKVVEECQEVGVEGRCC"
FT   gene            complement(1398824..1411328)
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /note="gene_id=hCG2036886.0"
FT   mRNA            complement(join(1398824..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404494,
FT                   1411303..1411328))
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   transcript variant hCT2341186"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341186.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 05-NOV-2003"
FT   mRNA            complement(join(1398824..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404494,
FT                   1410288..1410355,1410469..1410585,1410911..1411066,
FT                   1411303..1411328))
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   transcript variant hCT2341187"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341187.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 05-NOV-2003"
FT   mRNA            complement(join(1398824..1400815,1401553..1401817,
FT                   1402042..1402255,1402537..1402671,1403635..1403692,
FT                   1404319..1404494,1410288..1410355,1410469..1410585,
FT                   1410911..1411066,1411303..1411328))
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   transcript variant hCT2349986"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2349986.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 05-NOV-2003"
FT   mRNA            complement(join(1398824..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404494,
FT                   1410469..1410585,1410683..1410774,1410911..1411066,
FT                   1411303..1411327))
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   transcript variant hCT2349985"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2349985.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 05-NOV-2003"
FT   mRNA            complement(join(1398940..1399259,1399354..1399519,
FT                   1400597..1400815,1401553..1401770,1402042..1402255,
FT                   1402537..1402671,1403635..1403692,1404319..1404494,
FT                   1410469..1410585,1410911..1411066,1411213..1411310))
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   transcript variant hCT2341189"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341189.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 05-NOV-2003"
FT   CDS             complement(join(1398965..1399259,1399354..1399519,
FT                   1400597..1400815,1401553..1401770,1402042..1402255,
FT                   1402537..1402671,1403635..1403692,1404319..1404465))
FT                   /codon_start=1
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341189.0
FT                   protein_id=hCP1907772.0 isoform=CRA_b"
FT                   /db_xref="GOA:A8K9Q6"
FT                   /db_xref="InterPro:IPR018469"
FT                   /db_xref="UniProtKB/TrEMBL:A8K9Q6"
FT                   /protein_id="EAW77291.1"
FT   CDS             complement(join(1400556..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404465))
FT                   /codon_start=1
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341187.1
FT                   protein_id=hCP1907770.1 isoform=CRA_a"
FT                   /db_xref="GOA:B5M0B8"
FT                   /db_xref="InterPro:IPR018469"
FT                   /db_xref="UniProtKB/TrEMBL:B5M0B8"
FT                   /protein_id="EAW77290.1"
FT                   TKAYCKEAHPKDPDCAL"
FT   CDS             complement(join(1400556..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404465))
FT                   /codon_start=1
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2341186.0
FT                   protein_id=hCP1907771.0 isoform=CRA_a"
FT                   /db_xref="GOA:B5M0B8"
FT                   /db_xref="InterPro:IPR018469"
FT                   /db_xref="UniProtKB/TrEMBL:B5M0B8"
FT                   /protein_id="EAW77292.1"
FT                   TKAYCKEAHPKDPDCAL"
FT   CDS             complement(join(1400556..1400815,1401553..1401770,
FT                   1402042..1402255,1403635..1403692,1404319..1404465))
FT                   /codon_start=1
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2349985.0
FT                   protein_id=hCP1915235.0 isoform=CRA_a"
FT                   /db_xref="GOA:B5M0B8"
FT                   /db_xref="InterPro:IPR018469"
FT                   /db_xref="UniProtKB/TrEMBL:B5M0B8"
FT                   /protein_id="EAW77293.1"
FT                   TKAYCKEAHPKDPDCAL"
FT   CDS             complement(join(1400556..1400815,1401553..1401817,
FT                   1402042..1402098))
FT                   /codon_start=1
FT                   /gene="NIP"
FT                   /locus_tag="hCG_2036886"
FT                   /product="homolog of Drosophila Numb-interacting protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG2036886.0 transcript_id=hCT2349986.0
FT                   protein_id=hCP1915236.0 isoform=CRA_c"
FT                   /protein_id="EAW77294.1"
FT   gene            1411443..1447175
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /note="gene_id=hCG1818278.1"
FT   mRNA            join(1411443..1411549,1412922..1413113,1413369..1413475,
FT                   1415316..1415399,1415597..1415761,1416556..1416743,
FT                   1416926..1417127,1417663..1417726,1417845..1417941,
FT                   1419239..1419329,1420385..1420487,1420746..1420918,
FT                   1422214..1422389,1422611..1422729,1423290..1423427,
FT                   1424501..1424614,1425347..1425546,1426206..1426391,
FT                   1428744..1428969,1429215..1429308,1429583..1429758,
FT                   1431943..1432012,1432434..1432559,1433185..1433363,
FT                   1433597..1433827,1434690..1434789,1435246..1435295,
FT                   1437099..1437226,1442133..1442286,1443037..1443269,
FT                   1443518..1443676,1444831..1444986,1445089..1445217,
FT                   1446078..1447175)
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, transcript variant hCT2286454"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT2286454.0;
FT                   splice donor-acceptor pairs covered / total pairs = 29/33;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1411445..1411549,1413417..1413475,1415316..1415399,
FT                   1415597..1415761,1416556..1416743,1416926..1417127,
FT                   1417663..1417726,1417845..1417941,1419239..1419329,
FT                   1420385..1420487,1420746..1420918,1422214..1422389,
FT                   1422611..1422729,1423290..1423427,1424501..1424614,
FT                   1425347..1425546,1426206..1426391,1428744..1428969,
FT                   1429215..1429308,1429583..1429758,1431943..1432012,
FT                   1432434..1432559,1433185..1433363,1433597..1433827,
FT                   1434690..1434789,1435246..1435295,1437099..1437226,
FT                   1442133..1442286,1443037..1443269,1443518..1443676,
FT                   1444831..1444986,1445089..1445217,1446078..1447175)
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, transcript variant hCT1961905"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT1961905.1;
FT                   splice donor-acceptor pairs covered / total pairs = 28/32;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1411445..1411549,1413417..1413475,1415316..1415399,
FT                   1415597..1415761,1416556..1416743,1416926..1417127,
FT                   1417663..1417726,1417845..1417941,1419239..1419329,
FT                   1420385..1420487,1420746..1420918,1422214..1422389,
FT                   1422611..1422729,1423290..1423427,1424501..1424614,
FT                   1425347..1425546,1426206..1426391,1428744..1428969,
FT                   1429215..1429308,1429583..1429758,1431943..1432012,
FT                   1432434..1432559,1433185..1433363,1433597..>1433967)
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, transcript variant hCT2286455"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT2286455.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/23;
FT                   created on 26-AUG-2002"
FT   CDS             join(1416966..1417127,1417663..1417726,1417845..1417941,
FT                   1419239..1419329,1420385..1420487,1420746..1420918,
FT                   1422214..1422389,1422611..1422729,1423290..1423427,
FT                   1424501..1424614,1425347..1425546,1426206..1426391,
FT                   1428744..1428969,1429215..1429308,1429583..1429758,
FT                   1431943..1432012,1432434..1432559,1433185..1433363,
FT                   1433597..1433827,1434690..1434789,1435246..1435295,
FT                   1437099..1437226,1442133..1442286,1443037..1443269,
FT                   1443518..1443676,1444831..1444986,1445089..1445217,
FT                   1446078..1446200)
FT                   /codon_start=1
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, isoform CRA_a"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT1961905.1
FT                   protein_id=hCP1774105.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5R2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR029595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R2"
FT                   /protein_id="EAW77295.1"
FT   CDS             join(1416966..1417127,1417663..1417726,1417845..1417941,
FT                   1419239..1419329,1420385..1420487,1420746..1420918,
FT                   1422214..1422389,1422611..1422729,1423290..1423427,
FT                   1424501..1424614,1425347..1425546,1426206..1426391,
FT                   1428744..1428969,1429215..1429308,1429583..1429758,
FT                   1431943..1432012,1432434..1432559,1433185..1433363,
FT                   1433597..1433827,1434690..1434789,1435246..1435295,
FT                   1437099..1437226,1442133..1442286,1443037..1443269,
FT                   1443518..1443676,1444831..1444986,1445089..1445217,
FT                   1446078..1446200)
FT                   /codon_start=1
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, isoform CRA_a"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT2286454.0
FT                   protein_id=hCP1878911.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5R2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR029595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R2"
FT                   /protein_id="EAW77296.1"
FT   CDS             join(1416966..1417127,1417663..1417726,1417845..1417941,
FT                   1419239..1419329,1420385..1420487,1420746..1420918,
FT                   1422214..1422389,1422611..1422729,1423290..1423427,
FT                   1424501..1424614,1425347..1425546,1426206..1426391,
FT                   1428744..1428969,1429215..1429308,1429583..1429758,
FT                   1431943..1432012,1432434..1432559,1433185..1433363,
FT                   1433597..>1433967)
FT                   /codon_start=1
FT                   /gene="DUOX1"
FT                   /locus_tag="hCG_1818278"
FT                   /product="dual oxidase 1, isoform CRA_b"
FT                   /note="gene_id=hCG1818278.1 transcript_id=hCT2286455.0
FT                   protein_id=hCP1878913.0 isoform=CRA_b"
FT                   /protein_id="EAW77297.1"
FT   assembly_gap    1417137..1417481
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   gene            complement(1448513..1469238)
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /note="gene_id=hCG38999.2"
FT   mRNA            complement(join(1448513..1449431,1453181..1453300,
FT                   1453445..1453616,1456517..1456723,1459461..1459602,
FT                   1468750..1468800,1469209..1469238))
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, transcript
FT                   variant hCT2286884"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2286884.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1448513..1449431,1453181..1453300,
FT                   1453445..1453616,1456517..1456723,1459461..1459602,
FT                   1468750..1469009))
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, transcript
FT                   variant hCT30246"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT30246.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   gene            1448618..1469836
FT                   /locus_tag="hCG_1786518"
FT                   /note="gene_id=hCG1786518.1"
FT   mRNA            join(1448618..1448846,1467609..1467754,1469411..1469836)
FT                   /locus_tag="hCG_1786518"
FT                   /product="hCG1786518"
FT                   /note="gene_id=hCG1786518.1 transcript_id=hCT1825556.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1449245..1449431,1453181..1453300,
FT                   1453445..1453616,1456517..1456723,1459461..1459494))
FT                   /codon_start=1
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT30246.2
FT                   protein_id=hCP48830.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="UniProtKB/TrEMBL:B4DWP8"
FT                   /protein_id="EAW77298.1"
FT                   KGAEHMSLLYPVAIRTL"
FT   CDS             complement(join(1449245..1449431,1453181..1453300,
FT                   1453445..1453616,1456517..1456723,1459461..1459494))
FT                   /codon_start=1
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2286884.0
FT                   protein_id=hCP1878872.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="UniProtKB/TrEMBL:B4DWP8"
FT                   /protein_id="EAW77301.1"
FT                   KGAEHMSLLYPVAIRTL"
FT   mRNA            complement(join(1449340..1449431,1456517..1456723,
FT                   1459461..1459602,1468750..1468939))
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, transcript
FT                   variant hCT2355681"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2355681.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(1449406..1449431,1456517..1456723,
FT                   1459461..1459494))
FT                   /codon_start=1
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2355681.0
FT                   protein_id=hCP1920945.0 isoform=CRA_c"
FT                   /protein_id="EAW77300.1"
FT   mRNA            complement(join(1451964..1453300,1453447..1453616,
FT                   1454874..1455014,1456517..1456723,1459461..1459602,
FT                   1468750..1468984))
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, transcript
FT                   variant hCT2355680"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2355680.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(1453214..1453300,1453447..1453616,
FT                   1454874..1455014,1456517..1456723,1459461..1459494))
FT                   /codon_start=1
FT                   /gene="SHF"
FT                   /locus_tag="hCG_38999"
FT                   /product="Src homology 2 domain containing F, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG38999.2 transcript_id=hCT2355680.0
FT                   protein_id=hCP1920944.0 isoform=CRA_b"
FT                   /db_xref="UniProtKB/TrEMBL:Q8N9I8"
FT                   /protein_id="EAW77299.1"
FT   CDS             join(1467702..1467754,1469411..1469747)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786518"
FT                   /product="hCG1786518"
FT                   /note="gene_id=hCG1786518.1 transcript_id=hCT1825556.1
FT                   protein_id=hCP1733651.1"
FT                   /protein_id="EAW77302.1"
FT   gene            1533537..1559455
FT                   /gene="SLC28A2"
FT                   /locus_tag="hCG_39000"
FT                   /note="gene_id=hCG39000.3"
FT   mRNA            join(1533537..1533580,1534501..1534597,1534733..1534821,
FT                   1543318..1543409,1544364..1544547,1545184..1545325,
FT                   1545958..1546071,1546392..1546469,1546886..1546966,
FT                   1547384..1547464,1548758..1548883,1548969..1549099,
FT                   1549513..1549681,1550641..1550838,1551498..1551579,
FT                   1553598..1553696,1553976..1554087,1556699..1556957,
FT                   1559310..1559455)
FT                   /gene="SLC28A2"
FT                   /locus_tag="hCG_39000"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 2, transcript variant
FT                   hCT2286463"
FT                   /note="gene_id=hCG39000.3 transcript_id=hCT2286463.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1533537..1533580,1534501..1534597,1534733..1534821,
FT                   1543318..1543409,1544364..1544547,1545184..1545325,
FT                   1545958..1546071,1546392..1546469,1546886..1546966,
FT                   1547384..1547464,1548758..1548883,1548969..1549099,
FT                   1549513..1549681,1550641..1550838,1551498..1551579,
FT                   1553598..1553696,1553976..1554087,1556699..1557238)
FT                   /gene="SLC28A2"
FT                   /locus_tag="hCG_39000"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 2, transcript variant
FT                   hCT30247"
FT                   /note="gene_id=hCG39000.3 transcript_id=hCT30247.3; splice
FT                   donor-acceptor pairs covered / total pairs = 17/17; created
FT                   on 26-AUG-2002"
FT   CDS             join(1534517..1534597,1534733..1534821,1543318..1543409,
FT                   1544364..1544547,1545184..1545325,1545958..1546071,
FT                   1546392..1546469,1546886..1546966,1547384..1547464,
FT                   1548758..1548883,1548969..1549099,1549513..1549681,
FT                   1550641..1550838,1551498..1551579,1553598..1553696,
FT                   1553976..1554087,1556699..1556816)
FT                   /codon_start=1
FT                   /gene="SLC28A2"
FT                   /locus_tag="hCG_39000"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=hCG39000.3 transcript_id=hCT30247.3
FT                   protein_id=hCP48831.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q2M2A7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="InterPro:IPR030212"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M2A7"
FT                   /protein_id="EAW77303.1"
FT   CDS             join(1534517..1534597,1534733..1534821,1543318..1543409,
FT                   1544364..1544547,1545184..1545325,1545958..1546071,
FT                   1546392..1546469,1546886..1546966,1547384..1547464,
FT                   1548758..1548883,1548969..1549099,1549513..1549681,
FT                   1550641..1550838,1551498..1551579,1553598..1553696,
FT                   1553976..1554087,1556699..1556816)
FT                   /codon_start=1
FT                   /gene="SLC28A2"
FT                   /locus_tag="hCG_39000"
FT                   /product="solute carrier family 28 (sodium-coupled
FT                   nucleoside transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=hCG39000.3 transcript_id=hCT2286463.0
FT                   protein_id=hCP1878891.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q2M2A7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="InterPro:IPR030212"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M2A7"
FT                   /protein_id="EAW77304.1"
FT   gene            complement(<1602566..>1602835)
FT                   /locus_tag="hCG_1793639"
FT                   /note="gene_id=hCG1793639.1"
FT   mRNA            complement(<1602566..>1602835)
FT                   /locus_tag="hCG_1793639"
FT                   /product="hCG1793639"
FT                   /note="gene_id=hCG1793639.1 transcript_id=hCT1832899.1;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             complement(<1602566..1602835)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1793639"
FT                   /product="hCG1793639"
FT                   /note="gene_id=hCG1793639.1 transcript_id=hCT1832899.1
FT                   protein_id=hCP1733474.1"
FT                   /protein_id="EAW77305.1"
FT   gene            complement(1642550..1660217)
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /note="gene_id=hCG38743.3"
FT   mRNA            complement(join(1642550..1643649,1645328..1645444,
FT                   1646233..1646296,1647482..1647646,1647807..1647944,
FT                   1649506..1649696,1650762..1650957,1658037..1658255,
FT                   1659821..1660217))
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), transcript variant hCT29988"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT29988.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(1642552..1642979,1643217..1643649,
FT                   1645328..1645444,1646233..1646296,1647482..1647646,
FT                   1647807..1647944,1649506..1649696,1650762..1650957,
FT                   1658037..1658255,1659821..1660217))
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), transcript variant hCT2286878"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT2286878.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1642552..1643649,1645328..1645444,
FT                   1646233..1646296,1647482..1647646,1647807..1647944,
FT                   1649506..1649696,1650762..1650957,1658037..1659980))
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), transcript variant hCT2355687"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT2355687.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(1643537..1643649,1645328..1645444,
FT                   1646233..1646296,1647482..1647646,1647807..1647944,
FT                   1649506..1649696,1650762..1650957,1658037..1658255,
FT                   1659821..1660048))
FT                   /codon_start=1
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), isoform CRA_a"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT2286878.0
FT                   protein_id=hCP1878878.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5Q4"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q4"
FT                   /protein_id="EAW77306.1"
FT                   HCWTCDVRRRGTLQSYLD"
FT   CDS             complement(join(1643537..1643649,1645328..1645444,
FT                   1646233..1646296,1647482..1647646,1647807..1647944,
FT                   1649506..1649696,1650762..1650957,1658037..1658255,
FT                   1659821..1660048))
FT                   /codon_start=1
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), isoform CRA_a"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT29988.3
FT                   protein_id=hCP49513.3 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5Q4"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q4"
FT                   /protein_id="EAW77307.1"
FT                   HCWTCDVRRRGTLQSYLD"
FT   CDS             complement(join(1643537..1643649,1645328..1645444,
FT                   1646233..1646296,1647482..1647646,1647807..1647944,
FT                   1649506..1649696,1650762..1650858))
FT                   /codon_start=1
FT                   /gene="GATM"
FT                   /locus_tag="hCG_38743"
FT                   /product="glycine amidinotransferase (L-arginine:glycine
FT                   amidinotransferase), isoform CRA_b"
FT                   /note="gene_id=hCG38743.3 transcript_id=hCT2355687.0
FT                   protein_id=hCP1920942.0 isoform=CRA_b"
FT                   /protein_id="EAW77308.1"
FT                   DVRRRGTLQSYLD"
FT   gene            <1660318..1661014
FT                   /locus_tag="hCG_2001976"
FT                   /note="gene_id=hCG2001976.0"
FT   mRNA            <1660318..1661014
FT                   /locus_tag="hCG_2001976"
FT                   /product="hCG2001976"
FT                   /note="gene_id=hCG2001976.0 transcript_id=hCT2286467.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             1660318..1660659
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001976"
FT                   /product="hCG2001976"
FT                   /note="gene_id=hCG2001976.0 transcript_id=hCT2286467.0
FT                   protein_id=hCP1878892.0"
FT                   /protein_id="EAW77309.1"
FT                   QFRSFHFMF"
FT   gene            1683773..1702850
FT                   /gene="SPATA5L1"
FT                   /locus_tag="hCG_39722"
FT                   /note="gene_id=hCG39722.3"
FT   mRNA            join(1683773..1684954,1686754..1686939,1691805..1691963,
FT                   1696004..1696213,1697020..1697242,1698702..1698832,
FT                   1699990..1700115,1702474..1702850)
FT                   /gene="SPATA5L1"
FT                   /locus_tag="hCG_39722"
FT                   /product="spermatogenesis associated 5-like 1, transcript
FT                   variant hCT2286471"
FT                   /note="gene_id=hCG39722.3 transcript_id=hCT2286471.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1683773..1684954,1686754..1686939,1691805..1691963,
FT                   1696004..1696213,1697020..1697212,1698702..1698832,
FT                   1699990..1700115,1702474..1702850)
FT                   /gene="SPATA5L1"
FT                   /locus_tag="hCG_39722"
FT                   /product="spermatogenesis associated 5-like 1, transcript
FT                   variant hCT30974"
FT                   /note="gene_id=hCG39722.3 transcript_id=hCT30974.3; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   CDS             join(1683866..1684954,1686754..1686939,1691805..1691963,
FT                   1696004..1696213,1697020..1697212,1698702..1698832,
FT                   1699990..1700115,1702474..1702641)
FT                   /codon_start=1
FT                   /gene="SPATA5L1"
FT                   /locus_tag="hCG_39722"
FT                   /product="spermatogenesis associated 5-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG39722.3 transcript_id=hCT30974.3
FT                   protein_id=hCP49510.2 isoform=CRA_b"
FT                   /protein_id="EAW77311.1"
FT                   "
FT   CDS             join(1683866..1684954,1686754..1686939,1691805..1691963,
FT                   1696004..1696213,1697020..1697238)
FT                   /codon_start=1
FT                   /gene="SPATA5L1"
FT                   /locus_tag="hCG_39722"
FT                   /product="spermatogenesis associated 5-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG39722.3 transcript_id=hCT2286471.0
FT                   protein_id=hCP1878898.0 isoform=CRA_a"
FT                   /protein_id="EAW77310.1"
FT   gene            1711999..1715294
FT                   /gene="C15orf48"
FT                   /locus_tag="hCG_1818250"
FT                   /note="gene_id=hCG1818250.3"
FT   mRNA            join(1711999..1712089,1712204..1712266,1712435..1712520,
FT                   1713506..1713566,1714382..1714881)
FT                   /gene="C15orf48"
FT                   /locus_tag="hCG_1818250"
FT                   /product="chromosome 15 open reading frame 48, transcript
FT                   variant hCT2355725"
FT                   /note="gene_id=hCG1818250.3 transcript_id=hCT2355725.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 14-JUL-2004"
FT   mRNA            join(1712041..1712266,1712435..1712520,1713506..1713566,
FT                   1714382..1715294)
FT                   /gene="C15orf48"
FT                   /locus_tag="hCG_1818250"
FT                   /product="chromosome 15 open reading frame 48, transcript
FT                   variant hCT1961347"
FT                   /note="gene_id=hCG1818250.3 transcript_id=hCT1961347.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(1712231..1712266,1712435..1712520,1713506..1713566,
FT                   1714382..1714450)
FT                   /codon_start=1
FT                   /gene="C15orf48"
FT                   /locus_tag="hCG_1818250"
FT                   /product="chromosome 15 open reading frame 48, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1818250.3 transcript_id=hCT1961347.2
FT                   protein_id=hCP1774107.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5U4"
FT                   /db_xref="InterPro:IPR010530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U4"
FT                   /protein_id="EAW77312.1"
FT   CDS             join(1712231..1712266,1712435..1712520,1713506..1713566,
FT                   1714382..1714450)
FT                   /codon_start=1
FT                   /gene="C15orf48"
FT                   /locus_tag="hCG_1818250"
FT                   /product="chromosome 15 open reading frame 48, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1818250.3 transcript_id=hCT2355725.0
FT                   protein_id=hCP1920922.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5U4"
FT                   /db_xref="InterPro:IPR010530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U4"
FT                   /protein_id="EAW77313.1"
FT   gene            1729864..>1742822
FT                   /locus_tag="hCG_2001981"
FT                   /note="gene_id=hCG2001981.0"
FT   mRNA            join(1729864..1730232,1742711..>1742822)
FT                   /locus_tag="hCG_2001981"
FT                   /product="hCG2001981"
FT                   /note="gene_id=hCG2001981.0 transcript_id=hCT2286475.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(1730030..1730232,1742711..>1742822)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001981"
FT                   /product="hCG2001981"
FT                   /note="gene_id=hCG2001981.0 transcript_id=hCT2286475.0
FT                   protein_id=hCP1878899.0"
FT                   /protein_id="EAW77314.1"
FT                   D"
FT   gene            1731549..1794936
FT                   /gene="C15orf21"
FT                   /locus_tag="hCG_2001983"
FT                   /note="gene_id=hCG2001983.0"
FT   mRNA            join(1731549..1731721,1757255..1757485,1757578..1757728,
FT                   1793542..1793618,1794867..1794936)
FT                   /gene="C15orf21"
FT                   /locus_tag="hCG_2001983"
FT                   /product="chromosome 15 open reading frame 21"
FT                   /note="gene_id=hCG2001983.0 transcript_id=hCT2286478.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 29-APR-2003"
FT   CDS             join(1731708..1731721,1757255..1757429)
FT                   /codon_start=1
FT                   /gene="C15orf21"
FT                   /locus_tag="hCG_2001983"
FT                   /product="chromosome 15 open reading frame 21"
FT                   /note="gene_id=hCG2001983.0 transcript_id=hCT2286478.0
FT                   protein_id=hCP1878920.0"
FT                   /protein_id="EAW77315.1"
FT                   WLIFCRDGVLPCCPGWS"
FT   assembly_gap    1742867..1745736
FT                   /estimated_length=2870
FT                   /gap_type="unknown"
FT   gene            complement(1765126..1803978)
FT                   /gene="SLC30A4"
FT                   /locus_tag="hCG_39723"
FT                   /note="gene_id=hCG39723.2"
FT   mRNA            complement(join(1765126..1766491,1767785..1767919,
FT                   1768701..1768806,1770013..1770214,1771900..1772053,
FT                   1792307..1792453,1803133..1803515,1803612..1803637,
FT                   1803776..1803978))
FT                   /gene="SLC30A4"
FT                   /locus_tag="hCG_39723"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 4, transcript variant hCT2286864"
FT                   /note="gene_id=hCG39723.2 transcript_id=hCT2286864.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1765126..1766491,1767785..1767919,
FT                   1768701..1768806,1770013..1770214,1771900..1772053,
FT                   1792307..1792453,1803133..1803637,1803776..1803978))
FT                   /gene="SLC30A4"
FT                   /locus_tag="hCG_39723"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 4, transcript variant hCT2286863"
FT                   /note="gene_id=hCG39723.2 transcript_id=hCT2286863.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1766337..1766491,1767785..1767919,
FT                   1768701..1768806,1770013..1770214,1771900..1772053,
FT                   1792307..1792453,1803133..1803515,1803612..1803637,
FT                   1803776..1803805))
FT                   /codon_start=1
FT                   /gene="SLC30A4"
FT                   /locus_tag="hCG_39723"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 4, isoform CRA_b"
FT                   /note="gene_id=hCG39723.2 transcript_id=hCT2286864.0
FT                   protein_id=hCP1878884.0 isoform=CRA_b"
FT                   /protein_id="EAW77317.1"
FT   CDS             complement(join(1766337..1766491,1767785..1767919,
FT                   1768701..1768806,1770013..1770214,1771900..1772053,
FT                   1792307..1792453,1803133..1803523))
FT                   /codon_start=1
FT                   /gene="SLC30A4"
FT                   /locus_tag="hCG_39723"
FT                   /product="solute carrier family 30 (zinc transporter),
FT                   member 4, isoform CRA_a"
FT                   /note="gene_id=hCG39723.2 transcript_id=hCT2286863.0
FT                   protein_id=hCP1878886.0 isoform=CRA_a"
FT                   /db_xref="GOA:O14863"
FT                   /db_xref="HGNC:HGNC:11015"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14863"
FT                   /protein_id="EAW77316.1"
FT   gene            <1817280..>1837065
FT                   /locus_tag="hCG_2001985"
FT                   /note="gene_id=hCG2001985.0"
FT   mRNA            join(<1817280..1817378,1836940..>1837065)
FT                   /locus_tag="hCG_2001985"
FT                   /product="hCG2001985"
FT                   /note="gene_id=hCG2001985.0 transcript_id=hCT2286481.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(1817280..1817378,1836940..>1837065)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001985"
FT                   /product="hCG2001985"
FT                   /note="gene_id=hCG2001985.0 transcript_id=hCT2286481.0
FT                   protein_id=hCP1878921.0"
FT                   /protein_id="EAW77318.1"
FT   gene            1868381..1972482
FT                   /locus_tag="hCG_2001986"
FT                   /note="gene_id=hCG2001986.1"
FT   mRNA            join(1868381..1868687,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970407,
FT                   1972164..1972482)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286486"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286486.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 29-APR-2003"
FT   mRNA            join(1868381..1868687,1873297..1873438,1884267..1884350,
FT                   1886591..1886677,1896851..1896887)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286484"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286484.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 29-APR-2003"
FT   mRNA            join(1868381..1868687,1873297..1873438,1884263..1884350,
FT                   1886591..1886677,1887558..1889208)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286490"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286490.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 29-APR-2003"
FT   mRNA            join(1868381..1868687,1873297..1873438,1886591..1886677,
FT                   1887558..1888933)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286483"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286483.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 29-APR-2003"
FT   mRNA            join(1868381..1868687,1883520..1883538,1884263..1884350,
FT                   1886591..1886677,1887558..1888284)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344034"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344034.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 29-APR-2003"
FT   mRNA            join(1868517..1868687,1873297..1873438,1879042..1880724)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344039"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344039.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 29-APR-2003"
FT   CDS             join(1868606..1868687,1873297..1873438,1884263..1884350,
FT                   1886591..1886677,1887558..1887677)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_h"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286490.1
FT                   protein_id=hCP1878907.0 isoform=CRA_h"
FT                   /protein_id="EAW77330.1"
FT                   LTARPAKRM"
FT   CDS             join(1868606..1868687,1883520..1883538,1884263..1884350,
FT                   1886591..1886677,1887558..1887677)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_c"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344034.0
FT                   protein_id=hCP1909331.0 isoform=CRA_c"
FT                   /db_xref="HGNC:HGNC:8549"
FT                   /db_xref="InterPro:IPR017242"
FT                   /db_xref="InterPro:IPR028119"
FT                   /db_xref="UniProtKB/TrEMBL:H3BR42"
FT                   /protein_id="EAW77322.1"
FT   CDS             join(1868606..1868687,1873297..1873438,1886591..1886627)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_g"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286483.1
FT                   protein_id=hCP1878901.1 isoform=CRA_g"
FT                   /db_xref="HGNC:HGNC:8549"
FT                   /db_xref="InterPro:IPR017242"
FT                   /db_xref="UniProtKB/TrEMBL:H3BN13"
FT                   /protein_id="EAW77329.1"
FT   CDS             join(1868606..1868687,1873297..1873438,1884267..1884285)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_f"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286484.1
FT                   protein_id=hCP1878904.1 isoform=CRA_f"
FT                   /protein_id="EAW77327.1"
FT   CDS             join(1868606..1868687,1873297..1873438,1879042..1879075)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_e"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344039.0
FT                   protein_id=hCP1909334.0 isoform=CRA_e"
FT                   /db_xref="HGNC:HGNC:8549"
FT                   /db_xref="InterPro:IPR017242"
FT                   /db_xref="UniProtKB/TrEMBL:H3BU57"
FT                   /protein_id="EAW77325.1"
FT   mRNA            join(1912337..1912394,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970407,
FT                   1972164..1972415)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344037"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344037.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/9;
FT                   created on 29-APR-2003"
FT   mRNA            join(1915970..1916082,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1953211..1953342,1954799..1954993,
FT                   1957293..1957502,1963670..1963853,1969527..1969594,
FT                   1970229..1970407,1972164..1972482)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286485"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286485.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/10;
FT                   created on 29-APR-2003"
FT   mRNA            join(1915988..1916082,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1955208)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344035"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344035.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 29-APR-2003"
FT   mRNA            join(1916204..1916296,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970407,
FT                   1972164..1972482)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286482"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286482.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 29-APR-2003"
FT   mRNA            join(1916240..1916296,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970604)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344036"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344036.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 29-APR-2003"
FT   mRNA            join(1916249..1916296,1917201..1917336,1940099..1940349,
FT                   1943147..1943317,1951120..1951173,1954799..1954993,
FT                   1957293..1957502,1963670..1963853,1969527..1969594,
FT                   1970229..1970407,1972164..1972471)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2286488"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286488.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 29-APR-2003"
FT   mRNA            join(1927084..1927196,1940099..1940349,1943147..1943317,
FT                   1951120..1951173,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970407,
FT                   1972164..1972415)
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, transcript variant hCT2344038"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344038.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 29-APR-2003"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1953211..1953342,1954799..1954993,1957293..1957502,
FT                   1963670..1963853,1969527..1969594,1970229..1970407,
FT                   1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_b"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286485.1
FT                   protein_id=hCP1878903.1 isoform=CRA_b"
FT                   /protein_id="EAW77320.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970407,1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_a"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286482.0
FT                   protein_id=hCP1878902.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5X2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X2"
FT                   /protein_id="EAW77319.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970407,1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_a"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286488.1
FT                   protein_id=hCP1878908.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5X2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X2"
FT                   /protein_id="EAW77321.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970407,1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_a"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344038.0
FT                   protein_id=hCP1909333.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5X2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X2"
FT                   /protein_id="EAW77324.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970407,1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_a"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2286486.1
FT                   protein_id=hCP1878906.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5X2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X2"
FT                   /protein_id="EAW77326.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970407,1972164..1972221)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_a"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344037.0
FT                   protein_id=hCP1909332.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5X2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X2"
FT                   /protein_id="EAW77328.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1954993,1957293..1957502,1963670..1963853,
FT                   1969527..1969594,1970229..1970411)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_d"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344036.0
FT                   protein_id=hCP1909335.0 isoform=CRA_d"
FT                   /protein_id="EAW77323.1"
FT   CDS             join(1940116..1940349,1943147..1943317,1951120..1951173,
FT                   1954799..1955041)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001986"
FT                   /product="hCG2001986, isoform CRA_i"
FT                   /note="gene_id=hCG2001986.1 transcript_id=hCT2344035.0
FT                   protein_id=hCP1909336.0 isoform=CRA_i"
FT                   /protein_id="EAW77331.1"
FT                   SGDRDEQGGQC"
FT   assembly_gap    1977990..1980690
FT                   /estimated_length=2701
FT                   /gap_type="unknown"
FT   assembly_gap    3450252..3452366
FT                   /estimated_length=2115
FT                   /gap_type="unknown"
FT   gene            4000943..4056710
FT                   /gene="SEMA6D"
FT                   /locus_tag="hCG_40073"
FT                   /note="gene_id=hCG40073.3"
FT   mRNA            join(4000943..4001327,4042216..4042378,4042780..4042891,
FT                   4043454..4043514,4043634..4043696,4043806..4043907,
FT                   4044137..4044227,4044676..4044795,4045492..4045584,
FT                   4046326..4046543,4046650..4046781,4047114..4047269,
FT                   4047359..4047532,4048345..4048485,4048581..4048658,
FT                   4049052..4049152,4052972..4056710)
FT                   /gene="SEMA6D"
FT                   /locus_tag="hCG_40073"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6D, transcript variant
FT                   hCT31326"
FT                   /note="gene_id=hCG40073.3 transcript_id=hCT31326.3; splice
FT                   donor-acceptor pairs covered / total pairs = 15/16; created
FT                   on 26-AUG-2002"
FT   mRNA            join(4000943..4001327,4042216..4042378,4042780..4042891,
FT                   4043454..4043514,4043634..4043696,4043806..4043907,
FT                   4044137..4044227,4044676..4044795,4045492..4045580,
FT                   4046326..4046543,4046650..4046781,4047114..4047269,
FT                   4047359..4047956)
FT                   /gene="SEMA6D"
FT                   /locus_tag="hCG_40073"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6D, transcript variant
FT                   hCT2285930"
FT                   /note="gene_id=hCG40073.3 transcript_id=hCT2285930.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   gene            complement(4012536..4013429)
FT                   /pseudo
FT                   /locus_tag="hCG_2001684"
FT                   /note="gene_id=hCG2001684.0"
FT   mRNA            complement(4012536..4013429)
FT                   /pseudo
FT                   /locus_tag="hCG_2001684"
FT                   /note="gene_id=hCG2001684.0 transcript_id=hCT2285963.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             join(4042270..4042378,4042780..4042891,4043454..4043514,
FT                   4043634..4043696,4043806..4043907,4044137..4044227,
FT                   4044676..4044795,4045492..4045580,4046326..4046543,
FT                   4046650..4046781,4047114..4047269,4047359..4047536)
FT                   /codon_start=1
FT                   /gene="SEMA6D"
FT                   /locus_tag="hCG_40073"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6D, isoform CRA_a"
FT                   /note="gene_id=hCG40073.3 transcript_id=hCT2285930.0
FT                   protein_id=hCP1879489.0 isoform=CRA_a"
FT                   /protein_id="EAW77332.1"
FT                   SLNDSVLLEEIEAYNHAK"
FT   CDS             join(4046365..4046543,4046650..4046781,4047114..4047269,
FT                   4047359..4047532,4048345..4048485,4048581..4048658,
FT                   4049052..4049152,4052972..4054260)
FT                   /codon_start=1
FT                   /gene="SEMA6D"
FT                   /locus_tag="hCG_40073"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6D, isoform CRA_b"
FT                   /note="gene_id=hCG40073.3 transcript_id=hCT31326.3
FT                   protein_id=hCP49851.3 isoform=CRA_b"
FT                   /protein_id="EAW77333.1"
FT   gene            complement(4102104..4127452)
FT                   /locus_tag="hCG_2045342"
FT                   /note="gene_id=hCG2045342.0"
FT   mRNA            complement(join(4102104..4102403,4102594..4102633,
FT                   4110058..4110103,4127334..4127452))
FT                   /locus_tag="hCG_2045342"
FT                   /product="hCG2045342"
FT                   /note="gene_id=hCG2045342.0 transcript_id=hCT2360177.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             complement(4102112..4102210)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045342"
FT                   /product="hCG2045342"
FT                   /note="gene_id=hCG2045342.0 transcript_id=hCT2360177.0
FT                   protein_id=hCP1925418.0"
FT                   /protein_id="EAW77334.1"
FT                   /translation="MHRMESFCLIFLPPAFRFSKCFIKASANKLWH"
FT   gene            4403605..4425426
FT                   /gene="SLC24A5"
FT                   /locus_tag="hCG_40075"
FT                   /note="gene_id=hCG40075.2"
FT   mRNA            join(4403605..4403710,4404402..4404581,4416792..4416875,
FT                   4416969..4417072,4417418..4417518,4419217..4419497,
FT                   4421503..4421709,4423647..4423748,4424563..4425426)
FT                   /gene="SLC24A5"
FT                   /locus_tag="hCG_40075"
FT                   /product="solute carrier family 24, member 5"
FT                   /note="gene_id=hCG40075.2 transcript_id=hCT31328.2; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             join(4404515..4404581,4416792..4416875,4416969..4417072,
FT                   4417418..4417518,4419217..4419497,4421503..4421709,
FT                   4423647..4423748,4424563..4424885)
FT                   /codon_start=1
FT                   /gene="SLC24A5"
FT                   /locus_tag="hCG_40075"
FT                   /product="solute carrier family 24, member 5"
FT                   /note="gene_id=hCG40075.2 transcript_id=hCT31328.2
FT                   protein_id=hCP49853.2"
FT                   /protein_id="EAW77335.1"
FT   gene            complement(4417165..4419241)
FT                   /locus_tag="hCG_1820886"
FT                   /note="gene_id=hCG1820886.1"
FT   mRNA            complement(4417165..4419241)
FT                   /locus_tag="hCG_1820886"
FT                   /product="hCG1820886"
FT                   /note="gene_id=hCG1820886.1 transcript_id=hCT1971350.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(4417744..4417965)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820886"
FT                   /product="hCG1820886"
FT                   /note="gene_id=hCG1820886.1 transcript_id=hCT1971350.1
FT                   protein_id=hCP1783688.0"
FT                   /protein_id="EAW77336.1"
FT   gene            complement(4422764..4460881)
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /note="gene_id=hCG40072.6"
FT   mRNA            complement(join(4422764..4425605,4431566..4431617,
FT                   4431697..4431905,4434007..4434105,4434408..4434476,
FT                   4434768..4434818,4436326..4436427,4440526..4440589,
FT                   4440708..4440757,4441302..4441455,4442146..4442337,
FT                   4448463..4448556,4448651..4448658,4449879..4449931,
FT                   4451161..4451369,4460605..4460851))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT2287011"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2287011.1;
FT                   splice donor-acceptor pairs covered / total pairs = 13/15;
FT                   created on 07-OCT-2003"
FT   mRNA            complement(join(4422764..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448556,4449870..4449931,
FT                   4451161..4451369,4460605..4460827))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT2355726"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2355726.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(4424065..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448556,4448651..4448658,
FT                   4449879..4449931,4451161..4451369,4460605..4460851))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT1971237"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT1971237.1;
FT                   splice donor-acceptor pairs covered / total pairs = 14/16;
FT                   created on 07-OCT-2003"
FT   mRNA            complement(join(4424065..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448556,4449866..4449931,
FT                   4451161..4451369,4460613..4460837))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT31325"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT31325.4; splice
FT                   donor-acceptor pairs covered / total pairs = 13/15; created
FT                   on 07-OCT-2003"
FT   mRNA            complement(join(4424065..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448556,4449870..4449931,
FT                   4451161..4451376,4460613..4460672))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT2287005"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2287005.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 07-OCT-2003"
FT   mRNA            complement(join(4424744..4425605,4431566..4431617,
FT                   4431697..4431905,4434007..4434105,4434408..4434476,
FT                   4434768..4434818,4436326..4436427,4440526..4440589,
FT                   4440708..4440757,4441302..4441455,4442146..4442337,
FT                   4448463..4448556,4449870..4449931,4451161..4451369,
FT                   4460605..4460881))
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, transcript variant
FT                   hCT2355727"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2355727.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4434007..4434105,4434408..4434476,
FT                   4434768..4434818,4436326..4436427,4440526..4440589,
FT                   4440708..4440757,4441302..4441455,4442146..4442337,
FT                   4448463..4448556,4448651..4448658,4449879..4449931,
FT                   4451161..4451369,4460605..4460765))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_b"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2287011.1
FT                   protein_id=hCP1879501.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0A0MQW0"
FT                   /db_xref="HGNC:HGNC:17940"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A0MQW0"
FT                   /protein_id="EAW77338.1"
FT                   "
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448556,4448651..4448658,
FT                   4449879..4449931,4451161..4451369,4460605..4460765))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_a"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT1971237.1
FT                   protein_id=hCP1783302.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0A0MR39"
FT                   /db_xref="HGNC:HGNC:17940"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A0MR39"
FT                   /protein_id="EAW77337.1"
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4434007..4434105,4434408..4434476,
FT                   4434768..4434818,4436326..4436427,4440526..4440589,
FT                   4440708..4440757,4441302..4441455,4442146..4442337,
FT                   4448463..4448507))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_d"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2355727.0
FT                   protein_id=hCP1920953.0 isoform=CRA_d"
FT                   /protein_id="EAW77341.1"
FT                   GIKISGREIDVRLDRNA"
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448507))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_c"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2355726.0
FT                   protein_id=hCP1920952.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5Q6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q6"
FT                   /protein_id="EAW77339.1"
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448507))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_c"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT31325.4
FT                   protein_id=hCP49855.3 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5Q6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q6"
FT                   /protein_id="EAW77340.1"
FT   CDS             complement(join(4425442..4425605,4431566..4431617,
FT                   4431697..4431905,4433634..4433705,4434007..4434105,
FT                   4434408..4434476,4434768..4434818,4436326..4436427,
FT                   4440526..4440589,4440708..4440757,4441302..4441455,
FT                   4442146..4442337,4448463..4448507))
FT                   /codon_start=1
FT                   /gene="MYEF2"
FT                   /locus_tag="hCG_40072"
FT                   /product="myelin expression factor 2, isoform CRA_c"
FT                   /note="gene_id=hCG40072.6 transcript_id=hCT2287005.0
FT                   protein_id=hCP1879498.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5Q6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Q6"
FT                   /protein_id="EAW77342.1"
FT   assembly_gap    4444367..4444431
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(4474717..4484020)
FT                   /locus_tag="hCG_2045345"
FT                   /note="gene_id=hCG2045345.0"
FT   mRNA            complement(join(4474717..4474966,4483761..4484020))
FT                   /locus_tag="hCG_2045345"
FT                   /product="hCG2045345"
FT                   /note="gene_id=hCG2045345.0 transcript_id=hCT2360180.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             complement(4483833..4483997)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045345"
FT                   /product="hCG2045345"
FT                   /note="gene_id=hCG2045345.0 transcript_id=hCT2360180.0
FT                   protein_id=hCP1925421.0"
FT                   /protein_id="EAW77343.1"
FT                   LILAEELPQ"
FT   gene            4490054..4586596
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /note="gene_id=hCG40074.4"
FT   mRNA            join(4490054..4490660,4503158..4503289,4503445..4503520,
FT                   4509603..4509698,4511713..4511852,4512917..4513027,
FT                   4515251..4515362,4517401..4517528,4524033..4524117,
FT                   4527271..4527422,4529430..4529537,4529858..4529981,
FT                   4532096..4532197,4534136..4534291,4538332..4538431,
FT                   4541721..4541832,4550082..4550222,4552179..4552285,
FT                   4557092..4557174,4567627..4567770,4570564..4570695,
FT                   4570926..4571037,4574295..4574381,4581657..4581792,
FT                   4583832..4583899,4585270..4586527)
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1,
FT                   transcript variant hCT31327"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT31327.3; splice
FT                   donor-acceptor pairs covered / total pairs = 25/25; created
FT                   on 26-AUG-2002"
FT   CDS             join(4490241..4490660,4503158..4503289,4503445..4503520,
FT                   4509603..4509698,4511713..4511852,4512917..4513027,
FT                   4515251..4515362,4517401..4517528,4524033..4524117,
FT                   4527271..4527422,4529430..4529537,4529858..4529981,
FT                   4532096..4532197,4534136..4534291,4538332..4538431,
FT                   4541721..4541832,4550082..4550222,4552179..4552285,
FT                   4557092..4557174,4567627..4567770,4570564..4570695,
FT                   4570926..4571037,4574295..4574381,4581657..4581792,
FT                   4583832..4583899,4585270..4585405)
FT                   /codon_start=1
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT31327.3
FT                   protein_id=hCP49852.2 isoform=CRA_c"
FT                   /protein_id="EAW77346.1"
FT   mRNA            join(4504852..4509698,4511713..4511852,4512917..4513027,
FT                   4515251..4515362,4517401..4517528,4524033..4524117,
FT                   4527271..4527422,4529430..4529537,4529858..4529981,
FT                   4532096..4532197,4534136..4534291,4538332..4538431,
FT                   4541721..4541832,4550082..4550222,4552179..4552285,
FT                   4557092..4557174,4567627..4567770,4570564..4570695,
FT                   4570926..4571037,4574295..4574381,4581657..4581792,
FT                   4583832..4583899,4585270..4586596)
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1,
FT                   transcript variant hCT2355735"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT2355735.0;
FT                   splice donor-acceptor pairs covered / total pairs = 22/22;
FT                   created on 14-JUL-2004"
FT   mRNA            join(4506850..4511852,4512917..4513027,4515251..4515362,
FT                   4517401..4517528,4524033..4524117,4527271..4527422,
FT                   4529430..4529537,4529858..4529981,4532096..4532197,
FT                   4534136..4534291,4538332..4538431,4541721..4541832,
FT                   4550082..4550222,4552179..4552285,4557092..4557174,
FT                   4567627..4567770,4570564..4570695,4570926..4571037,
FT                   4574295..4574381,4581657..4581792,4583832..4583899,
FT                   4585270..4586596)
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1,
FT                   transcript variant hCT2355734"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT2355734.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 14-JUL-2004"
FT   gene            4509002..>4509094
FT                   /locus_tag="hCG_2001854"
FT                   /note="gene_id=hCG2001854.0"
FT   mRNA            4509002..>4509094
FT                   /locus_tag="hCG_2001854"
FT                   /product="hCG2001854"
FT                   /note="gene_id=hCG2001854.0 transcript_id=hCT2286232.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             4509032..>4509094
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001854"
FT                   /product="hCG2001854"
FT                   /note="gene_id=hCG2001854.0 transcript_id=hCT2286232.0
FT                   protein_id=hCP1879505.0"
FT                   /protein_id="EAW77347.1"
FT                   /translation="MVTSITGLSTSAIATNGFVRG"
FT   CDS             join(4509662..4509698,4511713..4511852,4512917..4513027,
FT                   4515251..4515362,4517401..4517528,4524033..4524117,
FT                   4527271..4527422,4529430..4529537,4529858..4529981,
FT                   4532096..4532197,4534136..4534291,4538332..4538431,
FT                   4541721..4541832,4550082..4550222,4552179..4552285,
FT                   4557092..4557174,4567627..4567770,4570564..4570695,
FT                   4570926..4571037,4574295..4574381,4581657..4581792,
FT                   4583832..4583899,4585270..4585405)
FT                   /codon_start=1
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT2355735.0
FT                   protein_id=hCP1920955.0 isoform=CRA_b"
FT                   /protein_id="EAW77345.1"
FT   CDS             join(4511808..4511852,4512917..4513027,4515251..4515362,
FT                   4517401..4517528,4524033..4524117,4527271..4527422,
FT                   4529430..4529537,4529858..4529981,4532096..4532197,
FT                   4534136..4534291,4538332..4538431,4541721..4541832,
FT                   4550082..4550222,4552179..4552285,4557092..4557174,
FT                   4567627..4567770,4570564..4570695,4570926..4571037,
FT                   4574295..4574381,4581657..4581792,4583832..4583899,
FT                   4585270..4585405)
FT                   /codon_start=1
FT                   /gene="SLC12A1"
FT                   /locus_tag="hCG_40074"
FT                   /product="solute carrier family 12
FT                   (sodium/potassium/chloride transporters), member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG40074.4 transcript_id=hCT2355734.0
FT                   protein_id=hCP1920954.0 isoform=CRA_a"
FT                   /protein_id="EAW77344.1"
FT                   LVRGNHKNVLTFYS"
FT   gene            complement(4595020..4614337)
FT                   /locus_tag="hCG_2045339"
FT                   /note="gene_id=hCG2045339.0"
FT   mRNA            complement(join(4595020..4595261,4597415..4597483,
FT                   4614044..4614337))
FT                   /locus_tag="hCG_2045339"
FT                   /product="hCG2045339"
FT                   /note="gene_id=hCG2045339.0 transcript_id=hCT2360174.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 16-AUG-2004"
FT   CDS             complement(join(4595144..4595261,4597415..4597437))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045339"
FT                   /product="hCG2045339"
FT                   /note="gene_id=hCG2045339.0 transcript_id=hCT2360174.0
FT                   protein_id=hCP1925415.0"
FT                   /protein_id="EAW77348.1"
FT                   A"
FT   gene            4613651..4625865
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /note="gene_id=hCG41784.3"
FT   mRNA            join(4613651..4614887,4616898..4616989,4618527..4618571,
FT                   4623770..4623844,4623996..4624066,4624503..4625865)
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, transcript variant
FT                   hCT1951321"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1951321.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4613901..4614276,4614749..4614887,4616898..4616989,
FT                   4618527..4618571,4623770..4623844,4623940..4624066,
FT                   4624503..4625865)
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, transcript variant
FT                   hCT1962504"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1962504.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4613901..4614276,4614749..4614887,4616898..4616989,
FT                   4618527..4618571,4623770..4623844,4623996..4624066,
FT                   4624503..4625865)
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, transcript variant
FT                   hCT1962503"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1962503.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(4613937..4613960,4614749..4614887,4616898..4616989,
FT                   4618527..4618571,4623770..4623844,4623996..4624066,
FT                   4624503..4624735)
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, transcript variant
FT                   hCT2355774"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT2355774.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 14-JUL-2004"
FT   CDS             join(4613997..4614276,4614749..4614887,4616898..4616989,
FT                   4618527..4618571,4623770..4623844,4623996..4624066,
FT                   4624503..4624559)
FT                   /codon_start=1
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, isoform CRA_b"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1962503.1
FT                   protein_id=hCP1777192.1 isoform=CRA_b"
FT                   /db_xref="GOA:P33316"
FT                   /db_xref="HGNC:HGNC:3078"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="PDB:1Q5H"
FT                   /db_xref="PDB:1Q5U"
FT                   /db_xref="PDB:2HQU"
FT                   /db_xref="PDB:3ARA"
FT                   /db_xref="PDB:3ARN"
FT                   /db_xref="PDB:3EHW"
FT                   /db_xref="PDB:4MZ5"
FT                   /db_xref="PDB:4MZ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33316"
FT                   /protein_id="EAW77350.1"
FT   CDS             join(4613997..4614276,4614749..4614887,4616898..4616989,
FT                   4618527..4618571,4623770..4623844,4623940..4623965)
FT                   /codon_start=1
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, isoform CRA_d"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1962504.1
FT                   protein_id=hCP1777206.1 isoform=CRA_d"
FT                   /protein_id="EAW77352.1"
FT   CDS             4613997..4614404
FT                   /codon_start=1
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, isoform CRA_a"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT1951321.1
FT                   protein_id=hCP1764793.1 isoform=CRA_a"
FT                   /protein_id="EAW77349.1"
FT   CDS             join(4614802..4614887,4616898..4616989,4618527..4618571,
FT                   4623770..4623844,4623996..4624066,4624503..4624559)
FT                   /codon_start=1
FT                   /gene="DUT"
FT                   /locus_tag="hCG_41784"
FT                   /product="dUTP pyrophosphatase, isoform CRA_c"
FT                   /note="gene_id=hCG41784.3 transcript_id=hCT2355774.0
FT                   protein_id=hCP1921007.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0C4DGL3"
FT                   /db_xref="HGNC:HGNC:3078"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C4DGL3"
FT                   /protein_id="EAW77351.1"
FT   gene            complement(4691769..4929416)
FT                   /gene="FBN1"
FT                   /locus_tag="hCG_38745"
FT                   /note="gene_id=hCG38745.3"
FT   mRNA            complement(join(4691769..4693860,4695050..4695224,
FT                   4698016..4698247,4703173..4703286,4704038..4704166,
FT                   4704432..4704548,4707849..4707971,4708219..4708344,
FT                   4710047..4710253,4710826..4710951,4713151..4713282,
FT                   4715346..4715468,4717074..4717193,4719441..4719557,
FT                   4719802..4719867,4720248..4720397,4724201..4724326,
FT                   4727021..4727140,4727858..4727986,4729188..4729304,
FT                   4731250..4731375,4736221..4736343,4740295..4740420,
FT                   4743904..4743975,4746740..4746898,4747557..4747679,
FT                   4749226..4749351,4749448..4749516,4751596..4751760,
FT                   4752070..4752192,4754292..4754414,4756209..4756334,
FT                   4757913..4758035,4758186..4758308,4765313..4765438,
FT                   4767476..4767601,4769032..4769154,4770723..4770848,
FT                   4770960..4771085,4771760..4771888,4772015..4772140,
FT                   4773498..4773725,4776108..4776233,4777851..4777901,
FT                   4778770..4778907,4779116..4779235,4779747..4779872,
FT                   4780913..4781038,4782632..4782685,4787434..4787586,
FT                   4788672..4788794,4792229..4792351,4793691..4793816,
FT                   4797196..4797315,4799034..4799174,4799830..4800009,
FT                   4804306..4804464,4809774..4809899,4817724..4817849,
FT                   4821255..4821452,4879905..4880000,4883761..4883856,
FT                   4894355..4894453,4896637..4896719,4928236..4928580,
FT                   4929205..4929416))
FT                   /gene="FBN1"
FT                   /locus_tag="hCG_38745"
FT                   /product="fibrillin 1 (Marfan syndrome), transcript variant
FT                   hCT29990"
FT                   /note="gene_id=hCG38745.3 transcript_id=hCT29990.2; splice
FT                   donor-acceptor pairs covered / total pairs = 65/65; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(4691769..4693860,4695050..4695224,
FT                   4698016..4698247,4703167..4703286,4704038..4704166,
FT                   4704432..4704548,4707849..4707971,4708219..4708344,
FT                   4710047..4710253,4710826..4710951,4713151..4713282,
FT                   4715346..4715468,4717074..4717193,4719441..4719557,
FT                   4719802..4719867,4720248..4720397,4724201..4724326,
FT                   4727021..4727140,4727858..4727986,4729188..4729304,
FT                   4731250..4731375,4736221..4736343,4740295..4740420,
FT                   4743904..4743975,4746740..4746898,4747557..4747679,
FT                   4749226..4749351,4749448..4749516,4751596..4751760,
FT                   4752070..4752192,4754292..4754414,4756209..4756334,
FT                   4757913..4758035,4758186..4758308,4765313..4765438,
FT                   4767476..4767601,4769032..4769154,4770723..4770848,
FT                   4770960..4771085,4771760..4771888,4772015..4772140,
FT                   4773498..4773725,4776108..4776233,4777851..4777901,
FT                   4778770..4778907,4779116..4779235,4779747..4779872,
FT                   4780913..4781038,4782632..4782685,4787434..4787586,
FT                   4788672..4788794,4792229..4792351,4793691..4793816,
FT                   4797196..4797315,4799034..4799174,4799830..4800009,
FT                   4804306..4804464,4809774..4809899,4817724..4817849,
FT                   4821255..4821452,4879905..4880000,4883761..4883856,
FT                   4894355..4894453,4896637..4896719,4928236..4928580,
FT                   4929205..4929416))
FT                   /gene="FBN1"
FT                   /locus_tag="hCG_38745"
FT                   /product="fibrillin 1 (Marfan syndrome), transcript variant
FT                   hCT2286994"
FT                   /note="gene_id=hCG38745.3 transcript_id=hCT2286994.0;
FT                   splice donor-acceptor pairs covered / total pairs = 65/65;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(4693471..4693860,4695050..4695224,
FT                   4698016..4698247,4703173..4703286,4704038..4704166,
FT                   4704432..4704548,4707849..4707971,4708219..4708344,
FT                   4710047..4710253,4710826..4710951,4713151..4713282,
FT                   4715346..4715468,4717074..4717193,4719441..4719557,
FT                   4719802..4719867,4720248..4720397,4724201..4724326,
FT                   4727021..4727140,4727858..4727986,4729188..4729304,
FT                   4731250..4731375,4736221..4736343,4740295..4740420,
FT                   4743904..4743975,4746740..4746898,4747557..4747679,
FT                   4749226..4749351,4749448..4749516,4751596..4751760,
FT                   4752070..4752192,4754292..4754414,4756209..4756334,
FT                   4757913..4758035,4758186..4758308,4765313..4765438,
FT                   4767476..4767601,4769032..4769154,4770723..4770848,
FT                   4770960..4771085,4771760..4771888,4772015..4772140,
FT                   4773498..4773725,4776108..4776233,4777851..4777901,
FT                   4778770..4778907,4779116..4779235,4779747..4779872,
FT                   4780913..4781038,4782632..4782685,4787434..4787586,
FT                   4788672..4788794,4792229..4792351,4793691..4793816,
FT                   4797196..4797315,4799034..4799174,4799830..4800009,
FT                   4804306..4804464,4809774..4809899,4817724..4817849,
FT                   4821255..4821452,4879905..4880000,4883761..4883856,
FT                   4894355..4894453,4896637..4896719,4928236..4928399))
FT                   /codon_start=1
FT                   /gene="FBN1"
FT                   /locus_tag="hCG_38745"
FT                   /product="fibrillin 1 (Marfan syndrome), isoform CRA_a"
FT                   /note="gene_id=hCG38745.3 transcript_id=hCT29990.2
FT                   protein_id=hCP51617.3 isoform=CRA_a"
FT                   /protein_id="EAW77353.1"
FT   CDS             complement(join(4693471..4693860,4695050..4695224,
FT                   4698016..4698247,4703167..4703286,4704038..4704166,
FT                   4704432..4704548,4707849..4707971,4708219..4708344,
FT                   4710047..4710253,4710826..4710951,4713151..4713282,
FT                   4715346..4715468,4717074..4717193,4719441..4719557,
FT                   4719802..4719867,4720248..4720397,4724201..4724326,
FT                   4727021..4727140,4727858..4727986,4729188..4729304,
FT                   4731250..4731375,4736221..4736343,4740295..4740420,
FT                   4743904..4743975,4746740..4746898,4747557..4747679,
FT                   4749226..4749351,4749448..4749516,4751596..4751760,
FT                   4752070..4752192,4754292..4754414,4756209..4756334,
FT                   4757913..4758035,4758186..4758308,4765313..4765438,
FT                   4767476..4767601,4769032..4769154,4770723..4770848,
FT                   4770960..4771085,4771760..4771888,4772015..4772140,
FT                   4773498..4773725,4776108..4776233,4777851..4777901,
FT                   4778770..4778907,4779116..4779235,4779747..4779872,
FT                   4780913..4781038,4782632..4782685,4787434..4787586,
FT                   4788672..4788794,4792229..4792351,4793691..4793816,
FT                   4797196..4797315,4799034..4799174,4799830..4800009,
FT                   4804306..4804464,4809774..4809899,4817724..4817849,
FT                   4821255..4821452,4879905..4880000,4883761..4883856,
FT                   4894355..4894453,4896637..4896719,4928236..4928399))
FT                   /codon_start=1
FT                   /gene="FBN1"
FT                   /locus_tag="hCG_38745"
FT                   /product="fibrillin 1 (Marfan syndrome), isoform CRA_b"
FT                   /note="gene_id=hCG38745.3 transcript_id=hCT2286994.0
FT                   protein_id=hCP1879495.0 isoform=CRA_b"
FT                   /db_xref="GOA:P35555"
FT                   /db_xref="HGNC:HGNC:3603"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011398"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR017878"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="PDB:1APJ"
FT                   /db_xref="PDB:1EMN"
FT                   /db_xref="PDB:1EMO"
FT                   /db_xref="PDB:1LMJ"
FT                   /db_xref="PDB:1UZJ"
FT                   /db_xref="PDB:1UZK"
FT                   /db_xref="PDB:1UZP"
FT                   /db_xref="PDB:1UZQ"
FT                   /db_xref="PDB:2M74"
FT                   /db_xref="PDB:2W86"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35555"
FT                   /protein_id="EAW77354.1"
FT   assembly_gap    4735162..4735181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5008979..5009982
FT                   /pseudo
FT                   /locus_tag="hCG_1640961"
FT                   /note="gene_id=hCG1640961.2"
FT   mRNA            5008979..5009982
FT                   /pseudo
FT                   /locus_tag="hCG_1640961"
FT                   /note="gene_id=hCG1640961.2 transcript_id=hCT1641088.3;
FT                   overlap evidence=yes; created on 28-JAN-2004"
FT   gene            complement(5024711..5094768)
FT                   /gene="CEP152"
FT                   /locus_tag="hCG_41788"
FT                   /note="gene_id=hCG41788.2"
FT   mRNA            complement(join(5024711..5025343,5025586..5025739,
FT                   5027879..5027982,5028535..5028631,5032082..5032249,
FT                   5035988..5036108,5039542..5040192,5043774..5043905,
FT                   5046030..5046311,5050699..5050831,5050974..5051102,
FT                   5051858..5051967,5052595..5052720,5056126..5056330,
FT                   5064833..5064996,5065776..5065867,5067610..5067757,
FT                   5072444..5072644,5074880..5075019,5076964..5077104,
FT                   5079653..5079803,5081300..5081369,5081587..5081690,
FT                   5089202..5089295,5094605..5094768))
FT                   /gene="CEP152"
FT                   /locus_tag="hCG_41788"
FT                   /product="centrosomal protein 152kDa"
FT                   /note="gene_id=hCG41788.2 transcript_id=hCT33061.3; splice
FT                   donor-acceptor pairs covered / total pairs = 24/24; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(5025226..5025343,5025586..5025739,
FT                   5027879..5027982,5028535..5028631,5032082..5032249,
FT                   5035988..5036108,5039542..5040192,5043774..5043905,
FT                   5046030..5046311,5050699..5050831,5050974..5051102,
FT                   5051858..5051967,5052595..5052720,5056126..5056330,
FT                   5064833..5064996,5065776..5065867,5067610..5067757,
FT                   5072444..5072644,5074880..5075019,5076964..5077104,
FT                   5079653..5079803,5081300..5081369,5081587..5081690,
FT                   5089202..5089288))
FT                   /codon_start=1
FT                   /gene="CEP152"
FT                   /locus_tag="hCG_41788"
FT                   /product="centrosomal protein 152kDa"
FT                   /note="gene_id=hCG41788.2 transcript_id=hCT33061.3
FT                   protein_id=hCP51619.2"
FT                   /protein_id="EAW77355.1"
FT   gene            5094368..5095232
FT                   /locus_tag="hCG_2045349"
FT                   /note="gene_id=hCG2045349.0"
FT   mRNA            join(5094368..5094451,5094575..5095232)
FT                   /locus_tag="hCG_2045349"
FT                   /product="hCG2045349"
FT                   /note="gene_id=hCG2045349.0 transcript_id=hCT2360184.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             5094396..5094428
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045349"
FT                   /product="hCG2045349"
FT                   /note="gene_id=hCG2045349.0 transcript_id=hCT2360184.0
FT                   protein_id=hCP1925405.0"
FT                   /protein_id="EAW77356.1"
FT                   /translation="MSLLSRILEE"
FT   gene            5161530..5163598
FT                   /gene="CRI1"
FT                   /locus_tag="hCG_41785"
FT                   /note="gene_id=hCG41785.2"
FT   mRNA            5161530..5163598
FT                   /gene="CRI1"
FT                   /locus_tag="hCG_41785"
FT                   /product="CREBBP/EP300 inhibitor 1"
FT                   /note="gene_id=hCG41785.2 transcript_id=hCT33058.2; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   CDS             5161821..5162384
FT                   /codon_start=1
FT                   /gene="CRI1"
FT                   /locus_tag="hCG_41785"
FT                   /product="CREBBP/EP300 inhibitor 1"
FT                   /note="gene_id=hCG41785.2 transcript_id=hCT33058.2
FT                   protein_id=hCP51615.2"
FT                   /db_xref="GOA:Q9Y6B2"
FT                   /db_xref="HGNC:HGNC:1191"
FT                   /db_xref="InterPro:IPR033255"
FT                   /db_xref="InterPro:IPR033258"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y6B2"
FT                   /protein_id="EAW77357.1"
FT   gene            5221879..>5231677
FT                   /locus_tag="hCG_2045348"
FT                   /note="gene_id=hCG2045348.0"
FT   mRNA            join(5221879..5222015,5229598..5229776,5230831..5230973,
FT                   5231471..>5231677)
FT                   /locus_tag="hCG_2045348"
FT                   /product="hCG2045348"
FT                   /note="gene_id=hCG2045348.0 transcript_id=hCT2360183.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             5231472..>5231677
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045348"
FT                   /product="hCG2045348"
FT                   /note="gene_id=hCG2045348.0 transcript_id=hCT2360183.0
FT                   protein_id=hCP1925404.0"
FT                   /protein_id="EAW77358.1"
FT   gene            complement(<5246169..5247118)
FT                   /locus_tag="hCG_2002255"
FT                   /note="gene_id=hCG2002255.0"
FT   mRNA            complement(<5246169..5247118)
FT                   /locus_tag="hCG_2002255"
FT                   /product="hCG2002255"
FT                   /note="gene_id=hCG2002255.0 transcript_id=hCT2286990.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(<5246169..5246660)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002255"
FT                   /product="hCG2002255"
FT                   /note="gene_id=hCG2002255.0 transcript_id=hCT2286990.0
FT                   protein_id=hCP1879491.0"
FT                   /protein_id="EAW77359.1"
FT                   P"
FT   gene            5255604..5257001
FT                   /pseudo
FT                   /locus_tag="hCG_1645991"
FT                   /note="gene_id=hCG1645991.3"
FT   mRNA            5255604..5257001
FT                   /pseudo
FT                   /locus_tag="hCG_1645991"
FT                   /note="gene_id=hCG1645991.3 transcript_id=hCT1646118.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(5272264..5330137)
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /note="gene_id=hCG41789.2"
FT   mRNA            complement(join(5272264..5276549,5279990..5280209,
FT                   5283458..5283612,5284502..5284722,5292841..5293003,
FT                   5295356..5295488,5296273..5296442,5300185..5300326,
FT                   5300473..5300640,5301173..5301253,5303043..5303177,
FT                   5310990..5311105,5311769..5311793,5312078..5312307,
FT                   5316590..5316725,5318966..5319290,5321219..5321397,
FT                   5329904..5330137))
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, transcript variant
FT                   hCT33062"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT33062.3; splice
FT                   donor-acceptor pairs covered / total pairs = 17/17; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(5275073..5275241,5275297..5276549,
FT                   5279990..5280209,5283458..5283612,5284502..5284722,
FT                   5292841..5293003,5295356..5295488,5296273..5296442,
FT                   5300185..5300326,5300473..5300640,5301173..5301253,
FT                   5303043..5303177,5310990..5311105,5311769..5311793,
FT                   5312078..5312307,5316590..5316725,5318966..5319290,
FT                   5321219..5321397,5329904..5330137))
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, transcript variant
FT                   hCT2286876"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT2286876.0;
FT                   splice donor-acceptor pairs covered / total pairs = 17/18;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(5275867..5276549,5279990..5280209,
FT                   5283458..5283612,5284502..5284722,5292841..5293003,
FT                   5295356..5295488,5296273..5296442,5300185..5300326,
FT                   5300473..5300640,5301173..5301253,5303043..5303177,
FT                   5310990..5311105,5311769..5311793,5312078..5312307,
FT                   5316590..5316725,5318966..5319290,5321219..5321397,
FT                   5329904..5329927))
FT                   /codon_start=1
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, isoform CRA_a"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT2286876.0
FT                   protein_id=hCP1879522.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R0"
FT                   /protein_id="EAW77360.1"
FT   CDS             complement(join(5275867..5276549,5279990..5280209,
FT                   5283458..5283612,5284502..5284722,5292841..5293003,
FT                   5295356..5295488,5296273..5296442,5300185..5300326,
FT                   5300473..5300640,5301173..5301253,5303043..5303177,
FT                   5310990..5311105,5311769..5311793,5312078..5312307,
FT                   5316590..5316725,5318966..5319290,5321219..5321397,
FT                   5329904..5329927))
FT                   /codon_start=1
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, isoform CRA_a"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT33062.3
FT                   protein_id=hCP51620.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R0"
FT                   /protein_id="EAW77362.1"
FT   gene            <5300252..>5300522
FT                   /locus_tag="hCG_2042661"
FT                   /note="gene_id=hCG2042661.0"
FT   mRNA            join(<5300252..5300326,5300473..>5300522)
FT                   /locus_tag="hCG_2042661"
FT                   /product="hCG2042661"
FT                   /note="gene_id=hCG2042661.0 transcript_id=hCT2347892.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<5300254..5300326,5300473..>5300522)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042661"
FT                   /product="hCG2042661"
FT                   /note="gene_id=hCG2042661.0 transcript_id=hCT2347892.0
FT                   protein_id=hCP1911412.0"
FT                   /protein_id="EAW77363.1"
FT   mRNA            complement(join(5311251..5312307,5316590..5316725,
FT                   5318966..5319290,5321219..5321397,5329904..5330137))
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, transcript variant
FT                   hCT2286874"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT2286874.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(5311961..5312307,5316590..5316725,
FT                   5318966..5319290,5321219..5321397,5329904..5329927))
FT                   /codon_start=1
FT                   /gene="KIAA0256"
FT                   /locus_tag="hCG_41789"
FT                   /product="KIAA0256 gene product, isoform CRA_b"
FT                   /note="gene_id=hCG41789.2 transcript_id=hCT2286874.0
FT                   protein_id=hCP1879521.0 isoform=CRA_b"
FT                   /protein_id="EAW77361.1"
FT   assembly_gap    5376029..5376392
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            complement(5408885..5439247)
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /note="gene_id=hCG41786.3"
FT   mRNA            complement(join(5408885..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417931..5418105,5420741..5420818,
FT                   5420939..5421028,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439247))
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), transcript variant hCT2286870"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT2286870.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(5408885..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417922..5418105,5420741..5420818,
FT                   5420939..5421028,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439247))
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), transcript variant hCT33059"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT33059.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(5410941..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417931..5418105,5420741..5420818,
FT                   5420939..5421049,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439173))
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), transcript variant hCT2355678"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT2355678.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(5411538..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417931..5418105,5420741..5420818,
FT                   5420939..5421028,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439168))
FT                   /codon_start=1
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), isoform CRA_c"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT2286870.0
FT                   protein_id=hCP1879512.0 isoform=CRA_c"
FT                   /protein_id="EAW77366.1"
FT   CDS             complement(join(5411538..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417922..5418105,5420741..5420818,
FT                   5420939..5421028,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439168))
FT                   /codon_start=1
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), isoform CRA_a"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT33059.3
FT                   protein_id=hCP51616.2 isoform=CRA_a"
FT                   /protein_id="EAW77364.1"
FT   CDS             complement(join(5411538..5411682,5412290..5412348,
FT                   5413065..5413147,5414307..5414404,5417350..5417402,
FT                   5417521..5417699,5417931..5418105,5420741..5420818,
FT                   5420939..5421049,5423119..5423244,5427818..5427895,
FT                   5428556..5428669,5439115..5439168))
FT                   /codon_start=1
FT                   /gene="COPS2"
FT                   /locus_tag="hCG_41786"
FT                   /product="COP9 constitutive photomorphogenic homolog
FT                   subunit 2 (Arabidopsis), isoform CRA_b"
FT                   /note="gene_id=hCG41786.3 transcript_id=hCT2355678.0
FT                   protein_id=hCP1920973.0 isoform=CRA_b"
FT                   /protein_id="EAW77365.1"
FT   gene            5438779..5612170
FT                   /gene="GALK2"
FT                   /locus_tag="hCG_1811969"
FT                   /note="gene_id=hCG1811969.1"
FT   mRNA            join(5438779..5438977,5439368..5439538,5453583..5453963,
FT                   5484745..5484833,5500773..5500896,5519434..5519524,
FT                   5522804..5522950,5565570..5565668,5567149..5567301,
FT                   5575910..5576120,5603198..5603399,5611557..5612170)
FT                   /gene="GALK2"
FT                   /locus_tag="hCG_1811969"
FT                   /product="galactokinase 2"
FT                   /note="gene_id=hCG1811969.1 transcript_id=hCT1955463.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/11;
FT                   created on 26-AUG-2002"
FT   gene            5448453..5449056
FT                   /locus_tag="hCG_2001864"
FT                   /note="gene_id=hCG2001864.0"
FT   mRNA            5448453..5449056
FT                   /locus_tag="hCG_2001864"
FT                   /product="hCG2001864"
FT                   /note="gene_id=hCG2001864.0 transcript_id=hCT2286245.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             5448464..5448607
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001864"
FT                   /product="hCG2001864"
FT                   /note="gene_id=hCG2001864.0 transcript_id=hCT2286245.0
FT                   protein_id=hCP1879532.0"
FT                   /protein_id="EAW77368.1"
FT                   LN"
FT   CDS             join(5453911..5453963,5484745..5484833,5500773..5500896,
FT                   5519434..5519524,5522804..5522950,5565570..5565668,
FT                   5567149..5567301,5575910..5576120,5603198..5603399,
FT                   5611557..5611764)
FT                   /codon_start=1
FT                   /gene="GALK2"
FT                   /locus_tag="hCG_1811969"
FT                   /product="galactokinase 2"
FT                   /note="gene_id=hCG1811969.1 transcript_id=hCT1955463.1
FT                   protein_id=hCP1764795.0"
FT                   /protein_id="EAW77367.1"
FT                   "
FT   gene            complement(5610567..5904174)
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /note="gene_id=hCG2002181.1"
FT   mRNA            complement(join(5610567..5612280,5615384..5615453,
FT                   5654914..5655011,5791418..5791555,5824882..5825008,
FT                   5851455..5851556,5858223..5858321,5859953..5860057,
FT                   5860841..5860876,5871228..5871295,5872982..5873213,
FT                   5894463..5894516,5898369..5898491,5903948..5904166))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT2344041"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344041.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 29-APR-2003"
FT   mRNA            complement(join(5610567..5612280,5615384..5615453,
FT                   5619021..5619101,5651062..5651220,5654914..5655011,
FT                   5791418..5791555,5824882..5825008,5851455..5851556,
FT                   5858223..5858321,5859953..5860057,5860841..5860876,
FT                   5871228..5871295,5872982..5873213,5894463..5894516,
FT                   5898369..5898491,5903879..5904109))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT1644268"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT1644268.4;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 29-APR-2003"
FT   CDS             complement(join(5615421..5615453,5654914..5655011,
FT                   5791418..5791555,5824882..5825008,5851455..5851556,
FT                   5858223..5858321,5859953..5860057,5860841..5860876,
FT                   5871228..5871295,5872982..5873213,5894463..5894516,
FT                   5898369..5898419))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344041.0
FT                   protein_id=hCP1909338.0 isoform=CRA_c"
FT                   /protein_id="EAW77371.1"
FT   CDS             complement(join(5619075..5619101,5651062..5651220,
FT                   5654914..5655011,5791418..5791555,5824882..5825008,
FT                   5851455..5851556,5858223..5858321,5859953..5860057,
FT                   5860841..5860876,5871228..5871295,5872982..5873213,
FT                   5894463..5894516,5898369..5898419))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT1644268.4
FT                   protein_id=hCP1614746.4 isoform=CRA_a"
FT                   /protein_id="EAW77369.1"
FT   mRNA            complement(join(5705587..5705904,5791418..5791555,
FT                   5824882..5825008,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5871228..5871295,
FT                   5872982..5873213,5894463..5894516,5898369..5898491,
FT                   5903879..5904174))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT2286858"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2286858.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 29-APR-2003"
FT   mRNA            complement(join(5705587..5705904,5791418..5791555,
FT                   5822551..5822806,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5898307..5898491,
FT                   5903879..5904088))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT2344040"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344040.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/8;
FT                   created on 29-APR-2003"
FT   mRNA            complement(join(5705706..5705904,5791418..5791555,
FT                   5824882..5825008,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5871228..5871295,
FT                   5872982..5873213,5889405..5889467,5894463..5894516,
FT                   5898369..5898491,5903948..5904150))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT2344043"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344043.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 29-APR-2003"
FT   CDS             complement(join(5705900..5705904,5791418..5791555,
FT                   5824882..5825008,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5871228..5871295,
FT                   5872982..5873213,5894463..5894516,5898369..5898419))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2286858.1
FT                   protein_id=hCP1879514.0 isoform=CRA_b"
FT                   /protein_id="EAW77370.1"
FT   CDS             complement(join(5705900..5705904,5791418..5791555,
FT                   5822551..5822806,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5898307..5898402))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344040.0
FT                   protein_id=hCP1909339.0 isoform=CRA_e"
FT                   /protein_id="EAW77373.1"
FT   CDS             complement(join(5705900..5705904,5791418..5791555,
FT                   5824882..5825008,5851455..5851556,5858223..5858321,
FT                   5859953..5860057,5860841..5860876,5871228..5871295,
FT                   5872982..5873069))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_f"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344043.0
FT                   protein_id=hCP1909337.0 isoform=CRA_f"
FT                   /protein_id="EAW77374.1"
FT   gene            5706428..5770530
FT                   /locus_tag="hCG_2001865"
FT                   /note="gene_id=hCG2001865.1"
FT   mRNA            join(5706428..5706630,5707222..5707773,5766355..5766458,
FT                   5767514..5770530)
FT                   /locus_tag="hCG_2001865"
FT                   /product="hCG2001865, transcript variant hCT2286247"
FT                   /note="gene_id=hCG2001865.1 transcript_id=hCT2286247.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 04-FEB-2004"
FT   mRNA            join(5706428..5706630,5707222..5708701)
FT                   /locus_tag="hCG_2001865"
FT                   /product="hCG2001865, transcript variant hCT2286246"
FT                   /note="gene_id=hCG2001865.1 transcript_id=hCT2286246.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 04-FEB-2004"
FT   CDS             join(5707488..5707773,5766355..5766458,5767514..5767708)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001865"
FT                   /product="hCG2001865, isoform CRA_b"
FT                   /note="gene_id=hCG2001865.1 transcript_id=hCT2286247.1
FT                   protein_id=hCP1879527.1 isoform=CRA_b"
FT                   /db_xref="GOA:P21781"
FT                   /db_xref="HGNC:HGNC:3685"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028247"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21781"
FT                   /protein_id="EAW77376.1"
FT   CDS             5707488..5707781
FT                   /codon_start=1
FT                   /locus_tag="hCG_2001865"
FT                   /product="hCG2001865, isoform CRA_a"
FT                   /note="gene_id=hCG2001865.1 transcript_id=hCT2286246.1
FT                   protein_id=hCP1879529.1 isoform=CRA_a"
FT                   /db_xref="GOA:P21781"
FT                   /db_xref="HGNC:HGNC:3685"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028247"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21781"
FT                   /protein_id="EAW77375.1"
FT   mRNA            complement(join(5857971..5858321,5894463..5894516,
FT                   5898369..5898491,5903948..5904103))
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, transcript
FT                   variant hCT2344042"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344042.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 29-APR-2003"
FT   CDS             complement(join(5858217..5858321,5894463..5894516,
FT                   5898369..5898419))
FT                   /codon_start=1
FT                   /gene="C15orf33"
FT                   /locus_tag="hCG_2002181"
FT                   /product="chromosome 15 open reading frame 33, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG2002181.1 transcript_id=hCT2344042.0
FT                   protein_id=hCP1909340.0 isoform=CRA_d"
FT                   /protein_id="EAW77372.1"
FT   assembly_gap    5884347..5884366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5904276..5928392
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /note="gene_id=hCG39819.3"
FT   mRNA            join(5904276..5904370,5908361..5908679,5915407..5915550,
FT                   5917784..5918042,5926583..5928392)
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, transcript variant
FT                   hCT31071"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT31071.3; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 07-OCT-2003"
FT   mRNA            join(5904276..5904370,5908361..5908679,5909992..5910141,
FT                   5912835..5913001)
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, transcript variant
FT                   hCT2286250"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT2286250.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 07-OCT-2003"
FT   mRNA            join(5904336..5904441,5908361..5908679,5915407..5915550,
FT                   5917784..5918299)
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, transcript variant
FT                   hCT2286249"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT2286249.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 07-OCT-2003"
FT   CDS             join(5908416..5908679,5915407..5915550,5917784..5918042,
FT                   5926583..5926830)
FT                   /codon_start=1
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, isoform CRA_c"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT31071.3
FT                   protein_id=hCP49581.2 isoform=CRA_c"
FT                   /protein_id="EAW77379.1"
FT   CDS             join(5908416..5908679,5915407..5915550,5917784..5918092)
FT                   /codon_start=1
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, isoform CRA_b"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT2286249.0
FT                   protein_id=hCP1879534.0 isoform=CRA_b"
FT                   /protein_id="EAW77378.1"
FT                   GKKKMFFWTAPPSDLF"
FT   CDS             join(5908416..5908679,5909992..5910057)
FT                   /codon_start=1
FT                   /gene="DTWD1"
FT                   /locus_tag="hCG_39819"
FT                   /product="DTW domain containing 1, isoform CRA_a"
FT                   /note="gene_id=hCG39819.3 transcript_id=hCT2286250.0
FT                   protein_id=hCP1879536.0 isoform=CRA_a"
FT                   /protein_id="EAW77377.1"
FT                   ITCIG"
FT   gene            6077313..6080114
FT                   /pseudo
FT                   /locus_tag="hCG_2001868"
FT                   /note="gene_id=hCG2001868.0"
FT   mRNA            6077313..6080114
FT                   /pseudo
FT                   /locus_tag="hCG_2001868"
FT                   /note="gene_id=hCG2001868.0 transcript_id=hCT2286253.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(6142254..6401921)
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /note="gene_id=hCG2002178.0"
FT   mRNA            complement(join(6142254..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162748,
FT                   6180581..6180804,6181357..6181540,6184381..6184495,
FT                   6199936..6200034,6200223..6200328,6202128..6202239,
FT                   6203535..6203699,6206668..6206783,6214408..6214596,
FT                   6217306..6217524,6255866..6256086,6262912..6263140,
FT                   6279973..6280055,6285449..6285519,6294141..6294213,
FT                   6322065..6322126,6327891..6327989,6330648..6330761,
FT                   6357391..6357449,6389644..6389713,6401822..6401921))
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, transcript
FT                   variant hCT2286852"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286852.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/25;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6142254..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162748,
FT                   6180581..6180804,6181357..6181540,6184381..6184528,
FT                   6200223..6200328,6202128..6202239,6203535..6203699,
FT                   6206668..6206783,6214408..6214596,6217306..6217471,
FT                   6245273..6245316,6255878..6256086,6262912..6263108,
FT                   6264501..6264589,6270686..6270844,6279973..6280055,
FT                   6285449..6285519,6294141..6294213,6302185..6302216))
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, transcript
FT                   variant hCT2286855"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286855.0;
FT                   splice donor-acceptor pairs covered / total pairs = 22/22;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6142254..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162778))
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, transcript
FT                   variant hCT2286853"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286853.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6143475..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162748,
FT                   6180581..6180804,6181357..6181540,6184381..6184528,
FT                   6200223..6200328,6202128..6202239,6203535..6203699,
FT                   6206668..6206783,6214408..6214596,6217306..6217471,
FT                   6245273..6245316,6255878..6256086,6262912..6263108,
FT                   6264501..6264589,6270686..6270844,6279973..6280055,
FT                   6285449..6285519,6294141..6294194))
FT                   /codon_start=1
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286855.0
FT                   protein_id=hCP1879519.0 isoform=CRA_b"
FT                   /protein_id="EAW77381.1"
FT                   KTTDTVSSFSQDKTVKL"
FT   CDS             complement(join(6143475..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162748,
FT                   6180581..6180804,6181357..6181489))
FT                   /codon_start=1
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286852.0
FT                   protein_id=hCP1879515.0 isoform=CRA_a"
FT                   /protein_id="EAW77380.1"
FT                   TVSSFSQDKTVKL"
FT   CDS             complement(join(6143475..6143756,6145534..6145664,
FT                   6149635..6149773,6159567..6159812,6162665..6162682))
FT                   /codon_start=1
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286853.0
FT                   protein_id=hCP1879517.0 isoform=CRA_d"
FT                   /protein_id="EAW77383.1"
FT   mRNA            complement(join(6262901..6263065,6264501..6264589,
FT                   6270686..6270844,6279973..6280055,6285449..6285519,
FT                   6294141..6294213,6322065..6322126,6327891..6327989,
FT                   6330648..6330761,6357391..6357449,6389644..6389713,
FT                   6401822..6401921))
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, transcript
FT                   variant hCT2286854"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286854.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6262970..6263065,6264501..6264589,
FT                   6270686..6270844,6279973..6280055,6285449..6285519,
FT                   6294141..6294213,6322065..6322126,6327891..6327989,
FT                   6330648..6330761,6357391..6357449,6389644..6389671))
FT                   /codon_start=1
FT                   /gene="ATP8B4"
FT                   /locus_tag="hCG_2002178"
FT                   /product="ATPase, Class I, type 8B, member 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG2002178.0 transcript_id=hCT2286854.0
FT                   protein_id=hCP1879518.0 isoform=CRA_c"
FT                   /protein_id="EAW77382.1"
FT   gene            6464830..6519010
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /note="gene_id=hCG39815.3"
FT   mRNA            join(6464830..6465531,6480124..6480333,6485109..6485267,
FT                   6487865..6487989,6505579..6505773,6508602..6508692,
FT                   6509594..6509792,6511560..6511657,6516484..6516614,
FT                   6518536..6519010)
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, transcript variant hCT31067"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT31067.2; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   mRNA            join(6464859..6465531,6480124..6480333,6487865..6487989,
FT                   6505579..6505773,6508602..6508692,6509594..6509792,
FT                   6511560..6511657,6516484..6516614,6518536..6518992)
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, transcript variant hCT2355696"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT2355696.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   CDS             join(6465054..6465531,6480124..6480333,6485109..6485267,
FT                   6487865..6487989,6505579..6505773,6508602..6508692,
FT                   6509594..6509792,6511560..6511657,6516484..6516614,
FT                   6518536..6518712)
FT                   /codon_start=1
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, isoform CRA_c"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT31067.2
FT                   protein_id=hCP49583.2 isoform=CRA_c"
FT                   /db_xref="GOA:O14975"
FT                   /db_xref="HGNC:HGNC:10996"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030305"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14975"
FT                   /protein_id="EAW77386.1"
FT   CDS             join(6465054..6465531,6480124..6480333,6487865..6487989,
FT                   6505579..6505773,6508602..6508692,6509594..6509792,
FT                   6511560..6511657,6516484..6516614,6518536..6518712)
FT                   /codon_start=1
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT2355696.0
FT                   protein_id=hCP1920947.0 isoform=CRA_a"
FT                   /protein_id="EAW77384.1"
FT   mRNA            join(6473623..6473726,6480124..6480333,6480859..6481106,
FT                   6485109..6485267,6487865..6487989,6505579..6505773,
FT                   6508602..6508692,6509594..6509792,6511560..6511657,
FT                   6516484..6516614,6518536..6519000)
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, transcript variant hCT2355697"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT2355697.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 14-JUL-2004"
FT   CDS             join(6485126..6485267,6487865..6487989,6505579..6505773,
FT                   6508602..6508692,6509594..6509792,6511560..6511657,
FT                   6516484..6516614,6518536..6518712)
FT                   /codon_start=1
FT                   /gene="SLC27A2"
FT                   /locus_tag="hCG_39815"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 2, isoform CRA_b"
FT                   /note="gene_id=hCG39815.3 transcript_id=hCT2355697.0
FT                   protein_id=hCP1920948.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3V1R7"
FT                   /db_xref="HGNC:HGNC:10996"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030305"
FT                   /db_xref="UniProtKB/TrEMBL:G3V1R7"
FT                   /protein_id="EAW77385.1"
FT   gene            complement(6524551..6548630)
FT                   /gene="HDC"
FT                   /locus_tag="hCG_39814"
FT                   /note="gene_id=hCG39814.3"
FT   mRNA            complement(join(6524551..6525610,6525747..6525848,
FT                   6530849..6530947,6535034..6535124,6535216..6535378,
FT                   6536204..6536270,6536734..6536877,6537134..6537268,
FT                   6540029..6540151,6541008..6541121,6545839..6546011,
FT                   6548197..6548630))
FT                   /gene="HDC"
FT                   /locus_tag="hCG_39814"
FT                   /product="histidine decarboxylase"
FT                   /note="gene_id=hCG39814.3 transcript_id=hCT31066.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(6524864..6525610,6525747..6525848,
FT                   6530849..6530947,6535034..6535124,6535216..6535378,
FT                   6536204..6536270,6536734..6536877,6537134..6537268,
FT                   6540029..6540151,6541008..6541121,6545839..6546011,
FT                   6548197..6548227))
FT                   /codon_start=1
FT                   /gene="HDC"
FT                   /locus_tag="hCG_39814"
FT                   /product="histidine decarboxylase"
FT                   /note="gene_id=hCG39814.3 transcript_id=hCT31066.3
FT                   protein_id=hCP49582.2"
FT                   /protein_id="EAW77387.1"
FT   gene            complement(6559816..6637912)
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /note="gene_id=hCG2002404.1"
FT   mRNA            complement(join(6559816..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583860..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398,
FT                   6637572..6637912))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287259"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287259.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6559816..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583824..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398,
FT                   6637572..6637826))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287258"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287258.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6559816..6561388,6564883..6564995,
FT                   6568672..6568787,6572087..6572272,6583392..6583505,
FT                   6583824..6583971,6585529..6585723,6586566..6586733,
FT                   6592291..6592398,6637572..6637826))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287262"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287262.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6559816..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583860..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398,
FT                   6597016..6597270,6628959..6628991))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287256"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287256.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(6561236..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583860..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_a"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287259.1
FT                   protein_id=hCP1879542.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X6"
FT                   /protein_id="EAW77388.1"
FT   CDS             complement(join(6561236..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583860..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_a"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287256.1
FT                   protein_id=hCP1879549.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X6"
FT                   /protein_id="EAW77394.1"
FT   CDS             complement(join(6561236..6561388,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583824..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_f"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287258.0
FT                   protein_id=hCP1879541.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q06547"
FT                   /db_xref="HGNC:HGNC:4074"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06547"
FT                   /protein_id="EAW77395.1"
FT   CDS             complement(join(6564897..6564995,6568672..6568787,
FT                   6572087..6572272,6583392..6583505,6583824..6583971,
FT                   6585529..6585723,6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_d"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287262.1
FT                   protein_id=hCP1879546.1 isoform=CRA_d"
FT                   /protein_id="EAW77391.1"
FT   mRNA            complement(join(6568486..6568787,6572087..6572272,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398,6637572..6637826))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287257"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287257.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6568486..6568787,6572087..6572272,
FT                   6583392..6583505,6583824..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398,6637572..6637826))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287251"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287251.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6568486..6568787,6572087..6572269,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398,6628959..6628982,
FT                   6637572..6637826))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2287252"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287252.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(6568490..6568787,6572087..6572272,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398,6628959..6628982,
FT                   6637572..6637785))
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, transcript variant hCT2355712"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2355712.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(6568624..6568787,6572087..6572269,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_c"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287252.1
FT                   protein_id=hCP1879550.1 isoform=CRA_c"
FT                   /db_xref="HGNC:HGNC:4074"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:H9ZYI9"
FT                   /protein_id="EAW77390.1"
FT                   LCRSHPK"
FT   CDS             complement(join(6568624..6568787,6572087..6572272,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_b"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2355712.0
FT                   protein_id=hCP1920924.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R5"
FT                   /protein_id="EAW77389.1"
FT                   VLCRSHPK"
FT   CDS             complement(join(6568624..6568787,6572087..6572272,
FT                   6583392..6583505,6583860..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_b"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287257.0
FT                   protein_id=hCP1879543.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R5"
FT                   /protein_id="EAW77392.1"
FT                   VLCRSHPK"
FT   CDS             complement(join(6568624..6568787,6572087..6572272,
FT                   6583392..6583505,6583824..6583971,6585529..6585723,
FT                   6586566..6586733,6592291..6592398))
FT                   /codon_start=1
FT                   /gene="GABPB2"
FT                   /locus_tag="hCG_2002404"
FT                   /product="GA binding protein transcription factor, beta
FT                   subunit 2, isoform CRA_e"
FT                   /note="gene_id=hCG2002404.1 transcript_id=hCT2287251.0
FT                   protein_id=hCP1879539.0 isoform=CRA_e"
FT                   /protein_id="EAW77393.1"
FT   gene            complement(6635988..>6637449)
FT                   /locus_tag="hCG_2042213"
FT                   /note="gene_id=hCG2042213.0"
FT   mRNA            complement(6635988..>6637449)
FT                   /locus_tag="hCG_2042213"
FT                   /product="hCG2042213"
FT                   /note="gene_id=hCG2042213.0 transcript_id=hCT2347444.0;
FT                   overlap evidence=yes; created on 18-JUN-2003"
FT   CDS             complement(6636873..>6637448)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042213"
FT                   /product="hCG2042213"
FT                   /note="gene_id=hCG2042213.0 transcript_id=hCT2347444.0
FT                   protein_id=hCP1911414.0"
FT                   /protein_id="EAW77396.1"
FT   gene            <6637542..6639030
FT                   /locus_tag="hCG_2002074"
FT                   /note="gene_id=hCG2002074.0"
FT   mRNA            join(<6637542..6638352,6638687..6639030)
FT                   /locus_tag="hCG_2002074"
FT                   /product="hCG2002074"
FT                   /note="gene_id=hCG2002074.0 transcript_id=hCT2286654.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             <6637543..6637791
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002074"
FT                   /product="hCG2002074"
FT                   /note="gene_id=hCG2002074.0 transcript_id=hCT2286654.0
FT                   protein_id=hCP1879570.0"
FT                   /protein_id="EAW77397.1"
FT   gene            6640742..6651204
FT                   /locus_tag="hCG_2002075"
FT                   /note="gene_id=hCG2002075.0"
FT   mRNA            join(6640742..6640795,6649971..6651204)
FT                   /locus_tag="hCG_2002075"
FT                   /product="hCG2002075"
FT                   /note="gene_id=hCG2002075.0 transcript_id=hCT2286655.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             6650168..6650554
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002075"
FT                   /product="hCG2002075"
FT                   /note="gene_id=hCG2002075.0 transcript_id=hCT2286655.0
FT                   protein_id=hCP1879571.0"
FT                   /protein_id="EAW77398.1"
FT   gene            6699964..6701259
FT                   /pseudo
FT                   /locus_tag="hCG_1644552"
FT                   /note="gene_id=hCG1644552.3"
FT   mRNA            6699964..6701259
FT                   /pseudo
FT                   /locus_tag="hCG_1644552"
FT                   /note="gene_id=hCG1644552.3 transcript_id=hCT1644679.2;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   gene            6706961..6783398
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /note="gene_id=hCG38748.4"
FT   mRNA            join(6706961..6707093,6721605..6721773,6723942..6724086,
FT                   6731993..6732078,6741594..6741756,6744874..6744916,
FT                   6747641..6747785,6754228..6754390,6759444..6759588,
FT                   6759871..6760094,6764076..6764660,6766870..6766956,
FT                   6772395..6772475,6772857..6773119,6775295..6775507,
FT                   6776664..6776874,6778442..6778678,6779683..6779825,
FT                   6781190..6781322,6781497..6782360)
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, transcript
FT                   variant hCT2355703"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2355703.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 14-JUL-2004"
FT   mRNA            join(6706982..6707233,6721605..6721773,6723942..6724086,
FT                   6731993..6732078,6741594..6741756,6744874..6744916,
FT                   6747641..6747785,6754228..6754390,6759444..6759588,
FT                   6759871..6760094,6764076..6764660,6766870..6766956,
FT                   6772395..6772475,6772857..6773119,6775295..6775507,
FT                   6776664..6776874,6778442..6778678,6779683..6779825,
FT                   6781190..6781322,6781497..6783263)
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, transcript
FT                   variant hCT29993"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT29993.3; splice
FT                   donor-acceptor pairs covered / total pairs = 19/19; created
FT                   on 26-AUG-2002"
FT   mRNA            join(6706994..6707233,6714934..6715095,6721605..6721773,
FT                   6723942..6724086,6731993..6732078,6741594..6741756,
FT                   6744874..6744916,6747641..6747785,6754228..6754390,
FT                   6759444..6759588,6759871..6760094,6764076..6764660,
FT                   6766870..6766956,6772395..6772475,6772857..6773119,
FT                   6775295..6775507,6776664..6776874,6778442..6778678,
FT                   6779683..6779825,6781190..6781322,6781497..6783263,
FT                   6783318..6783398)
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, transcript
FT                   variant hCT2286659"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2286659.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 26-AUG-2002"
FT   mRNA            join(6721613..6721773,6731993..6732078,6741594..6741756,
FT                   6744874..6744916,6747641..6747785)
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, transcript
FT                   variant hCT2286660"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2286660.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(6721670..6721773,6723942..6724086,6731993..6732078,
FT                   6741594..6741756,6744874..6744916,6747641..6747785,
FT                   6754228..6754390,6759444..6759588,6759871..6760094,
FT                   6764076..6764660,6766870..6766956,6772395..6772475,
FT                   6772857..6773119,6775295..6775507,6776664..6776874,
FT                   6778442..6778678,6779683..6779825,6781190..6781322,
FT                   6781497..6781682)
FT                   /codon_start=1
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, isoform CRA_a"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2286659.0
FT                   protein_id=hCP1879566.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR015063"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S4"
FT                   /protein_id="EAW77399.1"
FT                   SLGPRVTDVAT"
FT   CDS             join(6721670..6721773,6723942..6724086,6731993..6732078,
FT                   6741594..6741756,6744874..6744916,6747641..6747785,
FT                   6754228..6754390,6759444..6759588,6759871..6760094,
FT                   6764076..6764660,6766870..6766956,6772395..6772475,
FT                   6772857..6773119,6775295..6775507,6776664..6776874,
FT                   6778442..6778678,6779683..6779825,6781190..6781322,
FT                   6781497..6781682)
FT                   /codon_start=1
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, isoform CRA_a"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2355703.0
FT                   protein_id=hCP1920943.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR015063"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S4"
FT                   /protein_id="EAW77400.1"
FT                   SLGPRVTDVAT"
FT   CDS             join(6721670..6721773,6723942..6724086,6731993..6732078,
FT                   6741594..6741756,6744874..6744916,6747641..6747785,
FT                   6754228..6754390,6759444..6759588,6759871..6760094,
FT                   6764076..6764660,6766870..6766956,6772395..6772475,
FT                   6772857..6773119,6775295..6775507,6776664..6776874,
FT                   6778442..6778678,6779683..6779825,6781190..6781322,
FT                   6781497..6781682)
FT                   /codon_start=1
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, isoform CRA_a"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT29993.3
FT                   protein_id=hCP49642.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR015063"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S4"
FT                   /protein_id="EAW77401.1"
FT                   SLGPRVTDVAT"
FT   CDS             join(6741596..6741756,6744874..6744916,6747641..6747673)
FT                   /codon_start=1
FT                   /gene="USP8"
FT                   /locus_tag="hCG_38748"
FT                   /product="ubiquitin specific peptidase 8, isoform CRA_b"
FT                   /note="gene_id=hCG38748.4 transcript_id=hCT2286660.0
FT                   protein_id=hCP1879565.0 isoform=CRA_b"
FT                   /protein_id="EAW77402.1"
FT   gene            complement(6782748..6827359)
FT                   /gene="USP50"
FT                   /locus_tag="hCG_1786662"
FT                   /note="gene_id=hCG1786662.3"
FT   mRNA            complement(join(6782748..6783429,6812380..6812512,
FT                   6821289..6821431,6823629..6823832,6826177..6826372,
FT                   6827166..6827359))
FT                   /gene="USP50"
FT                   /locus_tag="hCG_1786662"
FT                   /product="ubiquitin specific peptidase 50"
FT                   /note="gene_id=hCG1786662.3 transcript_id=hCT1825707.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/5;
FT                   created on 25-AUG-2003"
FT   CDS             complement(join(6783361..6783429,6812380..6812512,
FT                   6821289..6821431,6823629..6823832,6826177..6826335))
FT                   /codon_start=1
FT                   /gene="USP50"
FT                   /locus_tag="hCG_1786662"
FT                   /product="ubiquitin specific peptidase 50"
FT                   /note="gene_id=hCG1786662.3 transcript_id=hCT1825707.3
FT                   protein_id=hCP1733778.2"
FT                   /protein_id="EAW77403.1"
FT                   HYTAFCKNSVTQA"
FT   gene            complement(6839742..6841598)
FT                   /locus_tag="hCG_2002402"
FT                   /note="gene_id=hCG2002402.0"
FT   mRNA            complement(6839742..6841598)
FT                   /locus_tag="hCG_2002402"
FT                   /product="hCG2002402"
FT                   /note="gene_id=hCG2002402.0 transcript_id=hCT2287249.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(6840085..6840234)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002402"
FT                   /product="hCG2002402"
FT                   /note="gene_id=hCG2002402.0 transcript_id=hCT2287249.0
FT                   protein_id=hCP1879552.0"
FT                   /protein_id="EAW77404.1"
FT                   RKYF"
FT   gene            complement(6842438..6969744)
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /note="gene_id=hCG39859.4"
FT   mRNA            complement(join(6842438..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6872483..6872822,
FT                   6873081..6873267,6874582..6875557,6876548..6876680,
FT                   6877360..6877544,6879186..6879312,6882053..6882227,
FT                   6887797..6888075,6890131..6890259,6892512..6892615,
FT                   6892737..6892892,6894024..6894252,6895480..6895760,
FT                   6896638..6896772,6897054..6897194,6902671..6902724,
FT                   6907091..6907225,6911074..6911174,6914341..6914413,
FT                   6915793..6915916,6917306..6917480,6920346..6920517,
FT                   6922348..6922472,6926264..6926477,6931609..6931807,
FT                   6940705..6940743,6945892..6945971,6969473..6969632))
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, transcript variant hCT2287248"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287248.0;
FT                   splice donor-acceptor pairs covered / total pairs = 30/34;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(6842438..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6858803..6858853,
FT                   6861573..6861598,6863808..6863842,6866023..6866090,
FT                   6869328..6869424,6872529..6872593,6874842..6875557,
FT                   6876548..6876680,6877360..6877544,6879186..6879312,
FT                   6882053..6882227,6887797..6888075,6890131..6890259,
FT                   6892512..6892655,6892737..6892892,6894024..6894252,
FT                   6895480..6895760,6896638..6896772,6897054..6897194,
FT                   6902671..6902724,6907091..6907225,6911074..6911174,
FT                   6914341..6914413,6915793..6915916,6917306..6917480,
FT                   6920346..6920517,6922348..6922472,6926264..6926477,
FT                   6931609..6931807,6940705..6940743,6945892..6945971,
FT                   6969473..6969632))
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, transcript variant hCT31111"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT31111.3; splice
FT                   donor-acceptor pairs covered / total pairs = 38/38; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(6842877..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6858803..6858853,
FT                   6861573..6861598,6863808..6863842,6866023..6866093,
FT                   6869328..6869424,6872529..6872593,6874842..6875557,
FT                   6876548..6876680,6877360..6877544,6879186..6879312,
FT                   6882053..6882227,6887797..6888075,6890131..6890259,
FT                   6892512..6892655,6892737..6892892,6894024..6894252,
FT                   6895480..6895760,6896638..6896772,6897054..6897194,
FT                   6902671..6902724,6907091..6907225,6911074..6911174,
FT                   6914341..6914413,6915793..6915916,6917306..6917480,
FT                   6920346..6920517,6922348..6922472,6926264..6926477,
FT                   6931609..6931807,6940705..6940743,6945892..6945971,
FT                   6969473..6969744))
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, transcript variant hCT2355718"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2355718.0;
FT                   splice donor-acceptor pairs covered / total pairs = 38/38;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(6843333..6843447,6843501..6844389,
FT                   6852823..6852929,6853040..6853091,6857208..6857413,
FT                   6857571..6857653,6857786..6858069,6858658..6858723,
FT                   6858803..6858853,6861573..6861598,6863808..6863842,
FT                   6866023..6866093,6869328..6869424,6872529..6872593,
FT                   6874842..6875557,6876548..6876680,6877360..6877544,
FT                   6879186..6879312,6882053..6882227,6887797..6888075,
FT                   6890131..6890259,6892512..6892655,6892737..6892892,
FT                   6894024..6894252,6895480..6895760,6896638..6896772,
FT                   6897054..6897194,6902671..6902724,6907091..6907225,
FT                   6911074..6911174,6914341..6914413,6915793..6915916,
FT                   6917306..6917480,6920346..6920517,6922348..6922472,
FT                   6926264..6926477,6931609..6931807,6940705..6940743,
FT                   6945892..6945971,6969473..6969632))
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, transcript variant hCT2287245"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287245.0;
FT                   splice donor-acceptor pairs covered / total pairs = 39/39;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6844259..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6858803..6858853,
FT                   6861573..6861598,6863808..6863842,6866023..6866090,
FT                   6869328..6869424,6872529..6872593,6874842..6875557,
FT                   6876548..6876680,6877360..6877544,6879186..6879312,
FT                   6882053..6882227,6887797..6888075,6890131..6890259,
FT                   6892512..6892655,6892737..6892892,6894024..6894252,
FT                   6895480..6895760,6896638..6896772,6897054..6897194,
FT                   6902671..6902724,6907091..6907225,6911074..6911174,
FT                   6914341..6914413,6915793..6915916,6917306..6917480,
FT                   6920346..6920517,6922348..6922472,6926264..6926477,
FT                   6931609..6931807,6940705..6940743,6945892..6945971,
FT                   6969473..6969475))
FT                   /codon_start=1
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, isoform CRA_c"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT31111.3
FT                   protein_id=hCP49646.2 isoform=CRA_c"
FT                   /db_xref="GOA:H0YLN8"
FT                   /db_xref="HGNC:HGNC:17994"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029601"
FT                   /db_xref="InterPro:IPR032415"
FT                   /db_xref="UniProtKB/TrEMBL:H0YLN8"
FT                   /protein_id="EAW77407.1"
FT   CDS             complement(join(6844259..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6858803..6858853,
FT                   6861573..6861598,6863808..6863842,6866023..6866093,
FT                   6869328..6869424,6872529..6872593,6874842..6875557,
FT                   6876548..6876680,6877360..6877544,6879186..6879312,
FT                   6882053..6882227,6887797..6888075,6890131..6890259,
FT                   6892512..6892655,6892737..6892892,6894024..6894252,
FT                   6895480..6895760,6896638..6896772,6897054..6897194,
FT                   6902671..6902724,6907091..6907225,6911074..6911174,
FT                   6914341..6914413,6915793..6915916,6917306..6917480,
FT                   6920346..6920517,6922348..6922472,6926264..6926477,
FT                   6931609..6931807,6940705..6940743,6945892..6945971,
FT                   6969473..6969475))
FT                   /codon_start=1
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, isoform CRA_a"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2355718.0
FT                   protein_id=hCP1920949.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5V1"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029601"
FT                   /db_xref="InterPro:IPR032415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V1"
FT                   /protein_id="EAW77405.1"
FT   CDS             complement(join(6844259..6844389,6852823..6852929,
FT                   6853040..6853091,6857208..6857413,6857571..6857653,
FT                   6857786..6858069,6858658..6858723,6858803..6858853,
FT                   6861573..6861598,6863808..6863842,6866023..6866093,
FT                   6869328..6869424,6872529..6872593,6874842..6875557,
FT                   6876548..6876680,6877360..6877544,6879186..6879312,
FT                   6882053..6882227,6887797..6888075,6890131..6890259,
FT                   6892512..6892655,6892737..6892892,6894024..6894252,
FT                   6895480..6895760,6896638..6896772,6897054..6897194,
FT                   6902671..6902724,6907091..6907225,6911074..6911174,
FT                   6914341..6914413,6915793..6915916,6917306..6917480,
FT                   6920346..6920517,6922348..6922472,6926264..6926477,
FT                   6931609..6931807,6940705..6940743,6945892..6945971,
FT                   6969473..6969475))
FT                   /codon_start=1
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, isoform CRA_a"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287245.0
FT                   protein_id=hCP1879558.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5V1"
FT                   /db_xref="InterPro:IPR004166"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029601"
FT                   /db_xref="InterPro:IPR032415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V1"
FT                   /protein_id="EAW77408.1"
FT   mRNA            complement(join(6874837..6875557,6877360..6877544,
FT                   6879186..6879312,6882053..6882227,6887797..6888075,
FT                   6890131..6890259,6892512..6892655,6892737..6892892,
FT                   6894024..6894252,6895480..6895760,6896638..6896772,
FT                   6897054..6897194,6902671..6902724,6907091..6907225,
FT                   6911074..6911174,6914341..6914413,6915793..6915916,
FT                   6917306..6917480,6920346..6920517,6922348..6922472,
FT                   6926264..6926477,6931609..6931807,6940705..6940743,
FT                   6945892..6945971,6969473..6969632))
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, transcript variant hCT2287243"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287243.0;
FT                   splice donor-acceptor pairs covered / total pairs = 23/24;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6875502..6875557,6877360..6877544,
FT                   6879186..6879312,6882053..6882227,6887797..6888075,
FT                   6890131..6890259,6892512..6892655,6892737..6892892,
FT                   6894024..6894252,6895480..6895760,6896638..6896772,
FT                   6897054..6897194,6902671..6902724,6907091..6907225,
FT                   6911074..6911174,6914341..6914413,6915793..6915916,
FT                   6917306..6917480,6920346..6920517,6922348..6922472,
FT                   6926264..6926477,6931609..6931807,6940705..6940743,
FT                   6945892..6945971,6969473..6969475))
FT                   /codon_start=1
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, isoform CRA_b"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287243.0
FT                   protein_id=hCP1879557.0 isoform=CRA_b"
FT                   /protein_id="EAW77406.1"
FT                   LKKLEIVSTT"
FT   CDS             complement(join(6892589..6892615,6892737..6892892,
FT                   6894024..6894252,6895480..6895760,6896638..6896772,
FT                   6897054..6897194,6902671..6902724,6907091..6907225,
FT                   6911074..6911174,6914341..6914413,6915793..6915916,
FT                   6917306..6917480,6920346..6920517,6922348..6922472,
FT                   6926264..6926477,6931609..6931807,6940705..6940743,
FT                   6945892..6945971,6969473..6969475))
FT                   /codon_start=1
FT                   /gene="TRPM7"
FT                   /locus_tag="hCG_39859"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 7, isoform CRA_d"
FT                   /note="gene_id=hCG39859.4 transcript_id=hCT2287248.0
FT                   protein_id=hCP1879556.0 isoform=CRA_d"
FT                   /protein_id="EAW77409.1"
FT                   ERMRWRYK"
FT   gene            complement(6990525..7048648)
FT                   /gene="SPPL2A"
FT                   /locus_tag="hCG_1811980"
FT                   /note="gene_id=hCG1811980.1"
FT   mRNA            complement(join(6990525..6990814,7002874..7003034,
FT                   7005058..7005135,7008155..7008257,7009255..7009311,
FT                   7013899..7013973,7015545..7015626,7019043..7019144,
FT                   7019586..7019682,7022623..7022771,7030437..7030570,
FT                   7031055..7031144,7031630..7031812,7032578..7032688,
FT                   7048407..7048648))
FT                   /gene="SPPL2A"
FT                   /locus_tag="hCG_1811980"
FT                   /product="signal peptide peptidase-like 2A"
FT                   /note="gene_id=hCG1811980.1 transcript_id=hCT1955474.1;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(6990740..6990814,7002874..7003034,
FT                   7005058..7005135,7008155..7008257,7009255..7009311,
FT                   7013899..7013973,7015545..7015626,7019043..7019144,
FT                   7019586..7019682,7022623..7022771,7030437..7030570,
FT                   7031055..7031144,7031630..7031812,7032578..7032688,
FT                   7048407..7048472))
FT                   /codon_start=1
FT                   /gene="SPPL2A"
FT                   /locus_tag="hCG_1811980"
FT                   /product="signal peptide peptidase-like 2A"
FT                   /note="gene_id=hCG1811980.1 transcript_id=hCT1955474.1
FT                   protein_id=hCP1764811.1"
FT                   /db_xref="GOA:Q8TCT8"
FT                   /db_xref="HGNC:HGNC:30227"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="InterPro:IPR033151"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TCT8"
FT                   /protein_id="EAW77410.1"
FT                   VQQ"
FT   gene            7191808..7286803
FT                   /gene="AP4E1"
FT                   /locus_tag="hCG_39856"
FT                   /note="gene_id=hCG39856.3"
FT   mRNA            join(7191808..7191987,7195137..7195208,7198507..7198630,
FT                   7206991..7207064,7208158..7208279,7212068..7212227,
FT                   7214226..7214392,7218045..7218118,7224863..7224985,
FT                   7225087..7225196,7231440..7231581,7233247..7233357,
FT                   7233470..7233588,7241913..7242215,7251682..7251796,
FT                   7267444..7267567,7276801..7277056,7280757..7281314,
FT                   7282503..7282693,7284459..7284616,7285935..7286803)
FT                   /gene="AP4E1"
FT                   /locus_tag="hCG_39856"
FT                   /product="adaptor-related protein complex 4, epsilon 1
FT                   subunit"
FT                   /note="gene_id=hCG39856.3 transcript_id=hCT31108.2; splice
FT                   donor-acceptor pairs covered / total pairs = 20/20; created
FT                   on 26-AUG-2002"
FT   CDS             join(7191838..7191987,7195137..7195208,7198507..7198630,
FT                   7206991..7207064,7208158..7208279,7212068..7212227,
FT                   7214226..7214392,7218045..7218118,7224863..7224985,
FT                   7225087..7225196,7231440..7231581,7233247..7233357,
FT                   7233470..7233588,7241913..7242215,7251682..7251796,
FT                   7267444..7267567,7276801..7277056,7280757..7281314,
FT                   7282503..7282693,7284459..7284616,7285935..7286095)
FT                   /codon_start=1
FT                   /gene="AP4E1"
FT                   /locus_tag="hCG_39856"
FT                   /product="adaptor-related protein complex 4, epsilon 1
FT                   subunit"
FT                   /note="gene_id=hCG39856.3 transcript_id=hCT31108.2
FT                   protein_id=hCP49643.2"
FT                   /db_xref="GOA:Q9UPM8"
FT                   /db_xref="HGNC:HGNC:573"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017109"
FT                   /db_xref="InterPro:IPR028269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UPM8"
FT                   /protein_id="EAW77411.1"
FT   gene            7228024..7229573
FT                   /pseudo
FT                   /locus_tag="hCG_1786378"
FT                   /note="gene_id=hCG1786378.1"
FT   mRNA            7228024..7229573
FT                   /pseudo
FT                   /locus_tag="hCG_1786378"
FT                   /note="gene_id=hCG1786378.1 transcript_id=hCT1825413.1;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   gene            complement(7340019..7378136)
FT                   /gene="TNFAIP8L3"
FT                   /locus_tag="hCG_1644551"
FT                   /note="gene_id=hCG1644551.2"
FT   mRNA            complement(join(7340019..7341866,7377960..7378136))
FT                   /gene="TNFAIP8L3"
FT                   /locus_tag="hCG_1644551"
FT                   /product="tumor necrosis factor, alpha-induced protein
FT                   8-like 3"
FT                   /note="gene_id=hCG1644551.2 transcript_id=hCT1644678.2;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(7341304..7341866,7377960..7378011))
FT                   /codon_start=1
FT                   /gene="TNFAIP8L3"
FT                   /locus_tag="hCG_1644551"
FT                   /product="tumor necrosis factor, alpha-induced protein
FT                   8-like 3"
FT                   /note="gene_id=hCG1644551.2 transcript_id=hCT1644678.2
FT                   protein_id=hCP1614792.3"
FT                   /db_xref="GOA:Q5GJ75"
FT                   /db_xref="HGNC:HGNC:20620"
FT                   /db_xref="InterPro:IPR008477"
FT                   /db_xref="PDB:4Q9V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GJ75"
FT                   /protein_id="EAW77412.1"
FT   gene            complement(7492503..7622013)
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /note="gene_id=hCG39857.5"
FT   mRNA            complement(join(7492503..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526364,7621908..7622013))
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, transcript variant hCT31109"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT31109.4; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 23-FEB-2004"
FT   mRNA            complement(join(7492503..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526364,7607231..7607339,7621908..7622013))
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, transcript variant hCT1971585"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT1971585.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 23-FEB-2004"
FT   mRNA            complement(join(7492503..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526364,7538933..7539176,7621231..7621321,
FT                   7621908..7622013))
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, transcript variant hCT2288139"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT2288139.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 23-FEB-2004"
FT   mRNA            complement(join(7492503..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526364,7621910..7622010))
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, transcript variant hCT2288145"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT2288145.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 23-FEB-2004"
FT   CDS             complement(join(7494218..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526326))
FT                   /codon_start=1
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT2288139.1
FT                   protein_id=hCP1879575.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S8"
FT                   /protein_id="EAW77413.1"
FT   CDS             complement(join(7494218..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526326))
FT                   /codon_start=1
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT1971585.1
FT                   protein_id=hCP1783693.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S8"
FT                   /protein_id="EAW77414.1"
FT   CDS             complement(join(7494218..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526326))
FT                   /codon_start=1
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT2288145.1
FT                   protein_id=hCP1879574.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S8"
FT                   /protein_id="EAW77415.1"
FT   CDS             complement(join(7494218..7494466,7495730..7495971,
FT                   7498480..7498642,7499113..7499227,7501951..7502065,
FT                   7505759..7505935,7511192..7511346,7520272..7520422,
FT                   7526182..7526326))
FT                   /codon_start=1
FT                   /gene="CYP19A1"
FT                   /locus_tag="hCG_39857"
FT                   /product="cytochrome P450, family 19, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=hCG39857.5 transcript_id=hCT31109.4
FT                   protein_id=hCP49644.4 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S8"
FT                   /protein_id="EAW77416.1"
FT   gene            complement(7578569..7580249)
FT                   /locus_tag="hCG_1786379"
FT                   /note="gene_id=hCG1786379.2"
FT   mRNA            complement(7578569..7580249)
FT                   /locus_tag="hCG_1786379"
FT                   /product="hCG1786379"
FT                   /note="gene_id=hCG1786379.2 transcript_id=hCT1825414.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(7579087..7579536)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786379"
FT                   /product="hCG1786379"
FT                   /note="gene_id=hCG1786379.2 transcript_id=hCT1825414.2
FT                   protein_id=hCP1733652.1"
FT                   /protein_id="EAW77417.1"
FT   gene            7625082..7691416
FT                   /gene="GLDN"
FT                   /locus_tag="hCG_1790689"
FT                   /note="gene_id=hCG1790689.2"
FT   mRNA            join(7625082..7625460,7660862..7660913,7666849..7666866,
FT                   7667197..7667304,7678247..7678393,7680882..7681010,
FT                   7683604..7683687,7683785..7683910,7685005..7685155,
FT                   7687689..7691416)
FT                   /gene="GLDN"
FT                   /locus_tag="hCG_1790689"
FT                   /product="gliomedin, transcript variant hCT1829949"
FT                   /note="gene_id=hCG1790689.2 transcript_id=hCT1829949.2;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 07-OCT-2003"
FT   CDS             join(7625098..7625460,7660862..7660913,7666849..7666866,
FT                   7667197..7667304,7678247..7678393,7680882..7681010,
FT                   7683604..7683687,7683785..7683910,7685005..7685155,
FT                   7687689..7688166)
FT                   /codon_start=1
FT                   /gene="GLDN"
FT                   /locus_tag="hCG_1790689"
FT                   /product="gliomedin, isoform CRA_b"
FT                   /note="gene_id=hCG1790689.2 transcript_id=hCT1829949.2
FT                   protein_id=hCP1733642.1 isoform=CRA_b"
FT                   /protein_id="EAW77419.1"
FT   mRNA            join(<7625098..7625460,7631637..>7631693)
FT                   /gene="GLDN"
FT                   /locus_tag="hCG_1790689"
FT                   /product="gliomedin, transcript variant hCT2287292"
FT                   /note="gene_id=hCG1790689.2 transcript_id=hCT2287292.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 07-OCT-2003"
FT   CDS             join(7625098..7625460,7631637..>7631693)
FT                   /codon_start=1
FT                   /gene="GLDN"
FT                   /locus_tag="hCG_1790689"
FT                   /product="gliomedin, isoform CRA_a"
FT                   /note="gene_id=hCG1790689.2 transcript_id=hCT2287292.0
FT                   protein_id=hCP1879618.0 isoform=CRA_a"
FT                   /protein_id="EAW77418.1"
FT   gene            complement(7731122..7906161)
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /note="gene_id=hCG1786381.2"
FT   mRNA            complement(join(7731122..7732603,7733539..7733756,
FT                   7736960..7737051,7738561..7738638,7739476..7739603,
FT                   7739719..7739779,7740738..7740876,7741916..7742037,
FT                   7742119..7742205,7746789..7746906,7748085..7748286,
FT                   7748976..7749061,7749593..7749720,7754632..7754810,
FT                   7757753..7758001,7759998..7760125,7761680..7761756,
FT                   7763357..7763548,7763951..7765032,7769482..7769746,
FT                   7771363..7771528,7771957..7772054,7774987..7775156,
FT                   7778433..7778543,7781961..7783640,7786215..7786442,
FT                   7790543..7790662,7797851..7797968,7800487..7800576,
FT                   7819072..7819193,7819575..7820271,7820897..7821168,
FT                   7821622..7821861,7825742..7825916,7828992..7829175,
FT                   7830639..7830817,7846790..7846856,7847534..7847669,
FT                   7848497..7848575,7851896..7851967,7859465..7859590,
FT                   7905868..7906161))
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, transcript variant hCT2288132"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288132.0;
FT                   splice donor-acceptor pairs covered / total pairs = 41/41;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7731122..7732603,7733539..7733756,
FT                   7735055..7735107,7736960..7737051,7738561..7738638,
FT                   7739476..7739603,7739719..7739779,7740738..7740876,
FT                   7741916..7742037,7742119..7742205,7746789..7746906,
FT                   7748085..7748286,7748976..7749061,7749593..7749720,
FT                   7754632..7754810,7757753..7758001,7759998..7760125,
FT                   7761680..7761756,7763357..7763548,7763951..7765032,
FT                   7769482..7769746,7771363..7771528,7771957..7772054,
FT                   7774987..7775156,7778433..7778543,7781961..7783640,
FT                   7786215..7786442,7790543..7790662,7797851..7797968,
FT                   7800487..7800576,7819072..7819193,7819575..7820271,
FT                   7820897..7821168,7821622..7821861,7825742..7825916,
FT                   7828992..7829175,7830639..7830817,7846790..7846856,
FT                   7847534..7847669,7848497..7848575,7851896..7851967,
FT                   7859465..7859590,7905868..7906161))
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, transcript variant hCT2288133"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288133.0;
FT                   splice donor-acceptor pairs covered / total pairs = 42/42;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7731585..7731886,7731941..7732603,
FT                   7733539..7733756,7735055..7735107,7736960..7737051,
FT                   7738561..7738638,7739476..7739603,7739719..7739779,
FT                   7740738..7740876,7741916..7742037,7742119..7742205,
FT                   7746789..7746906,7748085..7748286,7748976..7749061,
FT                   7749593..7749720,7754632..7754810,7757753..7758001,
FT                   7759998..7760125,7761680..7761756,7763357..7763548,
FT                   7763951..7765032,7769482..7769746,7771363..7771528,
FT                   7771957..7772054,7774987..7775156,7778433..7778543,
FT                   7781961..7783640,7786215..7786442,7790543..7790662,
FT                   7797851..7797968,7800487..7800576,7819072..7819193,
FT                   7819575..7820271,7820897..7821168,7821622..7821861,
FT                   7825742..7825916,7828992..7829175,7830639..7830817,
FT                   7846790..7846856,7847534..7847669,7848497..7848575,
FT                   7851896..7851967,7859465..7859590,7905868..7906161))
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, transcript variant hCT2288136"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288136.0;
FT                   splice donor-acceptor pairs covered / total pairs = 43/43;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(7731585..7731886,7731941..7732603,
FT                   7733539..7733756,7735055..7735107,7736960..7737051,
FT                   7738561..7738638,7739476..7739603,7739719..7739779,
FT                   7740738..7740876,7741916..7742037,7742119..7742205,
FT                   7743008..7743070,7746789..7746906,7748085..7748286,
FT                   7748976..7749061,7749593..7749720,7754632..7754810,
FT                   7757753..7758001,7759998..7760128,7761680..7761756,
FT                   7763357..7763548,7763951..7765032,7769482..7769746,
FT                   7771363..7771528,7771957..7772054,7774987..7775156,
FT                   7778433..7778543,7781961..7783640,7786215..7786442,
FT                   7790543..7790662,7797851..7797968,7800487..7800576,
FT                   7819072..7819193,7819575..7820271,7820897..7821168,
FT                   7821622..7821861,7825742..7825916,7828992..7829175,
FT                   7830639..7830817,7846790..7846856,7847534..7847669,
FT                   7848497..7848575,7851896..7851967,7859465..7859590,
FT                   7905868..7906161))
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, transcript variant hCT1825416"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT1825416.2;
FT                   splice donor-acceptor pairs covered / total pairs = 44/44;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(7732394..7732603,7733539..7733756,
FT                   7735055..7735107,7736960..7737051,7738561..7738638,
FT                   7739476..7739603,7739719..7739779,7740738..7740876,
FT                   7741916..7742037,7742119..7742205,7746789..7746906,
FT                   7748085..7748286,7748976..7749061,7749593..7749720,
FT                   7754632..7754810,7757753..7758001,7759998..7760125,
FT                   7761680..7761756,7763357..7763548,7763951..7765032,
FT                   7769482..7769746,7771363..7771528,7771957..7772054,
FT                   7774987..7775156,7778433..7778543,7781961..7783640,
FT                   7786215..7786442,7790543..7790662,7797851..7797968,
FT                   7800487..7800576,7819072..7819193,7819575..7820271,
FT                   7820897..7821168,7821622..7821861,7825742..7825916,
FT                   7828992..7829175,7830639..7830817,7846790..7846856,
FT                   7847534..7847669,7848497..7848575,7851896..7851967,
FT                   7859465..7859590,7905868..7905954))
FT                   /codon_start=1
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, isoform CRA_c"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288133.0
FT                   protein_id=hCP1879586.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V2"
FT                   /protein_id="EAW77422.1"
FT   CDS             complement(join(7732394..7732603,7733539..7733756,
FT                   7735055..7735107,7736960..7737051,7738561..7738638,
FT                   7739476..7739603,7739719..7739779,7740738..7740876,
FT                   7741916..7742037,7742119..7742205,7746789..7746906,
FT                   7748085..7748286,7748976..7749061,7749593..7749720,
FT                   7754632..7754810,7757753..7758001,7759998..7760125,
FT                   7761680..7761756,7763357..7763548,7763951..7765032,
FT                   7769482..7769746,7771363..7771528,7771957..7772054,
FT                   7774987..7775156,7778433..7778543,7781961..7783640,
FT                   7786215..7786442,7790543..7790662,7797851..7797968,
FT                   7800487..7800576,7819072..7819193,7819575..7820271,
FT                   7820897..7821168,7821622..7821861,7825742..7825916,
FT                   7828992..7829175,7830639..7830817,7846790..7846856,
FT                   7847534..7847669,7848497..7848575,7851896..7851967,
FT                   7859465..7859590,7905868..7905954))
FT                   /codon_start=1
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, isoform CRA_c"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288136.0
FT                   protein_id=hCP1879587.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V2"
FT                   /protein_id="EAW77423.1"
FT   CDS             complement(join(7732394..7732603,7733539..7733756,
FT                   7735055..7735107,7736960..7737051,7738561..7738638,
FT                   7739476..7739603,7739719..7739779,7740738..7740876,
FT                   7741916..7742037,7742119..7742205,7743008..7743070,
FT                   7746789..7746906,7748085..7748286,7748976..7749061,
FT                   7749593..7749720,7754632..7754810,7757753..7758001,
FT                   7759998..7760128,7761680..7761756,7763357..7763548,
FT                   7763951..7765032,7769482..7769746,7771363..7771528,
FT                   7771957..7772054,7774987..7775156,7778433..7778543,
FT                   7781961..7783640,7786215..7786442,7790543..7790662,
FT                   7797851..7797968,7800487..7800576,7819072..7819193,
FT                   7819575..7820271,7820897..7821168,7821622..7821861,
FT                   7825742..7825916,7828992..7829175,7830639..7830817,
FT                   7846790..7846856,7847534..7847669,7848497..7848575,
FT                   7851896..7851967,7859465..7859590,7905868..7905954))
FT                   /codon_start=1
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, isoform CRA_d"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT1825416.2
FT                   protein_id=hCP1733738.2 isoform=CRA_d"
FT                   /protein_id="EAW77424.1"
FT                   LDIL"
FT   CDS             complement(join(7733681..7733756,7736960..7737051,
FT                   7738561..7738638,7739476..7739603,7739719..7739779,
FT                   7740738..7740876,7741916..7742037,7742119..7742205,
FT                   7746789..7746906,7748085..7748286,7748976..7749061,
FT                   7749593..7749720,7754632..7754810,7757753..7758001,
FT                   7759998..7760125,7761680..7761756,7763357..7763548,
FT                   7763951..7765032,7769482..7769746,7771363..7771528,
FT                   7771957..7772054,7774987..7775156,7778433..7778543,
FT                   7781961..7783640,7786215..7786442,7790543..7790662,
FT                   7797851..7797968,7800487..7800576,7819072..7819193,
FT                   7819575..7820271,7820897..7821168,7821622..7821861,
FT                   7825742..7825916,7828992..7829175,7830639..7830817,
FT                   7846790..7846856,7847534..7847669,7848497..7848575,
FT                   7851896..7851967,7859465..7859590,7905868..7905954))
FT                   /codon_start=1
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, isoform CRA_b"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288132.0
FT                   protein_id=hCP1879589.0 isoform=CRA_b"
FT                   /protein_id="EAW77421.1"
FT   mRNA            complement(join(<7851881..7851967,7859465..7859590,
FT                   7905868..7906161))
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, transcript variant hCT2288126"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288126.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<7851881..7851967,7859465..7859590,
FT                   7905868..7905954))
FT                   /codon_start=1
FT                   /gene="DMXL2"
FT                   /locus_tag="hCG_1786381"
FT                   /product="Dmx-like 2, isoform CRA_a"
FT                   /note="gene_id=hCG1786381.2 transcript_id=hCT2288126.0
FT                   protein_id=hCP1879590.0 isoform=CRA_a"
FT                   /protein_id="EAW77420.1"
FT   gene            7964767..8004376
FT                   /gene="SCG3"
FT                   /locus_tag="hCG_38751"
FT                   /note="gene_id=hCG38751.4"
FT   mRNA            join(7964767..7965251,7965931..7965983,7966493..7966538,
FT                   7966633..7966848,7971674..7971816,7972630..7972779,
FT                   7975569..7975746,7979285..7979401,7982733..7982816,
FT                   7984521..7984658,7996765..7996845,8002841..8004376)
FT                   /gene="SCG3"
FT                   /locus_tag="hCG_38751"
FT                   /product="secretogranin III, transcript variant hCT29996"
FT                   /note="gene_id=hCG38751.4 transcript_id=hCT29996.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   mRNA            join(7964767..7965251,7965931..7965983,7966493..7966538,
FT                   7971674..7971816,7972630..7972779,7975569..7975746,
FT                   7979285..7979401,7982733..7982816,7984521..7984658,
FT                   7996765..7996845,8002841..8004376)
FT                   /gene="SCG3"
FT                   /locus_tag="hCG_38751"
FT                   /product="secretogranin III, transcript variant hCT1971206"
FT                   /note="gene_id=hCG38751.4 transcript_id=hCT1971206.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             join(7965170..7965251,7965931..7965983,7966493..7966538,
FT                   7966633..7966848,7971674..7971816,7972630..7972779,
FT                   7975569..7975746,7979285..7979401,7982733..7982816,
FT                   7984521..7984658,7996765..7996845,8002841..8002959)
FT                   /codon_start=1
FT                   /gene="SCG3"
FT                   /locus_tag="hCG_38751"
FT                   /product="secretogranin III, isoform CRA_b"
FT                   /note="gene_id=hCG38751.4 transcript_id=hCT29996.3
FT                   protein_id=hCP49906.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8WXD2"
FT                   /db_xref="HGNC:HGNC:13707"
FT                   /db_xref="InterPro:IPR026197"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WXD2"
FT                   /protein_id="EAW77426.1"
FT                   EAIKRIYSSL"
FT   CDS             join(7965170..7965251,7965931..7965983,7966493..7966538,
FT                   7971674..7971816,7972630..7972779,7975569..7975746,
FT                   7979285..7979401,7982733..7982816,7984521..7984658,
FT                   7996765..7996845,8002841..8002959)
FT                   /codon_start=1
FT                   /gene="SCG3"
FT                   /locus_tag="hCG_38751"
FT                   /product="secretogranin III, isoform CRA_a"
FT                   /note="gene_id=hCG38751.4 transcript_id=hCT1971206.1
FT                   protein_id=hCP1783305.0 isoform=CRA_a"
FT                   /protein_id="EAW77425.1"
FT   gene            complement(8006503..8034927)
FT                   /gene="LYSMD2"
FT                   /locus_tag="hCG_40129"
FT                   /note="gene_id=hCG40129.2"
FT   mRNA            complement(join(8006503..8007082,8008223..8008554,
FT                   8020783..8021272,8034704..8034927))
FT                   /gene="LYSMD2"
FT                   /locus_tag="hCG_40129"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 2"
FT                   /note="gene_id=hCG40129.2 transcript_id=hCT31383.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 07-OCT-2003"
FT   CDS             complement(join(8007040..8007082,8008223..8008554,
FT                   8020783..8021055))
FT                   /codon_start=1
FT                   /gene="LYSMD2"
FT                   /locus_tag="hCG_40129"
FT                   /product="LysM, putative peptidoglycan-binding, domain
FT                   containing 2"
FT                   /note="gene_id=hCG40129.2 transcript_id=hCT31383.2
FT                   protein_id=hCP49905.2"
FT                   /protein_id="EAW77427.1"
FT   gene            8035025..8094454
FT                   /gene="TMOD2"
FT                   /locus_tag="hCG_1641013"
FT                   /note="gene_id=hCG1641013.3"
FT   mRNA            join(8035025..8035145,8049806..8050000,8051695..8051851,
FT                   8057145..8057267,8060365..8060451,8064477..8064607,
FT                   8066158..8066265,8081605..8081748,8089785..8089929,
FT                   8091828..8094454)
FT                   /gene="TMOD2"
FT                   /locus_tag="hCG_1641013"
FT                   /product="tropomodulin 2 (neuronal), transcript variant
FT                   hCT1641140"
FT                   /note="gene_id=hCG1641013.3 transcript_id=hCT1641140.3;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            join(8035030..8035145,8049806..8050000,8050504..8050585,
FT                   8051695..8051851,8057145..8057267,8060365..8060451,
FT                   8064477..8064607,8066158..8066265,8081605..8081748,
FT                   8089785..8089929,8091828..8093521)
FT                   /gene="TMOD2"
FT                   /locus_tag="hCG_1641013"
FT                   /product="tropomodulin 2 (neuronal), transcript variant
FT                   hCT2355771"
FT                   /note="gene_id=hCG1641013.3 transcript_id=hCT2355771.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 14-JUL-2004"
FT   CDS             join(8049875..8050000,8051695..8051851,8057145..8057267,
FT                   8060365..8060451,8064477..8064607,8066158..8066265,
FT                   8081605..8081748,8089785..8089929,8091828..8091862)
FT                   /codon_start=1
FT                   /gene="TMOD2"
FT                   /locus_tag="hCG_1641013"
FT                   /product="tropomodulin 2 (neuronal), isoform CRA_b"
FT                   /note="gene_id=hCG1641013.3 transcript_id=hCT1641140.3
FT                   protein_id=hCP1614826.2 isoform=CRA_b"
FT                   /protein_id="EAW77429.1"
FT                   VRKKRVEADRR"
FT   CDS             join(8051701..8051851,8057145..8057267,8060365..8060451,
FT                   8064477..8064607,8066158..8066265,8081605..8081748,
FT                   8089785..8089929,8091828..8091862)
FT                   /codon_start=1
FT                   /gene="TMOD2"
FT                   /locus_tag="hCG_1641013"
FT                   /product="tropomodulin 2 (neuronal), isoform CRA_a"
FT                   /note="gene_id=hCG1641013.3 transcript_id=hCT2355771.0
FT                   protein_id=hCP1920974.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5EA42"
FT                   /db_xref="HGNC:HGNC:11872"
FT                   /db_xref="InterPro:IPR004934"
FT                   /db_xref="InterPro:IPR030130"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:G5EA42"
FT                   /protein_id="EAW77428.1"
FT   gene            8142406..8144743
FT                   /locus_tag="hCG_1642671"
FT                   /note="gene_id=hCG1642671.2"
FT   mRNA            join(8142406..8144074,8144382..8144743)
FT                   /locus_tag="hCG_1642671"
FT                   /product="hCG1642671"
FT                   /note="gene_id=hCG1642671.2 transcript_id=hCT1642798.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             8143154..8143582
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642671"
FT                   /product="hCG1642671"
FT                   /note="gene_id=hCG1642671.2 transcript_id=hCT1642798.2
FT                   protein_id=hCP1614754.2"
FT                   /protein_id="EAW77430.1"
FT   gene            complement(8170986..8184542)
FT                   /locus_tag="hCG_2045353"
FT                   /note="gene_id=hCG2045353.0"
FT   mRNA            complement(join(8170986..8171138,8175778..8175900,
FT                   8182431..8182553,8184438..8184542))
FT                   /locus_tag="hCG_2045353"
FT                   /product="hCG2045353"
FT                   /note="gene_id=hCG2045353.0 transcript_id=hCT2360188.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             complement(join(8182446..8182553,8184438..8184458))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045353"
FT                   /product="hCG2045353"
FT                   /note="gene_id=hCG2045353.0 transcript_id=hCT2360188.0
FT                   protein_id=hCP1925409.0"
FT                   /protein_id="EAW77431.1"
FT   gene            complement(8221453..8255189)
FT                   /gene="LEO1"
FT                   /locus_tag="hCG_40127"
FT                   /note="gene_id=hCG40127.2"
FT   mRNA            complement(join(8221453..8221688,8230723..8230820,
FT                   8233240..8233426,8235276..8235411,8236561..8236695,
FT                   8243332..8243477,8244072..8244166,8245820..8245924,
FT                   8249182..8249937,8255120..8255189))
FT                   /gene="LEO1"
FT                   /locus_tag="hCG_40127"
FT                   /product="Leo1, Paf1/RNA polymerase II complex component,
FT                   homolog (S. cerevisiae), transcript variant hCT2288099"
FT                   /note="gene_id=hCG40127.2 transcript_id=hCT2288099.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8221453..8221688,8230723..8230820,
FT                   8233240..8233426,8235276..8235411,8236561..8236695,
FT                   8237913..8238007,8242175..8242259,8243332..8243477,
FT                   8244072..8244166,8245820..8245924,8249182..8249937,
FT                   8255120..8255189))
FT                   /gene="LEO1"
FT                   /locus_tag="hCG_40127"
FT                   /product="Leo1, Paf1/RNA polymerase II complex component,
FT                   homolog (S. cerevisiae), transcript variant hCT31381"
FT                   /note="gene_id=hCG40127.2 transcript_id=hCT31381.2; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(8221584..8221688,8230723..8230820,
FT                   8233240..8233426,8235276..8235411,8236561..8236695,
FT                   8243332..8243477,8244072..8244166,8245820..8245924,
FT                   8249182..8249937,8255120..8255177))
FT                   /codon_start=1
FT                   /gene="LEO1"
FT                   /locus_tag="hCG_40127"
FT                   /product="Leo1, Paf1/RNA polymerase II complex component,
FT                   homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=hCG40127.2 transcript_id=hCT2288099.0
FT                   protein_id=hCP1879577.0 isoform=CRA_a"
FT                   /protein_id="EAW77432.1"
FT   CDS             complement(join(8221584..8221688,8230723..8230820,
FT                   8233240..8233426,8235276..8235411,8236561..8236695,
FT                   8237913..8238007,8242175..8242259,8243332..8243477,
FT                   8244072..8244166,8245820..8245924,8249182..8249937,
FT                   8255120..8255177))
FT                   /codon_start=1
FT                   /gene="LEO1"
FT                   /locus_tag="hCG_40127"
FT                   /product="Leo1, Paf1/RNA polymerase II complex component,
FT                   homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=hCG40127.2 transcript_id=hCT31381.2
FT                   protein_id=hCP49903.3 isoform=CRA_b"
FT                   /protein_id="EAW77433.1"
FT   gene            8303735..8350931
FT                   /gene="MAPK6"
FT                   /locus_tag="hCG_32835"
FT                   /note="gene_id=hCG32835.2"
FT   mRNA            join(8303735..8303884,8330351..8331536,8334514..8334658,
FT                   8343131..8343295,8345797..8345998,8348352..8350931)
FT                   /gene="MAPK6"
FT                   /locus_tag="hCG_32835"
FT                   /product="mitogen-activated protein kinase 6"
FT                   /note="gene_id=hCG32835.2 transcript_id=hCT24027.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   CDS             join(8330982..8331536,8334514..8334658,8343131..8343295,
FT                   8345797..8345998,8348352..8349450)
FT                   /codon_start=1
FT                   /gene="MAPK6"
FT                   /locus_tag="hCG_32835"
FT                   /product="mitogen-activated protein kinase 6"
FT                   /note="gene_id=hCG32835.2 transcript_id=hCT24027.2
FT                   protein_id=hCP46198.3"
FT                   /protein_id="EAW77434.1"
FT   gene            complement(8394078..8397307)
FT                   /gene="BCL2L10"
FT                   /locus_tag="hCG_1786829"
FT                   /note="gene_id=hCG1786829.3"
FT   mRNA            complement(join(8394078..8394426,8396679..8397307))
FT                   /gene="BCL2L10"
FT                   /locus_tag="hCG_1786829"
FT                   /product="BCL2-like 10 (apoptosis facilitator)"
FT                   /note="gene_id=hCG1786829.3 transcript_id=hCT1825876.3;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 07-OCT-2003"
FT   CDS             complement(join(8394301..8394426,8396679..8397167))
FT                   /codon_start=1
FT                   /gene="BCL2L10"
FT                   /locus_tag="hCG_1786829"
FT                   /product="BCL2-like 10 (apoptosis facilitator)"
FT                   /note="gene_id=hCG1786829.3 transcript_id=hCT1825876.3
FT                   protein_id=hCP1733565.0"
FT                   /protein_id="EAW77435.1"
FT   gene            complement(8405406..8475828)
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /note="gene_id=hCG40503.4"
FT   mRNA            complement(join(8405406..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8434360..8434401,8438417..8438553,
FT                   8464245..8464356,8469028..8469171,8475781..8475828))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT1971251"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971251.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 20-JUN-2003"
FT   mRNA            complement(join(8405406..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356,
FT                   8469028..8469171,8475781..8475828))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT31763"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT31763.3; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(8405406..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464451))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT1971249"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971249.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 20-JUN-2003"
FT   mRNA            complement(join(8405412..8405633,8405683..8406777,
FT                   8406942..8407245,8408950..8409116,8410425..8410521,
FT                   8412672..8412720,8417856..8417947,8420091..8420234,
FT                   8434360..8434401,8438417..8438553,8464245..8464356,
FT                   8469028..8469171,8475781..8475828))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT2288075"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2288075.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/12;
FT                   created on 20-JUN-2003"
FT   mRNA            complement(join(8405412..8405633,8405683..8406777,
FT                   8406942..8407245,8408950..8409116,8410425..8410521,
FT                   8412672..8412720,8417856..8417947,8420091..8420234,
FT                   8425619..8425751,8431935..8432011,8434360..8434401,
FT                   8438417..8438553,8464245..8464356,8469028..8469171,
FT                   8475781..8475828))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT1971248"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971248.1;
FT                   splice donor-acceptor pairs covered / total pairs = 13/14;
FT                   created on 20-JUN-2003"
FT   mRNA            complement(join(8405412..8405633,8405683..8407245,
FT                   8408950..8409116,8410425..8410521,8412672..8412720,
FT                   8417856..8417947,8420091..8420234,8425619..8425751,
FT                   8431935..8432011,8434360..8434401,8438417..8438553,
FT                   8464245..8464451))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT1971250"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971250.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 20-JUN-2003"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8434360..8434401,8438417..8438553,
FT                   8464245..8464356,8469028..8469153))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_c"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971251.1
FT                   protein_id=hCP1783290.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5Y0"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Y0"
FT                   /protein_id="EAW77438.1"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8434360..8434401,8438417..8438553,
FT                   8464245..8464356,8469028..8469153))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_c"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2288075.0
FT                   protein_id=hCP1879596.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5Y0"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Y0"
FT                   /protein_id="EAW77444.1"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356,
FT                   8469028..8469153))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_b"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971248.1
FT                   protein_id=hCP1783308.1 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5V3"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V3"
FT                   /protein_id="EAW77437.1"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356,
FT                   8469028..8469153))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_b"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT31763.3
FT                   protein_id=hCP50266.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5V3"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V3"
FT                   /protein_id="EAW77443.1"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_a"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971250.1
FT                   protein_id=hCP1783334.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5R9"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R9"
FT                   /protein_id="EAW77436.1"
FT                   CSGSWDHTLRVWA"
FT   CDS             complement(join(8407234..8407245,8408950..8409116,
FT                   8410425..8410521,8412672..8412720,8417856..8417947,
FT                   8420091..8420234,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_a"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT1971249.0
FT                   protein_id=hCP1783323.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5R9"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5R9"
FT                   /protein_id="EAW77442.1"
FT                   CSGSWDHTLRVWA"
FT   mRNA            complement(join(8408874..8409116,8410425..8410521,
FT                   8412672..8412720,8417856..8417947,8420091..8420234,
FT                   8425619..8425751,8431935..8432011,8434360..8434401,
FT                   8438417..8438553,8464245..8464376))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT2341052"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2341052.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 20-JUN-2003"
FT   CDS             complement(join(8408896..8409116,8410425..8410521,
FT                   8412672..8412720,8417856..8417947,8420091..8420234,
FT                   8425619..8425751,8431935..8432011,8434360..8434401,
FT                   8438417..8438553,8464245..8464356))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_e"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2341052.0
FT                   protein_id=hCP1907637.0 isoform=CRA_e"
FT                   /protein_id="EAW77440.1"
FT   mRNA            complement(join(<8410463..8410521,8412672..8412720,
FT                   8417856..8417947,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464380))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT2341053"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2341053.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 20-JUN-2003"
FT   CDS             complement(join(<8410463..8410521,8412672..8412720,
FT                   8417856..8417947,8425619..8425751,8431935..8432011,
FT                   8434360..8434401,8438417..8438553,8464245..8464356))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_f"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2341053.0
FT                   protein_id=hCP1907636.0 isoform=CRA_f"
FT                   /protein_id="EAW77441.1"
FT                   DREVAIYSKES"
FT   mRNA            complement(join(8433757..8434401,8438417..8438553,
FT                   8464245..8464356,8469028..8469171,8475781..8475828))
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, transcript variant hCT2288078"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2288078.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 20-JUN-2003"
FT   CDS             complement(join(8434270..8434401,8438417..8438553,
FT                   8464245..8464356,8469028..8469153))
FT                   /codon_start=1
FT                   /gene="GNB5"
FT                   /locus_tag="hCG_40503"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta 5, isoform CRA_d"
FT                   /note="gene_id=hCG40503.4 transcript_id=hCT2288078.0
FT                   protein_id=hCP1879595.0 isoform=CRA_d"
FT                   /protein_id="EAW77439.1"
FT                   CPALS"
FT   gene            <8465466..>8489629
FT                   /locus_tag="hCG_2002436"
FT                   /note="gene_id=hCG2002436.0"
FT   mRNA            join(<8465466..8465679,8489346..>8489629)
FT                   /locus_tag="hCG_2002436"
FT                   /product="hCG2002436"
FT                   /note="gene_id=hCG2002436.0 transcript_id=hCT2287310.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(8465466..8465679,8489346..>8489629)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002436"
FT                   /product="hCG2002436"
FT                   /note="gene_id=hCG2002436.0 transcript_id=hCT2287310.0
FT                   protein_id=hCP1879601.0"
FT                   /protein_id="EAW77445.1"
FT                   RLC"
FT   gene            complement(8476784..8580801)
FT                   /gene="MYO5C"
FT                   /locus_tag="hCG_40501"
FT                   /note="gene_id=hCG40501.3"
FT   mRNA            complement(join(8476784..8478512,8479835..8479915,
FT                   8480767..8480941,8489322..8489604,8490273..8490423,
FT                   8493011..8493100,8496187..8496341,8497645..8497743,
FT                   8499060..8499147,8502977..8503145,8504217..8504280,
FT                   8505619..8505712,8507998..8508178,8509355..8509435,
FT                   8509529..8509592,8509893..8509986,8513587..8513767,
FT                   8517089..8517152,8520137..8520230,8521949..8522113,
FT                   8524200..8524346,8526514..8526679,8528822..8529033,
FT                   8529820..8529931,8530422..8530508,8531383..8531480,
FT                   8531924..8532058,8533166..8533249,8535855..8535980,
FT                   8537778..8537918,8541111..8541192,8545335..8545600,
FT                   8548663..8548769,8554231..8554338,8556241..8556322,
FT                   8557058..8557201,8560042..8560198,8563353..8563497,
FT                   8563989..8564154,8567262..8567372,8580644..8580801))
FT                   /gene="MYO5C"
FT                   /locus_tag="hCG_40501"
FT                   /product="myosin VC"
FT                   /note="gene_id=hCG40501.3 transcript_id=hCT31761.3; splice
FT                   donor-acceptor pairs covered / total pairs = 40/40; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(8478360..8478512,8479835..8479915,
FT                   8480767..8480941,8489322..8489604,8490273..8490423,
FT                   8493011..8493100,8496187..8496341,8497645..8497743,
FT                   8499060..8499147,8502977..8503145,8504217..8504280,
FT                   8505619..8505712,8507998..8508178,8509355..8509435,
FT                   8509529..8509592,8509893..8509986,8513587..8513767,
FT                   8517089..8517152,8520137..8520230,8521949..8522113,
FT                   8524200..8524346,8526514..8526679,8528822..8529033,
FT                   8529820..8529931,8530422..8530508,8531383..8531480,
FT                   8531924..8532058,8533166..8533249,8535855..8535980,
FT                   8537778..8537918,8541111..8541192,8545335..8545600,
FT                   8548663..8548769,8554231..8554338,8556241..8556322,
FT                   8557058..8557201,8560042..8560198,8563353..8563497,
FT                   8563989..8564154,8567262..8567372,8580644..8580670))
FT                   /codon_start=1
FT                   /gene="MYO5C"
FT                   /locus_tag="hCG_40501"
FT                   /product="myosin VC"
FT                   /note="gene_id=hCG40501.3 transcript_id=hCT31761.3
FT                   protein_id=hCP50264.3"
FT                   /protein_id="EAW77446.1"
FT   assembly_gap    8579792..8579811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8596877..8814121)
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /note="gene_id=hCG1786830.2"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8621500..8621593,
FT                   8625234..8625432,8631404..8631504,8636297..8636524,
FT                   8638648..8638701,8638914..8639057,8645010..8645123,
FT                   8649596..8649744,8652071..8652164,8655204..8655452,
FT                   8657162..8657401,8660345..8660501,8661388..8661599,
FT                   8664670..8664778,8664867..8664953,8668137..8668234,
FT                   8669207..8669368,8672877..8672960,8674286..8674411,
FT                   8676978..8677118,8681364..8681445,8682249..8682514,
FT                   8690333..8690439,8692338..8692445,8693105..8693186,
FT                   8695378..8695521,8701191..8701347,8710879..8711023,
FT                   8713446..8713617,8718235..8718345,8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289387"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289387.0;
FT                   splice donor-acceptor pairs covered / total pairs = 36/37;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8625234..8625432,8631404..8631504,
FT                   8636297..8636524,8638648..8638701,8638914..8639057,
FT                   8645010..8645123,8649596..8649744,8652071..8652164,
FT                   8655204..8655452,8657162..8657401,8660345..8660501,
FT                   8661388..8661599,8664670..8664778,8664867..8664953,
FT                   8668137..8668234,8669207..8669368,8672877..8672960,
FT                   8674286..8674411,8676978..8677118,8681364..8681445,
FT                   8682249..8682514,8690333..8690439,8692338..8692445,
FT                   8693105..8693186,8695378..8695521,8701191..8701347,
FT                   8710879..8711023,8713446..8713617,8718235..8718345,
FT                   8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289392"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289392.0;
FT                   splice donor-acceptor pairs covered / total pairs = 38/38;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8621500..8621593,
FT                   8622847..8622921,8625234..8625432,8631404..8631504,
FT                   8636297..8636524,8638648..8638701,8638914..8639057,
FT                   8645010..8645123,8649596..8649744,8652071..8652164,
FT                   8655204..8655452,8657162..8657401,8660345..8660501,
FT                   8661388..8661599,8664670..8664778,8664867..8664953,
FT                   8668137..8668234,8669207..8669368,8672877..8672960,
FT                   8674286..8674411,8676978..8677118,8681364..8681445,
FT                   8682249..8682514,8690333..8690439,8692338..8692445,
FT                   8693105..8693186,8695378..8695521,8701191..8701347,
FT                   8710879..8711023,8713446..8713617,8718235..8718345,
FT                   8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289388"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289388.0;
FT                   splice donor-acceptor pairs covered / total pairs = 37/38;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8622847..8622921,8625234..8625432,
FT                   8631404..8631504,8636297..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289393"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289393.0;
FT                   splice donor-acceptor pairs covered / total pairs = 39/39;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615386..8615536,
FT                   8621500..8621593,8625234..8625432,8628160..8628240,
FT                   8631404..8631504,8636297..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT1825877"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT1825877.2;
FT                   splice donor-acceptor pairs covered / total pairs = 39/39;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602150,8602225..8602265,8604103..8604385,
FT                   8606402..8606552,8608397..8608486,8612894..8613048,
FT                   8615390..8615536,8621500..8621593,8622847..8622921,
FT                   8625234..8625432,8628160..8628240,8631404..8631504,
FT                   8636297..8636524,8638648..8638701,8638914..8639057,
FT                   8645010..8645123,8649596..8649744,8652071..8652164,
FT                   8655204..8655452,8657162..8657401,8660345..8660501,
FT                   8661388..8661599,8664670..8664778,8664867..8664953,
FT                   8668137..8668234,8669207..8669368,8672877..8672960,
FT                   8674286..8674411,8676978..8677118,8681364..8681445,
FT                   8682249..8682514,8690333..8690439,8692338..8692445,
FT                   8693105..8693186,8695378..8695521,8701191..8701347,
FT                   8710879..8711023,8713446..8713617,8718235..8718345,
FT                   8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289391"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289391.0;
FT                   splice donor-acceptor pairs covered / total pairs = 41/41;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8596877..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8625234..8625432,8628160..8628240,
FT                   8631404..8631504,8636291..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8814121))
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin),
FT                   transcript variant hCT2289390"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289390.0;
FT                   splice donor-acceptor pairs covered / total pairs = 39/39;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(8598739..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8621500..8621593,
FT                   8625234..8625432,8631404..8631504,8636297..8636524,
FT                   8638648..8638701,8638914..8639057,8645010..8645123,
FT                   8649596..8649744,8652071..8652164,8655204..8655452,
FT                   8657162..8657401,8660345..8660501,8661388..8661599,
FT                   8664670..8664778,8664867..8664953,8668137..8668234,
FT                   8669207..8669368,8672877..8672960,8674286..8674411,
FT                   8676978..8677118,8681364..8681445,8682249..8682514,
FT                   8690333..8690439,8692338..8692445,8693105..8693186,
FT                   8695378..8695521,8701191..8701347,8710879..8711023,
FT                   8713446..8713617,8718235..8718345,8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289387.0
FT                   protein_id=hCP1879633.0 isoform=CRA_b"
FT                   /protein_id="EAW77448.1"
FT   CDS             complement(join(8598739..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8625234..8625432,8631404..8631504,
FT                   8636297..8636524,8638648..8638701,8638914..8639057,
FT                   8645010..8645123,8649596..8649744,8652071..8652164,
FT                   8655204..8655452,8657162..8657401,8660345..8660501,
FT                   8661388..8661599,8664670..8664778,8664867..8664953,
FT                   8668137..8668234,8669207..8669368,8672877..8672960,
FT                   8674286..8674411,8676978..8677118,8681364..8681445,
FT                   8682249..8682514,8690333..8690439,8692338..8692445,
FT                   8693105..8693186,8695378..8695521,8701191..8701347,
FT                   8710879..8711023,8713446..8713617,8718235..8718345,
FT                   8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289392.0
FT                   protein_id=hCP1879631.0 isoform=CRA_d"
FT                   /protein_id="EAW77450.1"
FT                   SLGLGFISRV"
FT   CDS             complement(join(8598739..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8621500..8621593,
FT                   8622847..8622921,8625234..8625432,8631404..8631504,
FT                   8636297..8636524,8638648..8638701,8638914..8639057,
FT                   8645010..8645123,8649596..8649744,8652071..8652164,
FT                   8655204..8655452,8657162..8657401,8660345..8660501,
FT                   8661388..8661599,8664670..8664778,8664867..8664953,
FT                   8668137..8668234,8669207..8669368,8672877..8672960,
FT                   8674286..8674411,8676978..8677118,8681364..8681445,
FT                   8682249..8682514,8690333..8690439,8692338..8692445,
FT                   8693105..8693186,8695378..8695521,8701191..8701347,
FT                   8710879..8711023,8713446..8713617,8718235..8718345,
FT                   8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289388.0
FT                   protein_id=hCP1879634.0 isoform=CRA_a"
FT                   /protein_id="EAW77447.1"
FT   CDS             complement(join(8598739..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8622847..8622921,8625234..8625432,
FT                   8631404..8631504,8636297..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289393.0
FT                   protein_id=hCP1879635.0 isoform=CRA_e"
FT                   /protein_id="EAW77451.1"
FT   CDS             complement(join(8598739..8598891,8599166..8599246,
FT                   8602091..8602265,8604103..8604385,8606402..8606552,
FT                   8608397..8608486,8612894..8613048,8615390..8615536,
FT                   8621500..8621593,8625234..8625432,8628160..8628240,
FT                   8631404..8631504,8636291..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289390.0
FT                   protein_id=hCP1879629.0 isoform=CRA_c"
FT                   /protein_id="EAW77449.1"
FT   CDS             complement(join(8602140..8602150,8602225..8602265,
FT                   8604103..8604385,8606402..8606552,8608397..8608486,
FT                   8612894..8613048,8615390..8615536,8621500..8621593,
FT                   8622847..8622921,8625234..8625432,8628160..8628240,
FT                   8631404..8631504,8636297..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_f"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT2289391.0
FT                   protein_id=hCP1879632.0 isoform=CRA_f"
FT                   /protein_id="EAW77452.1"
FT                   NR"
FT   CDS             complement(join(8612967..8613048,8615386..8615536,
FT                   8621500..8621593,8625234..8625432,8628160..8628240,
FT                   8631404..8631504,8636297..8636524,8638648..8638701,
FT                   8638914..8639057,8645010..8645123,8649596..8649744,
FT                   8652071..8652164,8655204..8655452,8657162..8657401,
FT                   8660345..8660501,8661388..8661599,8664670..8664778,
FT                   8664867..8664953,8668137..8668234,8669207..8669368,
FT                   8672877..8672960,8674286..8674411,8676978..8677118,
FT                   8681364..8681445,8682249..8682514,8690333..8690439,
FT                   8692338..8692445,8693105..8693186,8695378..8695521,
FT                   8701191..8701347,8710879..8711023,8713446..8713617,
FT                   8718235..8718345,8813845..8813871))
FT                   /codon_start=1
FT                   /gene="MYO5A"
FT                   /locus_tag="hCG_1786830"
FT                   /product="myosin VA (heavy polypeptide 12, myoxin), isoform
FT                   CRA_g"
FT                   /note="gene_id=hCG1786830.2 transcript_id=hCT1825877.2
FT                   protein_id=hCP1733724.1 isoform=CRA_g"
FT                   /protein_id="EAW77453.1"
FT   gene            8790235..8790981
FT                   /pseudo
FT                   /locus_tag="hCG_1640317"
FT                   /note="gene_id=hCG1640317.3"
FT   mRNA            8790235..8790981
FT                   /pseudo
FT                   /locus_tag="hCG_1640317"
FT                   /note="gene_id=hCG1640317.3 transcript_id=hCT2287104.1;
FT                   overlap evidence=yes; created on 22-DEC-2003"
FT   gene            complement(8832106..8854230)
FT                   /gene="ARPP-19"
FT                   /locus_tag="hCG_40502"
FT                   /note="gene_id=hCG40502.5"
FT   mRNA            complement(join(8832106..8837164,8842164..8842286,
FT                   8853911..8853965,8854179..8854230))
FT                   /gene="ARPP-19"
FT                   /locus_tag="hCG_40502"
FT                   /product="cyclic AMP phosphoprotein, 19 kD, transcript
FT                   variant hCT2355733"
FT                   /note="gene_id=hCG40502.5 transcript_id=hCT2355733.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(8832138..8837164,8842164..8842286,
FT                   8853911..8854186))
FT                   /gene="ARPP-19"
FT                   /locus_tag="hCG_40502"
FT                   /product="cyclic AMP phosphoprotein, 19 kD, transcript
FT                   variant hCT31762"
FT                   /note="gene_id=hCG40502.5 transcript_id=hCT31762.4; splice
FT                   donor-acceptor pairs covered / total pairs = 2/2; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(8836994..8837164,8842164..8842286,
FT                   8853911..8853955))
FT                   /codon_start=1
FT                   /gene="ARPP-19"
FT                   /locus_tag="hCG_40502"
FT                   /product="cyclic AMP phosphoprotein, 19 kD, isoform CRA_a"
FT                   /note="gene_id=hCG40502.5 transcript_id=hCT2355733.0
FT                   protein_id=hCP1920957.0 isoform=CRA_a"
FT                   /db_xref="GOA:P56211"
FT                   /db_xref="HGNC:HGNC:16967"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56211"
FT                   /protein_id="EAW77454.1"
FT                   LVASKLAG"
FT   CDS             complement(join(8836994..8837164,8842164..8842286,
FT                   8853911..8853955))
FT                   /codon_start=1
FT                   /gene="ARPP-19"
FT                   /locus_tag="hCG_40502"
FT                   /product="cyclic AMP phosphoprotein, 19 kD, isoform CRA_a"
FT                   /note="gene_id=hCG40502.5 transcript_id=hCT31762.4
FT                   protein_id=hCP50265.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U3"
FT                   /protein_id="EAW77455.1"
FT                   LVASKLAG"
FT   gene            8862905..8883611
FT                   /locus_tag="hCG_2045350"
FT                   /note="gene_id=hCG2045350.0"
FT   mRNA            join(8862905..8863138,8869892..8870001,8875735..8875834,
FT                   8883586..8883611)
FT                   /locus_tag="hCG_2045350"
FT                   /product="hCG2045350"
FT                   /note="gene_id=hCG2045350.0 transcript_id=hCT2360185.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             8863017..8863130
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045350"
FT                   /product="hCG2045350"
FT                   /note="gene_id=hCG2045350.0 transcript_id=hCT2360185.0
FT                   protein_id=hCP1925406.0"
FT                   /protein_id="EAW77456.1"
FT   gene            complement(8866396..8964398)
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /note="gene_id=hCG40504.3"
FT   mRNA            complement(join(8866396..8867370,8869804..8870003,
FT                   8872115..8872278,8878637..8878795,8885171..8885279,
FT                   8886130..8886209,8890181..8890294,8893616..8895431,
FT                   8896178..8896303,8896623..8896825,8898719..8898903,
FT                   8963070..8963186,8963494..8963698))
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, transcript variant hCT2355738"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2355738.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(8866410..8867370,8869804..8870003,
FT                   8872210..8872278,8878633..8878795,8885171..8885279,
FT                   8886130..8886209,8890181..8890294,8893616..8895431,
FT                   8896178..8896303,8896623..8896825,8898719..8898903,
FT                   8963070..8963186,8964340..8964398))
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, transcript variant hCT31764"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT31764.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/12; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(8866410..8866923,8866982..8867370,
FT                   8869804..8870003,8872210..8872310,8878633..8878795,
FT                   8885171..8885279,8886130..8886209,8890181..8890294,
FT                   8893616..8895431,8896178..8896303,8896623..8896825,
FT                   8898719..8898903,8963070..8963186,8964340..8964398))
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, transcript variant hCT2289384"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2289384.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/13;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(8866727..8867370,8869804..8870003,
FT                   8872210..8872278,8878637..8878795,8885171..8885279,
FT                   8886130..8886209,8890181..8890294,8893616..8895431,
FT                   8896178..8896303,8896623..8896825,8898719..8898903,
FT                   8963070..8963186,8963636..8963676))
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, transcript variant hCT2355737"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2355737.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(8867217..8867370,8869804..8870003,
FT                   8872210..8872278,8878637..8878795,8885171..8885279,
FT                   8886130..8886209,8890181..8890294,8893616..8895431,
FT                   8896178..8896303,8896623..8896825,8898719..8898903,
FT                   8963070..8963085))
FT                   /codon_start=1
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, isoform CRA_b"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2355737.0
FT                   protein_id=hCP1920958.0 isoform=CRA_b"
FT                   /protein_id="EAW77458.1"
FT   CDS             complement(join(8867217..8867370,8869804..8870003,
FT                   8872210..8872310,8878633..8878795,8885171..8885279,
FT                   8886130..8886209,8890181..8890294,8893616..8895431,
FT                   8896178..8896303,8896623..8896825,8898719..8898903,
FT                   8963070..8963085))
FT                   /codon_start=1
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, isoform CRA_a"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2289384.0
FT                   protein_id=hCP1879628.0 isoform=CRA_a"
FT                   /protein_id="EAW77457.1"
FT   CDS             complement(join(8872195..8872278,8878637..8878795,
FT                   8885171..8885279,8886130..8886209,8890181..8890294,
FT                   8893616..8895431,8896178..8896303,8896623..8896825,
FT                   8898719..8898903,8963070..8963085))
FT                   /codon_start=1
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, isoform CRA_d"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT2355738.0
FT                   protein_id=hCP1920959.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q32MH5"
FT                   /db_xref="HGNC:HGNC:25609"
FT                   /db_xref="InterPro:IPR025261"
FT                   /db_xref="InterPro:IPR033473"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q32MH5"
FT                   /protein_id="EAW77460.1"
FT   CDS             complement(join(8872250..8872278,8878633..8878795,
FT                   8885171..8885279,8886130..8886209,8890181..8890294,
FT                   8893616..8895431,8896178..8896303,8896623..8896825,
FT                   8898719..8898903,8963070..8963085))
FT                   /codon_start=1
FT                   /gene="KIAA1370"
FT                   /locus_tag="hCG_40504"
FT                   /product="KIAA1370, isoform CRA_c"
FT                   /note="gene_id=hCG40504.3 transcript_id=hCT31764.3
FT                   protein_id=hCP50267.2 isoform=CRA_c"
FT                   /protein_id="EAW77459.1"
FT                   APSPYMARCDYFRVPW"
FT   assembly_gap    9006027..9006046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9041936..9075001)
FT                   /gene="ONECUT1"
FT                   /locus_tag="hCG_37703"
FT                   /note="gene_id=hCG37703.3"
FT   mRNA            complement(join(9041936..9042819,9073769..9075001))
FT                   /gene="ONECUT1"
FT                   /locus_tag="hCG_37703"
FT                   /product="one cut domain, family member 1"
FT                   /note="gene_id=hCG37703.3 transcript_id=hCT28937.2; splice
FT                   donor-acceptor pairs covered / total pairs = 1/1; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(9042527..9042819,9073769..9074873))
FT                   /codon_start=1
FT                   /gene="ONECUT1"
FT                   /locus_tag="hCG_37703"
FT                   /product="one cut domain, family member 1"
FT                   /note="gene_id=hCG37703.3 transcript_id=hCT28937.2
FT                   protein_id=hCP47675.1"
FT                   /db_xref="GOA:Q9UBC0"
FT                   /db_xref="HGNC:HGNC:8138"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003350"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UBC0"
FT                   /protein_id="EAW77461.1"
FT                   SSTCTKA"
FT   assembly_gap    9079194..9080037
FT                   /estimated_length=844
FT                   /gap_type="unknown"
FT   gene            9170709..9171587
FT                   /pseudo
FT                   /locus_tag="hCG_1644502"
FT                   /note="gene_id=hCG1644502.2"
FT   mRNA            9170709..9171587
FT                   /pseudo
FT                   /locus_tag="hCG_1644502"
FT                   /note="gene_id=hCG1644502.2 transcript_id=hCT1644629.3;
FT                   overlap evidence=yes; created on 30-JAN-2004"
FT   gene            complement(9222290..9223645)
FT                   /pseudo
FT                   /locus_tag="hCG_1639870"
FT                   /note="gene_id=hCG1639870.4"
FT   mRNA            complement(9222290..9223645)
FT                   /pseudo
FT                   /locus_tag="hCG_1639870"
FT                   /note="gene_id=hCG1639870.4 transcript_id=hCT1639997.4;
FT                   overlap evidence=yes; created on 22-DEC-2003"
FT   gene            complement(9800127..10044605)
FT                   /locus_tag="hCG_1786738"
FT                   /note="gene_id=hCG1786738.3"
FT   mRNA            complement(join(9800127..9802713,9808177..9808281,
FT                   9882028..9882223,9894462..9894541,9898613..9898704,
FT                   9900373..9901190,9950519..9950715,9984697..9984892,
FT                   9987079..9987299,9989936..9990181,9990875..9991022,
FT                   9995789..9995885,9996268..9996413,9997704..9997823,
FT                   9999367..9999443,10000126..10000300,10001540..10001618,
FT                   10007737..10007843,10017940..10018104,10044576..10044605))
FT                   /locus_tag="hCG_1786738"
FT                   /product="hCG1786738, transcript variant hCT2355685"
FT                   /note="gene_id=hCG1786738.3 transcript_id=hCT2355685.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(9800127..9802713,9808177..9808281,
FT                   9882028..9882223,9894462..9894541,9898613..9898704,
FT                   9900373..9901190,9950519..9950715,9984689..9984892,
FT                   9987079..9987299,9989936..9990181,9990875..9991022,
FT                   9995789..9995885,9996268..9996413,9997704..9997823,
FT                   9999367..9999443,10000126..10000300,10001540..10001618,
FT                   10007737..10007843,10017940..10018104,10044576..10044605))
FT                   /locus_tag="hCG_1786738"
FT                   /product="hCG1786738, transcript variant hCT1825784"
FT                   /note="gene_id=hCG1786738.3 transcript_id=hCT1825784.3;
FT                   splice donor-acceptor pairs covered / total pairs = 18/19;
FT                   created on 07-OCT-2003"
FT   gene            complement(9802279..9825680)
FT                   /locus_tag="hCG_1798577"
FT                   /note="gene_id=hCG1798577.1"
FT   mRNA            complement(join(9802279..9802713,9808177..9808281,
FT                   9825625..9825680))
FT                   /locus_tag="hCG_1798577"
FT                   /product="hCG1798577"
FT                   /note="gene_id=hCG1798577.1 transcript_id=hCT1837837.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(9802334..9802495)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1798577"
FT                   /product="hCG1798577"
FT                   /note="gene_id=hCG1798577.1 transcript_id=hCT1837837.1
FT                   protein_id=hCP1733793.1"
FT                   /protein_id="EAW77464.1"
FT                   TDTNLILL"
FT   CDS             complement(join(9802658..9802713,9808177..9808281,
FT                   9882028..9882223,9894462..9894541,9898613..9898704,
FT                   9900373..9901190,9950519..9950715,9984697..9984892,
FT                   9987079..9987299,9989936..9990181,9990875..9991022,
FT                   9995789..9995885,9996268..9996413,9997704..9997823,
FT                   9999367..9999443,10000126..10000300,10001540..10001618,
FT                   10007737..10007843,10017940..10018092))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786738"
FT                   /product="hCG1786738, isoform CRA_a"
FT                   /note="gene_id=hCG1786738.3 transcript_id=hCT2355685.0
FT                   protein_id=hCP1920911.0 isoform=CRA_a"
FT                   /protein_id="EAW77462.1"
FT   CDS             complement(join(9950641..9950715,9984689..9984892,
FT                   9987079..9987299,9989936..9990181,9990875..9991022,
FT                   9995789..9995885,9996268..9996413,9997704..9997823,
FT                   9999367..9999443,10000126..10000300,10001540..10001618,
FT                   10007737..10007843,10017940..10018092))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786738"
FT                   /product="hCG1786738, isoform CRA_b"
FT                   /note="gene_id=hCG1786738.3 transcript_id=hCT1825784.3
FT                   protein_id=hCP1733414.3 isoform=CRA_b"
FT                   /protein_id="EAW77463.1"
FT   gene            complement(9999299..10030942)
FT                   /locus_tag="hCG_2002193"
FT                   /note="gene_id=hCG2002193.0"
FT   mRNA            complement(join(9999299..9999443,10000126..10000300,
FT                   10001540..10001618,10007737..10007843,10012483..10012590,
FT                   10017940..10018104,10028472..10028626,10030858..10030942))
FT                   /locus_tag="hCG_2002193"
FT                   /product="hCG2002193"
FT                   /note="gene_id=hCG2002193.0 transcript_id=hCT2286877.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/7;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(9999313..9999443,10000126..10000300,
FT                   10001540..10001618,10007737..10007843,10012483..10012590,
FT                   10017940..10018104,10028472..10028492))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002193"
FT                   /product="hCG2002193"
FT                   /note="gene_id=hCG2002193.0 transcript_id=hCT2286877.0
FT                   protein_id=hCP1879648.0"
FT                   /protein_id="EAW77465.1"
FT   gene            10298108..>10301113
FT                   /locus_tag="hCG_1646520"
FT                   /note="gene_id=hCG1646520.1"
FT   mRNA            10298108..>10301113
FT                   /locus_tag="hCG_1646520"
FT                   /product="hCG1646520"
FT                   /note="gene_id=hCG1646520.1 transcript_id=hCT1646647.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             10298117..10301113
FT                   /codon_start=1
FT                   /locus_tag="hCG_1646520"
FT                   /product="hCG1646520"
FT                   /note="gene_id=hCG1646520.1 transcript_id=hCT1646647.1
FT                   protein_id=hCP1632152.0"
FT                   /protein_id="EAW77466.1"
FT                   KILAGGIHV"
FT   gene            complement(10333410..>10387691)
FT                   /locus_tag="hCG_1645885"
FT                   /note="gene_id=hCG1645885.2"
FT   mRNA            complement(10333410..10335192)
FT                   /locus_tag="hCG_1645885"
FT                   /product="hCG1645885, transcript variant hCT2286869"
FT                   /note="gene_id=hCG1645885.2 transcript_id=hCT2286869.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   mRNA            complement(join(10333415..10334408,10369162..10369216,
FT                   10381869..10381998,10387577..>10387691))
FT                   /locus_tag="hCG_1645885"
FT                   /product="hCG1645885, transcript variant hCT1646012"
FT                   /note="gene_id=hCG1645885.2 transcript_id=hCT1646012.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(10333890..10334408,10369162..10369216,
FT                   10381869..10381998,10387577..10387691))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1645885"
FT                   /product="hCG1645885, isoform CRA_b"
FT                   /note="gene_id=hCG1645885.2 transcript_id=hCT1646012.2
FT                   protein_id=hCP1632171.2 isoform=CRA_b"
FT                   /protein_id="EAW77468.1"
FT   CDS             complement(10333890..10334219)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1645885"
FT                   /product="hCG1645885, isoform CRA_a"
FT                   /note="gene_id=hCG1645885.2 transcript_id=hCT2286869.0
FT                   protein_id=hCP1879647.0 isoform=CRA_a"
FT                   /protein_id="EAW77467.1"
FT                   EEQTM"
FT   gene            <10482328..>10604401
FT                   /locus_tag="hCG_2002152"
FT                   /note="gene_id=hCG2002152.0"
FT   mRNA            join(<10482328..10482401,10520226..10520304,
FT                   10522815..10522886,10535386..10535605,10535673..10535815,
FT                   10549287..10549569,10550529..10550670,10579047..10579216,
FT                   10582963..10583078,10585362..10585525,10604344..>10604401)
FT                   /locus_tag="hCG_2002152"
FT                   /product="hCG2002152"
FT                   /note="gene_id=hCG2002152.0 transcript_id=hCT2286815.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/10;
FT                   created on 26-AUG-2002"
FT   CDS             join(10482328..10482401,10520226..10520304,
FT                   10522815..10522886,10535386..10535605,10535673..10535815,
FT                   10549287..10549569,10550529..10550670,10579047..10579216,
FT                   10582963..10583078,10585362..10585525,10604344..>10604401)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002152"
FT                   /product="hCG2002152"
FT                   /note="gene_id=hCG2002152.0 transcript_id=hCT2286815.0
FT                   protein_id=hCP1879653.0"
FT                   /protein_id="EAW77469.1"
FT   gene            <10607139..>10714140
FT                   /locus_tag="hCG_2002153"
FT                   /note="gene_id=hCG2002153.0"
FT   mRNA            join(<10607139..10607243,10617191..10617259,
FT                   10618915..10619004,10623509..10623637,10678194..10678327,
FT                   10700133..10700218,10714106..>10714140)
FT                   /locus_tag="hCG_2002153"
FT                   /product="hCG2002153"
FT                   /note="gene_id=hCG2002153.0 transcript_id=hCT2286816.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(10607139..10607243,10617191..10617259,
FT                   10618915..10619004,10623509..10623637,10678194..10678327,
FT                   10700133..10700218,10714106..>10714140)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002153"
FT                   /product="hCG2002153"
FT                   /note="gene_id=hCG2002153.0 transcript_id=hCT2286816.0
FT                   protein_id=hCP1879652.0"
FT                   /protein_id="EAW77470.1"
FT   gene            10853024..10913812
FT                   /locus_tag="hCG_38864"
FT                   /note="gene_id=hCG38864.2"
FT   mRNA            join(10853024..10853053,10907542..10907634,
FT                   10909010..10909169,10912037..10913812)
FT                   /locus_tag="hCG_38864"
FT                   /product="hCG38864"
FT                   /note="gene_id=hCG38864.2 transcript_id=hCT30110.3; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             join(10909048..10909169,10912037..10912322)
FT                   /codon_start=1
FT                   /locus_tag="hCG_38864"
FT                   /product="hCG38864"
FT                   /note="gene_id=hCG38864.2 transcript_id=hCT30110.3
FT                   protein_id=hCP49568.3"
FT                   /db_xref="HGNC:HGNC:23149"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C4DGH4"
FT                   /protein_id="EAW77471.1"
FT   gene            11335711..11371467
FT                   /locus_tag="hCG_2044149"
FT                   /note="gene_id=hCG2044149.0"
FT   mRNA            join(11335711..11335876,11370812..11371467)
FT                   /locus_tag="hCG_2044149"
FT                   /product="hCG2044149"
FT                   /note="gene_id=hCG2044149.0 transcript_id=hCT2351315.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 04-MAR-2004"
FT   CDS             11370991..11371215
FT                   /codon_start=1
FT                   /locus_tag="hCG_2044149"
FT                   /product="hCG2044149"
FT                   /note="gene_id=hCG2044149.0 transcript_id=hCT2351315.0
FT                   protein_id=hCP1916545.0"
FT                   /protein_id="EAW77472.1"
FT   gene            complement(11459913..11475673)
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /note="gene_id=hCG40053.3"
FT   mRNA            complement(join(11459913..11460828,11461918..11462003,
FT                   11463965..11464028,11469578..11469650,11471323..11471436,
FT                   11475413..11475673))
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, transcript
FT                   variant hCT31306"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT31306.2; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(11459913..11460828,11461918..11462003,
FT                   11463965..11464028,11469578..11469650,11471323..11471436,
FT                   11473907..11474194,11475413..11475514))
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, transcript
FT                   variant hCT1971229"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT1971229.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(11459916..11460290,11460307..11460828,
FT                   11461918..11462003,11463965..11464028,11469578..11469650,
FT                   11471323..11471436,11475413..11475673))
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, transcript
FT                   variant hCT1971230"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT1971230.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(11460755..11460828,11461918..11462003,
FT                   11463965..11464028,11469578..11469650,11471323..11471436,
FT                   11475413..11475493))
FT                   /codon_start=1
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT1971230.1
FT                   protein_id=hCP1783278.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9UHA3"
FT                   /db_xref="HGNC:HGNC:18479"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR024546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UHA3"
FT                   /protein_id="EAW77473.1"
FT                   "
FT   CDS             complement(join(11460755..11460828,11461918..11462003,
FT                   11463965..11464028,11469578..11469650,11471323..11471436,
FT                   11475413..11475493))
FT                   /codon_start=1
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT31306.2
FT                   protein_id=hCP49820.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5U8"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR024546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U8"
FT                   /protein_id="EAW77475.1"
FT                   "
FT   CDS             complement(join(11460755..11460828,11461918..11462003,
FT                   11463965..11464028,11469578..11469650,11471323..11471436,
FT                   11473907..11473918))
FT                   /codon_start=1
FT                   /gene="C15orf15"
FT                   /locus_tag="hCG_40053"
FT                   /product="chromosome 15 open reading frame 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG40053.3 transcript_id=hCT1971229.1
FT                   protein_id=hCP1783332.1 isoform=CRA_b"
FT                   /protein_id="EAW77474.1"
FT   gene            complement(11482206..11568421)
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /note="gene_id=hCG38865.4"
FT   mRNA            complement(join(11482206..11483084,11483134..11484308,
FT                   11502490..11502613,11507210..11507313,11509002..11509087,
FT                   11513383..11513557,11548767..11548886,11568322..11568421))
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, transcript
FT                   variant hCT2287849"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT2287849.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(11482206..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513557,
FT                   11548767..11548886,11568322..11568421))
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, transcript
FT                   variant hCT1962485"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT1962485.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(11482206..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513557,
FT                   11517004..11517087,11548767..11548886,11549358..11549479))
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, transcript
FT                   variant hCT30111"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT30111.4; splice
FT                   donor-acceptor pairs covered / total pairs = 6/7; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(11482206..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513557,
FT                   11548767..11549041))
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, transcript
FT                   variant hCT2287846"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT2287846.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(11484110..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513535))
FT                   /codon_start=1
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT1962485.1
FT                   protein_id=hCP1777195.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RU94"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RU94"
FT                   /protein_id="EAW77476.1"
FT   CDS             complement(join(11484110..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513535))
FT                   /codon_start=1
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT2287846.0
FT                   protein_id=hCP1878923.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RU94"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RU94"
FT                   /protein_id="EAW77477.1"
FT   CDS             complement(join(11484110..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513535))
FT                   /codon_start=1
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT30111.4
FT                   protein_id=hCP49816.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2RU94"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RU94"
FT                   /protein_id="EAW77478.1"
FT   CDS             complement(join(11484110..11484308,11502490..11502613,
FT                   11507210..11507313,11509002..11509087,11513383..11513535))
FT                   /codon_start=1
FT                   /gene="RAB27A"
FT                   /locus_tag="hCG_38865"
FT                   /product="RAB27A, member RAS oncogene family, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG38865.4 transcript_id=hCT2287849.0
FT                   protein_id=hCP1878927.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RU94"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RU94"
FT                   /protein_id="EAW77479.1"
FT   gene            11597556..11634779
FT                   /gene="PIGB"
FT                   /locus_tag="hCG_40051"
FT                   /note="gene_id=hCG40051.3"
FT   mRNA            join(11597556..11598001,11598863..11598998,
FT                   11599861..11599978,11606119..11606223,11608312..11608442,
FT                   11612455..11612595,11617855..11617906,11619200..11619411,
FT                   11620326..11620390,11629287..11629500,11633385..11633565,
FT                   11633873..11634779)
FT                   /gene="PIGB"
FT                   /locus_tag="hCG_40051"
FT                   /product="phosphatidylinositol glycan, class B"
FT                   /note="gene_id=hCG40051.3 transcript_id=hCT31304.3; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             join(11597839..11598001,11598863..11598998,
FT                   11599861..11599978,11606119..11606223,11608312..11608442,
FT                   11612455..11612595,11617855..11617906,11619200..11619411,
FT                   11620326..11620390,11629287..11629500,11633385..11633565,
FT                   11633873..11634019)
FT                   /codon_start=1
FT                   /gene="PIGB"
FT                   /locus_tag="hCG_40051"
FT                   /product="phosphatidylinositol glycan, class B"
FT                   /note="gene_id=hCG40051.3 transcript_id=hCT31304.3
FT                   protein_id=hCP49818.2"
FT                   /protein_id="EAW77480.1"
FT   gene            complement(11634231..11687042)
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /note="gene_id=hCG40050.3"
FT   mRNA            complement(join(11634231..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668022,11686808..11687042))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT2287835"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287835.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-MAR-2003"
FT   mRNA            complement(join(11634231..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668022,11686434..11686639))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT1686395"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT1686395.3;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-MAR-2003"
FT   mRNA            complement(join(11634231..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668022,11676806..11676857))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT2287838"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287838.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-MAR-2003"
FT   mRNA            complement(join(11634231..11639533,11643777..11643898,
FT                   11650381..11651542))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT2341439"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2341439.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-MAR-2003"
FT   mRNA            complement(join(11634232..11634996,11638128..11638279,
FT                   11639429..11639533,11643777..11643898,11650381..11650632,
FT                   11655537..11655738,11656888..11656964,11664188..11664302,
FT                   11667954..11668022,11686808..11687042))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT2287836"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287836.1;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-MAR-2003"
FT   CDS             complement(join(11634807..11634996,11638128..11638279,
FT                   11639429..11639533,11643777..11643898,11650381..11650632,
FT                   11655537..11655738,11656888..11656964,11664188..11664302,
FT                   11667954..11668013))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_d"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287836.1
FT                   protein_id=hCP1878937.0 isoform=CRA_d"
FT                   /protein_id="EAW77485.1"
FT   mRNA            complement(join(11637437..11639533,11650381..11650618,
FT                   11655537..11655738,11656888..11656964,11664188..11664302,
FT                   11667954..11668022,11686808..11686870))
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, transcript variant
FT                   hCT2355716"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2355716.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(11638088..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668013))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_a"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287835.1
FT                   protein_id=hCP1878936.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9ULG6"
FT                   /db_xref="HGNC:HGNC:24227"
FT                   /db_xref="InterPro:IPR033588"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ULG6"
FT                   /protein_id="EAW77481.1"
FT                   YSSL"
FT   CDS             complement(join(11638088..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668013))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_a"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2287838.1
FT                   protein_id=hCP1878933.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S7"
FT                   /db_xref="InterPro:IPR033588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S7"
FT                   /protein_id="EAW77482.1"
FT                   YSSL"
FT   CDS             complement(join(11638088..11639533,11643777..11643898,
FT                   11650381..11650632,11655537..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11668013))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_a"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT1686395.3
FT                   protein_id=hCP1689979.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5S7"
FT                   /db_xref="InterPro:IPR033588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S7"
FT                   /protein_id="EAW77486.1"
FT                   YSSL"
FT   CDS             complement(join(11638088..11639533,11643777..11643898,
FT                   11650381..11650654))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_b"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2341439.0
FT                   protein_id=hCP1908023.0 isoform=CRA_b"
FT                   /protein_id="EAW77483.1"
FT   CDS             complement(join(11638088..11639533,11650381..11650383))
FT                   /codon_start=1
FT                   /gene="CCPG1"
FT                   /locus_tag="hCG_40050"
FT                   /product="cell cycle progression 1, isoform CRA_c"
FT                   /note="gene_id=hCG40050.3 transcript_id=hCT2355716.0
FT                   protein_id=hCP1920950.0 isoform=CRA_c"
FT                   /protein_id="EAW77484.1"
FT   gene            11638836..11639473
FT                   /locus_tag="hCG_2045356"
FT                   /note="gene_id=hCG2045356.0"
FT   mRNA            join(11638836..11638877,11638933..11639473)
FT                   /locus_tag="hCG_2045356"
FT                   /product="hCG2045356"
FT                   /note="gene_id=hCG2045356.0 transcript_id=hCT2360191.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             join(11638875..11638877,11638933..11639070)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045356"
FT                   /product="hCG2045356"
FT                   /note="gene_id=hCG2045356.0 transcript_id=hCT2360191.0
FT                   protein_id=hCP1925412.0"
FT                   /protein_id="EAW77487.1"
FT                   Q"
FT   gene            <11655572..11667994
FT                   /locus_tag="hCG_2042696"
FT                   /note="gene_id=hCG2042696.0"
FT   mRNA            join(<11655572..11655738,11656888..11656964,
FT                   11664188..11664302,11667954..11667994)
FT                   /locus_tag="hCG_2042696"
FT                   /product="hCG2042696"
FT                   /note="gene_id=hCG2042696.0 transcript_id=hCT2347927.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 18-JUN-2003"
FT   CDS             join(<11656941..11656964,11664188..11664302,
FT                   11667954..11667964)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042696"
FT                   /product="hCG2042696"
FT                   /note="gene_id=hCG2042696.0 transcript_id=hCT2347927.0
FT                   protein_id=hCP1911413.0"
FT                   /protein_id="EAW77488.1"
FT                   TPHD"
FT   gene            11687154..11697299
FT                   /locus_tag="hCG_1820885"
FT                   /note="gene_id=hCG1820885.1"
FT   mRNA            join(11687154..11687373,11696807..11697299)
FT                   /locus_tag="hCG_1820885"
FT                   /product="hCG1820885"
FT                   /note="gene_id=hCG1820885.1 transcript_id=hCT1971349.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(11687356..11687373,11696807..11697154)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820885"
FT                   /product="hCG1820885"
FT                   /note="gene_id=hCG1820885.1 transcript_id=hCT1971349.1
FT                   protein_id=hCP1783690.1"
FT                   /db_xref="HGNC:HGNC:44654"
FT                   /db_xref="InterPro:IPR026507"
FT                   /db_xref="UniProtKB/Swiss-Prot:H3BRN8"
FT                   /protein_id="EAW77489.1"
FT                   APDRTRTLDFPNIQHTL"
FT   gene            complement(11708831..11786841)
FT                   /gene="DYX1C1"
FT                   /locus_tag="hCG_1786105"
FT                   /note="gene_id=hCG1786105.2"
FT   mRNA            complement(join(11708831..11709357,11711075..11711180,
FT                   11713483..11713636,11718048..11718157,11728801..11728946,
FT                   11745520..11745751,11769730..11769863,11776319..11776466,
FT                   11776814..11777191,11786729..11786841))
FT                   /gene="DYX1C1"
FT                   /locus_tag="hCG_1786105"
FT                   /product="dyslexia susceptibility 1 candidate 1, transcript
FT                   variant hCT1825136"
FT                   /note="gene_id=hCG1786105.2 transcript_id=hCT1825136.2;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 07-OCT-2003"
FT   mRNA            complement(join(11708888..11709357,11713483..11713636,
FT                   11718048..11718157,11728801..11728946,11745520..11745751,
FT                   11769730..11769863,11776319..11776466,11776814..11776978))
FT                   /gene="DYX1C1"
FT                   /locus_tag="hCG_1786105"
FT                   /product="dyslexia susceptibility 1 candidate 1, transcript
FT                   variant hCT2355688"
FT                   /note="gene_id=hCG1786105.2 transcript_id=hCT2355688.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(11709248..11709357,11711075..11711180,
FT                   11713483..11713636,11718048..11718157,11728801..11728946,
FT                   11745520..11745751,11769730..11769863,11776319..11776466,
FT                   11776814..11776936))
FT                   /codon_start=1
FT                   /gene="DYX1C1"
FT                   /locus_tag="hCG_1786105"
FT                   /product="dyslexia susceptibility 1 candidate 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1786105.2 transcript_id=hCT1825136.2
FT                   protein_id=hCP1733506.2 isoform=CRA_a"
FT                   /protein_id="EAW77490.1"
FT   CDS             complement(join(11709274..11709357,11713483..11713636,
FT                   11718048..11718157,11728801..11728946,11745520..11745751,
FT                   11769730..11769863,11776319..11776466,11776814..11776936))
FT                   /codon_start=1
FT                   /gene="DYX1C1"
FT                   /locus_tag="hCG_1786105"
FT                   /product="dyslexia susceptibility 1 candidate 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1786105.2 transcript_id=hCT2355688.0
FT                   protein_id=hCP1920909.0 isoform=CRA_b"
FT                   /protein_id="EAW77491.1"
FT   gene            complement(11720710..11721995)
FT                   /pseudo
FT                   /locus_tag="hCG_2002763"
FT                   /note="gene_id=hCG2002763.1"
FT   mRNA            complement(11720710..11721995)
FT                   /pseudo
FT                   /locus_tag="hCG_2002763"
FT                   /note="gene_id=hCG2002763.1 transcript_id=hCT2287828.1;
FT                   overlap evidence=no; created on 04-FEB-2004"
FT   gene            complement(11822377..11867479)
FT                   /gene="PYGO1"
FT                   /locus_tag="hCG_1645418"
FT                   /note="gene_id=hCG1645418.4"
FT   mRNA            complement(join(11822377..11825738,11827478..11827563,
FT                   11867336..11867479))
FT                   /gene="PYGO1"
FT                   /locus_tag="hCG_1645418"
FT                   /product="pygopus homolog 1 (Drosophila)"
FT                   /note="gene_id=hCG1645418.4 transcript_id=hCT1645545.4;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 06-APR-2004"
FT   CDS             complement(join(11824614..11825738,11827478..11827563,
FT                   11867336..11867384))
FT                   /codon_start=1
FT                   /gene="PYGO1"
FT                   /locus_tag="hCG_1645418"
FT                   /product="pygopus homolog 1 (Drosophila)"
FT                   /note="gene_id=hCG1645418.4 transcript_id=hCT1645545.4
FT                   protein_id=hCP1632141.4"
FT                   /protein_id="EAW77492.1"
FT   gene            complement(11898364..12021583)
FT                   /gene="PRTG"
FT                   /locus_tag="hCG_40052"
FT                   /note="gene_id=hCG40052.4"
FT   mRNA            complement(join(11898364..11898767,11899164..11899268,
FT                   11902843..11903008,11905509..11905629,11907321..11907503,
FT                   11915640..11915810,11917019..11917146,11918112..11918298,
FT                   11919583..11919678,11950899..11951087,11951825..11952052,
FT                   11953973..11954137,11956251..11956498,11957740..11957899,
FT                   11958011..11958154,11958508..11958666,11958945..11959082,
FT                   11960818..11960951,11962253..11962397,12018880..12019182,
FT                   12021336..12021583))
FT                   /gene="PRTG"
FT                   /locus_tag="hCG_40052"
FT                   /product="protogenin homolog (Gallus gallus), transcript
FT                   variant hCT31305"
FT                   /note="gene_id=hCG40052.4 transcript_id=hCT31305.4; splice
FT                   donor-acceptor pairs covered / total pairs = 17/20; created
FT                   on 06-APR-2004"
FT   CDS             complement(join(11898513..11898767,11899164..11899268,
FT                   11902843..11903008,11905509..11905629,11907321..11907503,
FT                   11915640..11915810,11917019..11917146,11918112..11918298,
FT                   11919583..11919678,11950899..11951087,11951825..11952052,
FT                   11953973..11954137,11956251..11956498,11957740..11957899,
FT                   11958011..11958154,11958508..11958666,11958945..11959082,
FT                   11960818..11960951,11962253..11962397,12018880..12019182,
FT                   12021336..12021429))
FT                   /codon_start=1
FT                   /gene="PRTG"
FT                   /locus_tag="hCG_40052"
FT                   /product="protogenin homolog (Gallus gallus), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG40052.4 transcript_id=hCT31305.4
FT                   protein_id=hCP49819.4 isoform=CRA_a"
FT                   /protein_id="EAW77493.1"
FT                   TTPPNL"
FT   mRNA            complement(join(12016747..12016997,12018880..12019182,
FT                   12021336..12021583))
FT                   /gene="PRTG"
FT                   /locus_tag="hCG_40052"
FT                   /product="protogenin homolog (Gallus gallus), transcript
FT                   variant hCT1825135"
FT                   /note="gene_id=hCG40052.4 transcript_id=hCT1825135.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 06-APR-2004"
FT   CDS             complement(join(12016981..12016997,12018880..12019182,
FT                   12021336..12021429))
FT                   /codon_start=1
FT                   /gene="PRTG"
FT                   /locus_tag="hCG_40052"
FT                   /product="protogenin homolog (Gallus gallus), isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG40052.4 transcript_id=hCT1825135.2
FT                   protein_id=hCP1733504.2 isoform=CRA_b"
FT                   /db_xref="GOA:H0YLT7"
FT                   /db_xref="HGNC:HGNC:26373"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033011"
FT                   /db_xref="UniProtKB/TrEMBL:H0YLT7"
FT                   /protein_id="EAW77494.1"
FT   gene            complement(12105446..12272169)
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /note="gene_id=hCG40054.4"
FT   mRNA            complement(join(12105446..12106660,12106713..12108528,
FT                   12109043..12109115,12111537..12111633,12112567..12112674,
FT                   12112756..12112815,12116309..12116369,12116627..12116700,
FT                   12117029..12117124,12118967..12119037,12119126..12119247,
FT                   12120454..12120683,12125489..12125554,12126890..12126948,
FT                   12127039..12127093,12127324..12127404,12129060..12129260,
FT                   12130942..12131061,12134639..12134704,12138914..12139081,
FT                   12139168..12139285,12141420..12141586,12148089..12148191,
FT                   12150930..12150987,12152468..12152522,12203167..12203220,
FT                   12229906..12229944,12230041..12230119,12245003..12245076,
FT                   12272043..12272168))
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, transcript variant hCT2288872"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT2288872.0;
FT                   splice donor-acceptor pairs covered / total pairs = 29/29;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(12105462..12108528,12109043..12109115,
FT                   12111537..12111633,12112567..12112674,12112756..12112815,
FT                   12116309..12116369,12116627..12116700,12117029..12117124,
FT                   12118967..12119037,12119126..12119247,12120454..12120683,
FT                   12125489..12125554,12126890..12126948,12127039..12127093,
FT                   12127324..12127404,12129060..12129260,12130942..12131061,
FT                   12134639..12134704,12138914..12139081,12139168..12139285,
FT                   12141420..12141586,12148089..12148191,12150930..12150991,
FT                   12152472..12152522,12203167..12203220,12229906..12229944,
FT                   12230041..12230119,12245003..12245076,12272043..12272169))
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, transcript variant hCT2355723"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT2355723.0;
FT                   splice donor-acceptor pairs covered / total pairs = 28/28;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(12105758..12108528,12109043..12109115,
FT                   12111537..12111633,12112567..12112674,12112756..12112815,
FT                   12116309..12116369,12116627..12116700,12117029..12117124,
FT                   12118967..12119037,12119126..12119247,12120454..12120683,
FT                   12125489..12125554,12126890..12126948,12127039..12127093,
FT                   12127324..12127404,12129060..12129260,12130942..12131061,
FT                   12134639..12134704,12138914..12139081,12139168..12139285,
FT                   12141420..12141586,12148089..12148191,12150930..12150987,
FT                   12152468..12152522,12203167..12203220,12229906..12229944,
FT                   12230041..12230119,12245003..12245076,12272043..12272168))
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, transcript variant hCT31307"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT31307.3; splice
FT                   donor-acceptor pairs covered / total pairs = 28/28; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(12108426..12108528,12109043..12109115,
FT                   12111537..12111633,12112567..12112674,12112756..12112815,
FT                   12116309..12116369,12116627..12116700,12117029..12117124,
FT                   12118967..12119037,12119126..12119247,12120454..12120683,
FT                   12125489..12125554,12126890..12126948,12127039..12127093,
FT                   12127324..12127404,12129060..12129260,12130942..12131061,
FT                   12134639..12134704,12138914..12139081,12139168..12139285,
FT                   12141420..12141586,12148089..12148191,12150930..12150991,
FT                   12152472..12152522,12203167..12203220,12229906..12229944,
FT                   12230041..12230119,12245003..12245076,12272043..12272087))
FT                   /codon_start=1
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, isoform CRA_a"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT2355723.0
FT                   protein_id=hCP1920951.0 isoform=CRA_a"
FT                   /db_xref="GOA:P46934"
FT                   /db_xref="HGNC:HGNC:7727"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="PDB:2KPZ"
FT                   /db_xref="PDB:2KQ0"
FT                   /db_xref="PDB:2M3O"
FT                   /db_xref="PDB:2XBB"
FT                   /db_xref="PDB:2XBF"
FT                   /db_xref="PDB:3B7Y"
FT                   /db_xref="PDB:4BBN"
FT                   /db_xref="PDB:4BE8"
FT                   /db_xref="PDB:4N7F"
FT                   /db_xref="PDB:4N7H"
FT                   /db_xref="PDB:5AHT"
FT                   /db_xref="PDB:5C7J"
FT                   /db_xref="PDB:5C91"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46934"
FT                   /protein_id="EAW77495.1"
FT   CDS             complement(join(12108426..12108528,12109043..12109115,
FT                   12111537..12111633,12112567..12112674,12112756..12112815,
FT                   12116309..12116369,12116627..12116700,12117029..12117124,
FT                   12118967..12119037,12119126..12119247,12120454..12120683,
FT                   12125489..12125554,12126890..12126948,12127039..12127093,
FT                   12127324..12127404,12129060..12129260,12130942..12131061,
FT                   12134639..12134704,12138914..12139081,12139168..12139285,
FT                   12141420..12141586,12148089..12148191,12150930..12150987,
FT                   12152468..12152522,12203167..12203220,12229906..12229944,
FT                   12230041..12230119,12245003..12245076,12272043..12272087))
FT                   /codon_start=1
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, isoform CRA_b"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT2288872.0
FT                   protein_id=hCP1878951.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5S9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S9"
FT                   /protein_id="EAW77496.1"
FT   CDS             complement(join(12108426..12108528,12109043..12109115,
FT                   12111537..12111633,12112567..12112674,12112756..12112815,
FT                   12116309..12116369,12116627..12116700,12117029..12117124,
FT                   12118967..12119037,12119126..12119247,12120454..12120683,
FT                   12125489..12125554,12126890..12126948,12127039..12127093,
FT                   12127324..12127404,12129060..12129260,12130942..12131061,
FT                   12134639..12134704,12138914..12139081,12139168..12139285,
FT                   12141420..12141586,12148089..12148191,12150930..12150987,
FT                   12152468..12152522,12203167..12203220,12229906..12229944,
FT                   12230041..12230119,12245003..12245076,12272043..12272087))
FT                   /codon_start=1
FT                   /gene="NEDD4"
FT                   /locus_tag="hCG_40054"
FT                   /product="neural precursor cell expressed, developmentally
FT                   down-regulated 4, isoform CRA_b"
FT                   /note="gene_id=hCG40054.4 transcript_id=hCT31307.3
FT                   protein_id=hCP49821.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5S9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5S9"
FT                   /protein_id="EAW77497.1"
FT   gene            complement(12281837..12285971)
FT                   /pseudo
FT                   /locus_tag="hCG_2003400"
FT                   /note="gene_id=hCG2003400.0"
FT   mRNA            complement(join(12281837..12282535,12283163..12285971))
FT                   /pseudo
FT                   /locus_tag="hCG_2003400"
FT                   /note="gene_id=hCG2003400.0 transcript_id=hCT2288870.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 20-JAN-2004"
FT   assembly_gap    12282537..12283162
FT                   /estimated_length=626
FT                   /gap_type="unknown"
FT   gene            complement(12366078..12423289)
FT                   /gene="RFXDC2"
FT                   /locus_tag="hCG_2003398"
FT                   /note="gene_id=hCG2003398.0"
FT   mRNA            complement(join(12366078..12366302,12372430..12373209))
FT                   /gene="RFXDC2"
FT                   /locus_tag="hCG_2003398"
FT                   /product="regulatory factor X domain containing 2,
FT                   transcript variant hCT2288866"
FT                   /note="gene_id=hCG2003398.0 transcript_id=hCT2288866.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(12366261..12366302,12372430..12372834))
FT                   /codon_start=1
FT                   /gene="RFXDC2"
FT                   /locus_tag="hCG_2003398"
FT                   /product="regulatory factor X domain containing 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG2003398.0 transcript_id=hCT2288866.0
FT                   protein_id=hCP1878958.0 isoform=CRA_a"
FT                   /protein_id="EAW77498.1"
FT   mRNA            complement(join(12369333..12375417,12376883..12377178,
FT                   12380161..12380368,12380971..12381043,12421586..12421708,
FT                   12423207..12423289))
FT                   /gene="RFXDC2"
FT                   /locus_tag="hCG_2003398"
FT                   /product="regulatory factor X domain containing 2,
FT                   transcript variant hCT2288867"
FT                   /note="gene_id=hCG2003398.0 transcript_id=hCT2288867.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(12372142..12375417,12376883..12377178,
FT                   12380161..12380368,12380971..12381043,12421586..12421695))
FT                   /codon_start=1
FT                   /gene="RFXDC2"
FT                   /locus_tag="hCG_2003398"
FT                   /product="regulatory factor X domain containing 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG2003398.0 transcript_id=hCT2288867.0
FT                   protein_id=hCP1878957.0 isoform=CRA_b"
FT                   /protein_id="EAW77499.1"
FT   gene            complement(12471156..12472067)
FT                   /pseudo
FT                   /locus_tag="hCG_1792426"
FT                   /note="gene_id=hCG1792426.1"
FT   mRNA            complement(12471156..12472067)
FT                   /pseudo
FT                   /locus_tag="hCG_1792426"
FT                   /note="gene_id=hCG1792426.1 transcript_id=hCT1831686.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   assembly_gap    12589425..12590240
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   gene            12644398..12707724
FT                   /gene="TEX9"
FT                   /locus_tag="hCG_40112"
FT                   /note="gene_id=hCG40112.3"
FT   mRNA            join(12644398..12644616,12652387..12652450,
FT                   12662899..12662978,12667419..12667467,12668265..12668347,
FT                   12670190..12670365,12673112..12673194,12673608..12673781,
FT                   12691254..12691388,12706647..12706781,12707409..12707724)
FT                   /gene="TEX9"
FT                   /locus_tag="hCG_40112"
FT                   /product="testis expressed sequence 9"
FT                   /note="gene_id=hCG40112.3 transcript_id=hCT31366.3; splice
FT                   donor-acceptor pairs covered / total pairs = 10/10; created
FT                   on 26-AUG-2002"
FT   CDS             join(12662941..12662978,12667419..12667467,
FT                   12668265..12668347,12670190..12670365,12673112..12673194,
FT                   12673608..12673781,12691254..12691388,12706647..12706781,
FT                   12707409..12707486)
FT                   /codon_start=1
FT                   /gene="TEX9"
FT                   /locus_tag="hCG_40112"
FT                   /product="testis expressed sequence 9"
FT                   /note="gene_id=hCG40112.3 transcript_id=hCT31366.3
FT                   protein_id=hCP49892.3"
FT                   /db_xref="HGNC:HGNC:29585"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N6V9"
FT                   /protein_id="EAW77500.1"
FT   gene            complement(12707766..12744199)
FT                   /gene="MNS1"
FT                   /locus_tag="hCG_40113"
FT                   /note="gene_id=hCG40113.3"
FT   mRNA            complement(join(12707766..12708235,12710415..12710540,
FT                   12713185..12713442,12722476..12722583,12722684..12722900,
FT                   12723490..12723719,12725887..12725989,12735445..12735572,
FT                   12743085..12743306,12744032..12744199))
FT                   /gene="MNS1"
FT                   /locus_tag="hCG_40113"
FT                   /product="meiosis-specific nuclear structural 1, transcript
FT                   variant hCT31367"
FT                   /note="gene_id=hCG40113.3 transcript_id=hCT31367.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(12707773..12708235,12710415..12710540,
FT                   12713185..12713442,12722476..12722583,12722684..12722900,
FT                   12723490..12723719,12725887..12725989,12735459..12735572,
FT                   12743085..12743288))
FT                   /gene="MNS1"
FT                   /locus_tag="hCG_40113"
FT                   /product="meiosis-specific nuclear structural 1, transcript
FT                   variant hCT2355766"
FT                   /note="gene_id=hCG40113.3 transcript_id=hCT2355766.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   CDS             complement(join(12708143..12708235,12710415..12710540,
FT                   12713185..12713442,12722476..12722583,12722684..12722900,
FT                   12723490..12723719,12725887..12725989,12735445..12735572,
FT                   12743085..12743306,12744032..12744034))
FT                   /codon_start=1
FT                   /gene="MNS1"
FT                   /locus_tag="hCG_40113"
FT                   /product="meiosis-specific nuclear structural 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG40113.3 transcript_id=hCT31367.3
FT                   protein_id=hCP49893.2 isoform=CRA_b"
FT                   /protein_id="EAW77502.1"
FT   CDS             complement(join(12708143..12708235,12710415..12710540,
FT                   12713185..12713442,12722476..12722583,12722684..12722900,
FT                   12723490..12723719,12725887..12725946))
FT                   /codon_start=1
FT                   /gene="MNS1"
FT                   /locus_tag="hCG_40113"
FT                   /product="meiosis-specific nuclear structural 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG40113.3 transcript_id=hCT2355766.0
FT                   protein_id=hCP1921006.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR026504"
FT                   /db_xref="UniProtKB/TrEMBL:B3KQ70"
FT                   /protein_id="EAW77501.1"
FT   gene            complement(12822305..>12908982)
FT                   /locus_tag="hCG_2038279"
FT                   /note="gene_id=hCG2038279.0"
FT   mRNA            complement(join(12822305..12822447,12822910..12823163,
FT                   12827211..12827358,12827799..12827953,12828509..12828862,
FT                   12872102..12872234,12883230..12883261,12884766..12884873,
FT                   12908194..12908281,12908904..>12908982))
FT                   /locus_tag="hCG_2038279"
FT                   /product="hCG2038279"
FT                   /note="gene_id=hCG2038279.0 transcript_id=hCT2342705.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 07-APR-2003"
FT   CDS             complement(join(12822445..12822447,12822910..12823163,
FT                   12827211..>12827220))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038279"
FT                   /product="hCG2038279"
FT                   /note="gene_id=hCG2038279.0 transcript_id=hCT2342705.0
FT                   protein_id=hCP1908377.0"
FT                   /protein_id="EAW77503.1"
FT   gene            complement(12909569..13013495)
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /note="gene_id=hCG1811981.1"
FT   mRNA            complement(join(12909569..12911511,12914584..12914639,
FT                   12922341..12922386,12933588..12933624,12933775..12933893,
FT                   12937813..12937875,12945787..12945927,12946071..12946378,
FT                   12948215..12948349,12956061..12956207,12956965..12957065,
FT                   12958055..12958212,12961645..12961868,12968437..12968546,
FT                   12968696..12968866,12972494..12972611,12980329..12980468,
FT                   12980569..12980634,12983518..12983664,12986660..12986703,
FT                   13012867..13013495))
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   transcript variant hCT1955475"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT1955475.1;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(12909569..12911511,12914584..12914639,
FT                   12922341..12922386,12933588..12933624,12933775..12933893,
FT                   12934121..12934232,12937813..12937875,12945787..12945927,
FT                   12946071..12946378,12948215..12948349,12956061..12956207,
FT                   12956965..12957065,12958055..12958212,12961645..12961855,
FT                   12968437..12968546,12968696..12968859,12980240..12980468,
FT                   12980569..12980634,12983518..12983664,12986660..12986703,
FT                   13012867..13013495))
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   transcript variant hCT2288860"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288860.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(12910106..12910207,12910253..12911511,
FT                   12914584..12914639,12922341..12922386,12933588..12933624,
FT                   12933775..12933893,12937813..12937875,12945787..12945927,
FT                   12946071..12946378,12948215..12948349,12956061..12956207,
FT                   12956965..12957065,12958055..12958212,12961645..12961868,
FT                   12968437..12968546,12968696..12968866,12972494..12972611,
FT                   12980329..12980468,12980569..12980634,12983518..12983664,
FT                   12986660..12986703,13012867..13013495))
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   transcript variant hCT2288859"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288859.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/21;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(12910106..12910207,12910253..12911206,
FT                   12911261..12911511,12914584..12914639,12922341..12922465,
FT                   12933588..12933624,12933775..12933893,12937813..12937875,
FT                   12945787..12945927,12946071..12946378,12948215..12948349,
FT                   12956061..12956207,12956965..12957065,12958055..12958212,
FT                   12961645..12961868,12968437..12968546,12968696..12968866,
FT                   12972494..12972611,12980329..12980468,12980569..12980634,
FT                   12983518..12983664,12986660..12986703,13012867..13013495))
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   transcript variant hCT2288857"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288857.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/22;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(12910106..12910207,12910253..12911206,
FT                   12911261..12911511,12914584..12914639,12922341..12922386,
FT                   12933588..12933624,12933775..12933893,12934121..12934232,
FT                   12937813..12937875,12945787..12945927,12946071..12946378,
FT                   12948215..12948349,12956061..12956207,12956965..12957065,
FT                   12958055..12958212,12961645..12961868,12968437..12968546,
FT                   12968696..12968866,12972494..12972611,12980329..12980468,
FT                   12980569..12980634,12983518..12983664,12986660..12986703,
FT                   13012867..13013495))
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   transcript variant hCT2288858"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288858.0;
FT                   splice donor-acceptor pairs covered / total pairs = 22/23;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(12910887..12911511,12914584..12914639,
FT                   12922341..12922386,12933588..12933624,12933775..12933893,
FT                   12937813..12937875,12945787..12945927,12946071..12946378,
FT                   12948215..12948349,12956061..12956207,12956965..12957065,
FT                   12958055..12958212,12961645..12961868,12968437..12968546,
FT                   12968696..12968866,12972494..12972611,12980329..12980468,
FT                   12980569..12980634,12983518..12983664,12986660..12986703,
FT                   13012867..13013342))
FT                   /codon_start=1
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT1955475.1
FT                   protein_id=hCP1764791.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5W1"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR025243"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5W1"
FT                   /protein_id="EAW77504.1"
FT   CDS             complement(join(12910887..12911511,12914584..12914639,
FT                   12922341..12922386,12933588..12933624,12933775..12933893,
FT                   12937813..12937875,12945787..12945927,12946071..12946378,
FT                   12948215..12948349,12956061..12956207,12956965..12957065,
FT                   12958055..12958212,12961645..12961868,12968437..12968546,
FT                   12968696..12968866,12972494..12972611,12980329..12980468,
FT                   12980569..12980634,12983518..12983664,12986660..12986703,
FT                   13012867..13013342))
FT                   /codon_start=1
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288859.0
FT                   protein_id=hCP1878947.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5W1"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR025243"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5W1"
FT                   /protein_id="EAW77508.1"
FT   CDS             complement(join(12922420..12922465,12933588..12933624,
FT                   12933775..12933893,12937813..12937875,12945787..12945927,
FT                   12946071..12946378,12948215..12948349,12956061..12956207,
FT                   12956965..12957065,12958055..12958212,12961645..12961868,
FT                   12968437..12968546,12968696..12968866,12972494..12972611,
FT                   12980329..12980468,12980569..12980634,12983518..12983664,
FT                   12986660..12986703,13012867..13013342))
FT                   /codon_start=1
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288857.0
FT                   protein_id=hCP1878949.0 isoform=CRA_b"
FT                   /protein_id="EAW77505.1"
FT   CDS             complement(join(12934136..12934232,12937813..12937875,
FT                   12945787..12945927,12946071..12946378,12948215..12948349,
FT                   12956061..12956207,12956965..12957065,12958055..12958212,
FT                   12961645..12961868,12968437..12968546,12968696..12968866,
FT                   12972494..12972611,12980329..12980468,12980569..12980634,
FT                   12983518..12983664,12986660..12986703,13012867..13013342))
FT                   /codon_start=1
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288858.0
FT                   protein_id=hCP1878948.0 isoform=CRA_c"
FT                   /protein_id="EAW77506.1"
FT                   LTLGLLTPNF"
FT   CDS             complement(join(12934136..12934232,12937813..12937875,
FT                   12945787..12945927,12946071..12946378,12948215..12948349,
FT                   12956061..12956207,12956965..12957065,12958055..12958212,
FT                   12961645..12961853))
FT                   /codon_start=1
FT                   /gene="SUHW4"
FT                   /locus_tag="hCG_1811981"
FT                   /product="suppressor of hairy wing homolog 4 (Drosophila),
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG1811981.1 transcript_id=hCT2288860.0
FT                   protein_id=hCP1878945.0 isoform=CRA_d"
FT                   /protein_id="EAW77507.1"
FT   gene            <13013113..>13126865
FT                   /locus_tag="hCG_1652800"
FT                   /note="gene_id=hCG1652800.2"
FT   mRNA            join(<13013113..13013337,13040304..13040435,
FT                   13052496..13052533,13052566..13052642,13079019..13079133,
FT                   13095161..13095237,13114939..13115018,13126614..>13126865)
FT                   /locus_tag="hCG_1652800"
FT                   /product="hCG1652800"
FT                   /note="gene_id=hCG1652800.2 transcript_id=hCT1652927.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/7;
FT                   created on 26-AUG-2002"
FT   CDS             join(13013113..13013337,13040304..13040435,
FT                   13052496..13052533,13052566..13052642,13079019..13079133,
FT                   13095161..13095237,13114939..13115018,13126614..>13126865)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1652800"
FT                   /product="hCG1652800"
FT                   /note="gene_id=hCG1652800.2 transcript_id=hCT1652927.2
FT                   protein_id=hCP1632109.2"
FT                   /protein_id="EAW77509.1"
FT   assembly_gap    13047678..13047697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13197003..13198849)
FT                   /locus_tag="hCG_1820887"
FT                   /note="gene_id=hCG1820887.1"
FT   mRNA            complement(join(13197003..13197483,13197811..13197965,
FT                   13198266..13198849))
FT                   /locus_tag="hCG_1820887"
FT                   /product="hCG1820887"
FT                   /note="gene_id=hCG1820887.1 transcript_id=hCT1971351.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(13197316..13197483,13197811..13197888))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820887"
FT                   /product="hCG1820887"
FT                   /note="gene_id=hCG1820887.1 transcript_id=hCT1971351.1
FT                   protein_id=hCP1783697.1"
FT                   /protein_id="EAW77510.1"
FT   gene            13198906..13568802
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /note="gene_id=hCG40686.4"
FT   mRNA            join(13198906..13199177,13200163..13200259,
FT                   13201307..13201379,13344012..13344085,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13532697..13532768,13533537..13533743,13542390..13542504,
FT                   13543408..13543570,13553319..13553551,13562733..13562886,
FT                   13566445..13568802)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2355711"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355711.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 14-JUL-2004"
FT   mRNA            join(13198906..13199177,13200173..13200259,
FT                   13201307..13201379,13344012..13344085,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13532697..13532768,13533537..13533743,13542390..13542504,
FT                   13543408..13543570,13553319..13553551,13562733..13562886,
FT                   13566445..13568802)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2355710"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355710.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 14-JUL-2004"
FT   mRNA            join(13198906..13199177,13200173..13200259,
FT                   13201307..13201379,13344012..13344085,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562886,13566445..13568802)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2355709"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355709.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/19;
FT                   created on 14-JUL-2004"
FT   mRNA            join(13198921..13199177,13200163..13200259,
FT                   13201307..13201379,13344012..13344085,13352920..13352981,
FT                   13372062..13372164,13446706..13446770,13472446..13472581,
FT                   13478064..13478116,13511428..13511533,13512567..13512706,
FT                   13512988..13513132,13514319..13514383,13523747..13523825,
FT                   13531626..13531699,13533537..13533743,13542390..13542504,
FT                   13543408..13543570,13553319..13553551,13562733..13562886,
FT                   13566439..13568802)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2287629"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287629.0;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 26-AUG-2002"
FT   mRNA            join(13198921..13199177,13200163..13200259,
FT                   13201307..13201379,13344012..13344085,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562886,13566445..13568802)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT31947"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT31947.3; splice
FT                   donor-acceptor pairs covered / total pairs = 19/19; created
FT                   on 26-AUG-2002"
FT   mRNA            join(13198921..13199177,13200163..13200259,
FT                   13201307..13201379,13344012..13344085,13352920..13352981,
FT                   13372062..13372164,13446706..13446770,13472446..13472581,
FT                   13478064..13478116,13511428..13511533,13512567..13512706,
FT                   13512988..13513132,13514319..13514383,13523747..13523825,
FT                   13531626..13531699,13532697..13532768,13533537..13533743,
FT                   13542390..13542504,13543408..13543570,13553319..13553551,
FT                   13562733..13562886,13566445..13567434,13567484..13567541)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2287628"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287628.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/22;
FT                   created on 26-AUG-2002"
FT   mRNA            join(13198921..13199177,13200163..13200259,
FT                   13201307..13201379,13344012..13344085,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562886,13566445..13567434,
FT                   13567484..13567541)
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), transcript variant hCT2287625"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287625.0;
FT                   splice donor-acceptor pairs covered / total pairs = 19/20;
FT                   created on 26-AUG-2002"
FT   CDS             join(13200185..13200259,13201307..13201379,
FT                   13344012..13344085,13372062..13372164,13446706..13446770,
FT                   13472446..13472581,13478064..13478116,13511428..13511533,
FT                   13512567..13512706,13512988..13513132,13514319..13514383,
FT                   13523747..13523825,13531626..13531699,13532697..13532768,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_b"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355710.0
FT                   protein_id=hCP1920965.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99081"
FT                   /db_xref="HGNC:HGNC:11623"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="PDB:2KNH"
FT                   /db_xref="PDB:4JOL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99081"
FT                   /protein_id="EAW77512.1"
FT                   GLSETTNPMGHM"
FT   CDS             join(13200185..13200259,13201307..13201379,
FT                   13344012..13344085,13372062..13372164,13446706..13446770,
FT                   13472446..13472581,13478064..13478116,13511428..13511533,
FT                   13512567..13512706,13512988..13513132,13514319..13514383,
FT                   13523747..13523825,13531626..13531699,13532697..13532768,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_b"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355711.0
FT                   protein_id=hCP1920966.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Z0"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z0"
FT                   /protein_id="EAW77514.1"
FT                   GLSETTNPMGHM"
FT   CDS             join(13200185..13200259,13201307..13201379,
FT                   13344012..13344085,13372062..13372164,13446706..13446770,
FT                   13472446..13472581,13478064..13478116,13511428..13511533,
FT                   13512567..13512706,13512988..13513132,13514319..13514383,
FT                   13523747..13523825,13531626..13531699,13533537..13533743,
FT                   13542390..13542504,13543408..13543570,13553319..13553551,
FT                   13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_c"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT31947.3
FT                   protein_id=hCP50441.2 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5T1"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T1"
FT                   /protein_id="EAW77513.1"
FT   CDS             join(13200185..13200259,13201307..13201379,
FT                   13344012..13344085,13372062..13372164,13446706..13446770,
FT                   13472446..13472581,13478064..13478116,13511428..13511533,
FT                   13512567..13512706,13512988..13513132,13514319..13514383,
FT                   13523747..13523825,13531626..13531699,13533537..13533743,
FT                   13542390..13542504,13543408..13543570,13553319..13553551,
FT                   13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_c"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287625.0
FT                   protein_id=hCP1878985.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5T1"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T1"
FT                   /protein_id="EAW77516.1"
FT   CDS             join(13200185..13200259,13201307..13201379,
FT                   13344012..13344085,13372062..13372164,13446706..13446770,
FT                   13472446..13472581,13478064..13478116,13511428..13511533,
FT                   13512567..13512706,13512988..13513132,13514319..13514383,
FT                   13523747..13523825,13531626..13531699,13533537..13533743,
FT                   13542390..13542504,13543408..13543570,13553319..13553551,
FT                   13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_c"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2355709.0
FT                   protein_id=hCP1920964.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5T1"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T1"
FT                   /protein_id="EAW77517.1"
FT   CDS             join(13352934..13352981,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13532697..13532768,13533537..13533743,13542390..13542504,
FT                   13543408..13543570,13553319..13553551,13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_d"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287628.0
FT                   protein_id=hCP1878984.0 isoform=CRA_d"
FT                   /protein_id="EAW77515.1"
FT                   PGLSETTNPMGHM"
FT   CDS             join(13352934..13352981,13372062..13372164,
FT                   13446706..13446770,13472446..13472581,13478064..13478116,
FT                   13511428..13511533,13512567..13512706,13512988..13513132,
FT                   13514319..13514383,13523747..13523825,13531626..13531699,
FT                   13533537..13533743,13542390..13542504,13543408..13543570,
FT                   13553319..13553551,13562733..13562875)
FT                   /codon_start=1
FT                   /gene="TCF12"
FT                   /locus_tag="hCG_40686"
FT                   /product="transcription factor 12 (HTF4, helix-loop-helix
FT                   transcription factors 4), isoform CRA_a"
FT                   /note="gene_id=hCG40686.4 transcript_id=hCT2287629.0
FT                   protein_id=hCP1878982.0 isoform=CRA_a"
FT                   /protein_id="EAW77511.1"
FT   gene            <13580653..13588048
FT                   /locus_tag="hCG_2038274"
FT                   /note="gene_id=hCG2038274.0"
FT   mRNA            join(<13580653..13581212,13585606..13587355,
FT                   13587829..13588048)
FT                   /locus_tag="hCG_2038274"
FT                   /product="hCG2038274"
FT                   /note="gene_id=hCG2038274.0 transcript_id=hCT2342700.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 07-APR-2003"
FT   CDS             <13586622..13587182
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038274"
FT                   /product="hCG2038274"
FT                   /note="gene_id=hCG2038274.0 transcript_id=hCT2342700.0
FT                   protein_id=hCP1908372.0"
FT                   /protein_id="EAW77518.1"
FT   gene            <13586983..>13587547
FT                   /locus_tag="hCG_2042181"
FT                   /note="gene_id=hCG2042181.0"
FT   mRNA            join(<13586983..13587355,13587431..>13587547)
FT                   /locus_tag="hCG_2042181"
FT                   /product="hCG2042181"
FT                   /note="gene_id=hCG2042181.0 transcript_id=hCT2347412.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<13587116..13587355,13587431..13587547)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042181"
FT                   /product="hCG2042181"
FT                   /note="gene_id=hCG2042181.0 transcript_id=hCT2347412.0
FT                   protein_id=hCP1911415.0"
FT                   /protein_id="EAW77519.1"
FT                   VWFTGSQELEPILS"
FT   gene            complement(<13605756..>13606686)
FT                   /locus_tag="hCG_1786435"
FT                   /note="gene_id=hCG1786435.1"
FT   mRNA            complement(join(<13605756..13605926,13606558..>13606686))
FT                   /locus_tag="hCG_1786435"
FT                   /product="hCG1786435"
FT                   /note="gene_id=hCG1786435.1 transcript_id=hCT1825473.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(13605756..13605926,13606558..13606686))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786435"
FT                   /product="hCG1786435"
FT                   /note="gene_id=hCG1786435.1 transcript_id=hCT1825473.0
FT                   protein_id=hCP1733365.0"
FT                   /protein_id="EAW77520.1"
FT   gene            13656827..13831042
FT                   /gene="CGNL1"
FT                   /locus_tag="hCG_2002631"
FT                   /note="gene_id=hCG2002631.0"
FT   mRNA            join(13656827..13656889,13718311..13719927,
FT                   13720704..13720798,13722701..13722806,13731829..13731930,
FT                   13732470..13732618,13734012..13734147,13742009..13742221,
FT                   13797109..13797315,13798720..13798824,13803816..13803968,
FT                   13804908..13805078,13808981..13809142,13812017..13812106,
FT                   13824023..13824106,13824800..13824924,13825919..13826027,
FT                   13826403..13826566,13827682..13831042)
FT                   /gene="CGNL1"
FT                   /locus_tag="hCG_2002631"
FT                   /product="cingulin-like 1"
FT                   /note="gene_id=hCG2002631.0 transcript_id=hCT2287632.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   CDS             join(13718326..13719927,13720704..13720798,
FT                   13722701..13722806,13731829..13731930,13732470..13732618,
FT                   13734012..13734147,13742009..13742221,13797109..13797315,
FT                   13798720..13798824,13803816..13803968,13804908..13805078,
FT                   13808981..13809142,13812017..13812106,13824023..13824106,
FT                   13824800..13824924,13825919..13826027,13826403..13826566,
FT                   13827682..13827817)
FT                   /codon_start=1
FT                   /gene="CGNL1"
FT                   /locus_tag="hCG_2002631"
FT                   /product="cingulin-like 1"
FT                   /note="gene_id=hCG2002631.0 transcript_id=hCT2287632.0
FT                   protein_id=hCP1878977.0"
FT                   /db_xref="GOA:Q0VF96"
FT                   /db_xref="HGNC:HGNC:25931"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VF96"
FT                   /protein_id="EAW77521.1"
FT                   EAPVSYTFSKDSTVASQI"
FT   gene            13872251..13965671
FT                   /locus_tag="hCG_40688"
FT                   /note="gene_id=hCG40688.2"
FT   mRNA            join(13872251..13872442,13884602..13884688,
FT                   13898371..13898526,13901946..13902038,13906117..13906230,
FT                   13910042..13910194,13912775..13912900,13913954..13914082,
FT                   13918036..13918115,13919781..13919886,13941785..13941868,
FT                   13955301..13955401,13964708..13965671)
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, transcript variant hCT31949"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT31949.2; splice
FT                   donor-acceptor pairs covered / total pairs = 12/12; created
FT                   on 26-AUG-2002"
FT   mRNA            join(13872251..13872442,13884602..13884688,
FT                   13898371..13898526,13901946..13902038,13906117..13906230,
FT                   13910042..13910194,13912775..13912900,13913954..13914082,
FT                   13918036..13918115,13919781..13919886,13941785..13941868,
FT                   13955301..13955401,13964708..13965151,13965330..13965387)
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, transcript variant hCT2287637"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT2287637.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/13;
FT                   created on 26-AUG-2002"
FT   CDS             join(13872368..13872442,13884602..13884688,
FT                   13898371..13898526,13901946..13902038,13906117..13906230,
FT                   13910042..13910194,13912775..13912900,13913954..13914082,
FT                   13918036..13918115,13919781..13919886,13941785..13941868,
FT                   13955301..13955401,13964708..13964804)
FT                   /codon_start=1
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, isoform CRA_a"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT2287637.0
FT                   protein_id=hCP1878988.0 isoform=CRA_a"
FT                   /db_xref="GOA:P0CAP1"
FT                   /db_xref="HGNC:HGNC:43444"
FT                   /db_xref="InterPro:IPR028273"
FT                   /db_xref="PDB:2KXS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CAP1"
FT                   /protein_id="EAW77522.1"
FT                   LTMKKTLT"
FT   CDS             join(13872368..13872442,13884602..13884688,
FT                   13898371..13898526,13901946..13902038,13906117..13906230,
FT                   13910042..13910194,13912775..13912900,13913954..13914082,
FT                   13918036..13918115,13919781..13919886,13941785..13941868,
FT                   13955301..13955401,13964708..13964804)
FT                   /codon_start=1
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, isoform CRA_a"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT31949.2
FT                   protein_id=hCP50444.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5W4"
FT                   /db_xref="InterPro:IPR028273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5W4"
FT                   /protein_id="EAW77523.1"
FT                   LTMKKTLT"
FT   mRNA            join(13884615..13884688,13898371..13898526,
FT                   13901946..13902038,13906117..13906230,13910042..13910194,
FT                   13912775..13912900,13913954..13914082,13918036..13918115,
FT                   13919781..13919886,13955301..13955401,13964708..13965665)
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, transcript variant hCT2355717"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT2355717.0;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 14-JUL-2004"
FT   CDS             join(13898467..13898526,13901946..13902038,
FT                   13906117..13906230,13910042..13910194,13912775..13912900,
FT                   13913954..13914082,13918036..13918115,13919781..13919886,
FT                   13955301..13955401,13964708..13964804)
FT                   /codon_start=1
FT                   /locus_tag="hCG_40688"
FT                   /product="hCG40688, isoform CRA_b"
FT                   /note="gene_id=hCG40688.2 transcript_id=hCT2355717.0
FT                   protein_id=hCP1920967.0 isoform=CRA_b"
FT                   /protein_id="EAW77524.1"
FT                   RVLELTMKKTLT"
FT   gene            13986437..13997376
FT                   /locus_tag="hCG_1642449"
FT                   /note="gene_id=hCG1642449.4"
FT   mRNA            join(13986437..13986667,13988897..13989070,
FT                   13991696..13991900,13994238..13997256)
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, transcript variant hCT2355765"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT2355765.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2004"
FT   mRNA            join(13986462..13986667,13988426..13989070,
FT                   13991696..13991900,13994238..13997256)
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, transcript variant hCT1642576"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT1642576.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 24-NOV-2003"
FT   CDS             join(13986555..13986667,13988426..13989070,
FT                   13991696..13991900,13994238..13994381)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, isoform CRA_a"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT1642576.3
FT                   protein_id=hCP1603312.2 isoform=CRA_a"
FT                   /db_xref="GOA:P0CAP2"
FT                   /db_xref="HGNC:HGNC:14862"
FT                   /db_xref="InterPro:IPR026213"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CAP2"
FT                   /protein_id="EAW77525.1"
FT   CDS             join(13986555..13986667,13988897..13989070,
FT                   13991696..13991900,13994238..13994381)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, isoform CRA_c"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT2355765.0
FT                   protein_id=hCP1920975.0 isoform=CRA_c"
FT                   /db_xref="GOA:P0CAP1"
FT                   /db_xref="HGNC:HGNC:43444"
FT                   /db_xref="InterPro:IPR028273"
FT                   /db_xref="PDB:2KXS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CAP1"
FT                   /protein_id="EAW77527.1"
FT   mRNA            13994231..13997376
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, transcript variant hCT2287620"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT2287620.0;
FT                   overlap evidence=yes; created on 24-NOV-2003"
FT   CDS             13995145..13995351
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642449"
FT                   /product="hCG1642449, isoform CRA_b"
FT                   /note="gene_id=hCG1642449.4 transcript_id=hCT2287620.0
FT                   protein_id=hCP1878974.0 isoform=CRA_b"
FT                   /protein_id="EAW77526.1"
FT   gene            complement(14233109..14345297)
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /note="gene_id=hCG1786466.4"
FT   mRNA            complement(join(14233109..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272523..14272651,14274656..14274717,
FT                   14290231..14290360,14293440..14293580,14293759..14293863,
FT                   14345113..14345287))
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   transcript variant hCT2355682"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT2355682.0;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 14-JUL-2004"
FT   mRNA            complement(join(14233110..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272283..14272396,14272523..14272651,
FT                   14274656..14274717,14290231..14290360,14293440..14293580,
FT                   14293759..14293863,14345113..14345297))
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   transcript variant hCT1825504"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT1825504.3;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 08-OCT-2003"
FT   mRNA            complement(join(14233110..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272283..14272396,14272523..14272651,
FT                   14274656..14274717,14290231..14290360,14293440..14293576,
FT                   14293755..14293863,14345113..14345297))
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   transcript variant hCT2287681"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT2287681.1;
FT                   splice donor-acceptor pairs covered / total pairs = 11/12;
FT                   created on 08-OCT-2003"
FT   CDS             complement(join(14234876..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272523..14272651,14274656..14274717,
FT                   14290231..14290360,14293440..14293580,14293759..14293863,
FT                   14345113..14345229))
FT                   /codon_start=1
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT2355682.0
FT                   protein_id=hCP1920910.0 isoform=CRA_b"
FT                   /protein_id="EAW77529.1"
FT   CDS             complement(join(14234876..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272283..14272396,14272523..14272651,
FT                   14274656..14274717,14290231..14290360,14293440..14293580,
FT                   14293759..14293863,14345113..14345229))
FT                   /codon_start=1
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT1825504.3
FT                   protein_id=hCP1733669.1 isoform=CRA_a"
FT                   /protein_id="EAW77528.1"
FT                   S"
FT   CDS             complement(join(14234876..14234948,14240449..14240523,
FT                   14240816..14240973,14241691..14241855,14243564..14243748,
FT                   14245404..14245506,14272283..14272396,14272523..14272651,
FT                   14274656..14274717,14290231..14290360,14293440..14293576,
FT                   14293755..14293863,14345113..14345229))
FT                   /codon_start=1
FT                   /gene="ALDH1A2"
FT                   /locus_tag="hCG_1786466"
FT                   /product="aldehyde dehydrogenase 1 family, member A2,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1786466.4 transcript_id=hCT2287681.1
FT                   protein_id=hCP1878994.0 isoform=CRA_c"
FT                   /protein_id="EAW77530.1"
FT                   S"
FT   gene            complement(14258990..14260292)
FT                   /pseudo
FT                   /locus_tag="hCG_40046"
FT                   /note="gene_id=hCG40046.2"
FT   mRNA            complement(14258990..14260292)
FT                   /pseudo
FT                   /locus_tag="hCG_40046"
FT                   /note="gene_id=hCG40046.2 transcript_id=hCT31299.2; overlap
FT                   evidence=no; created on 26-AUG-2002"
FT   gene            14344803..>14358589
FT                   /locus_tag="hCG_2002577"
FT                   /note="gene_id=hCG2002577.0"
FT   mRNA            join(14344803..14345321,14346394..14346513,
FT                   14350387..14350608,14358108..>14358589)
FT                   /locus_tag="hCG_2002577"
FT                   /product="hCG2002577"
FT                   /note="gene_id=hCG2002577.0 transcript_id=hCT2287548.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(14350410..14350608,14358108..>14358589)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2002577"
FT                   /product="hCG2002577"
FT                   /note="gene_id=hCG2002577.0 transcript_id=hCT2287548.0
FT                   protein_id=hCP1879020.0"
FT                   /protein_id="EAW77531.1"
FT                   ISPHE"
FT   gene            14417836..14466031
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /note="gene_id=hCG40043.4"
FT   mRNA            join(14417836..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14459243..14459460,
FT                   14464081..14466031)
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, transcript variant hCT31296"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT31296.4; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   mRNA            join(14417836..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14464081..14466031)
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, transcript variant hCT1971228"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT1971228.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(14417836..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14459243..14459460,
FT                   14464081..14464690,14464741..14464807)
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, transcript variant hCT2287550"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT2287550.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(14418138..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14459243..14459460,
FT                   14464081..14464255)
FT                   /codon_start=1
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, isoform CRA_a"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT31296.4
FT                   protein_id=hCP49806.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q6FGT0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR015685"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FGT0"
FT                   /protein_id="EAW77532.1"
FT                   SEDKPEKYELSVIM"
FT   CDS             join(14418138..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14459243..14459460,
FT                   14464081..14464255)
FT                   /codon_start=1
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, isoform CRA_a"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT2287550.0
FT                   protein_id=hCP1879007.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6FGT0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR015685"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FGT0"
FT                   /protein_id="EAW77533.1"
FT                   SEDKPEKYELSVIM"
FT   CDS             join(14418138..14418248,14446793..14446919,
FT                   14453188..14453325,14455038..14455156,14464081..14464167)
FT                   /codon_start=1
FT                   /gene="AQP9"
FT                   /locus_tag="hCG_40043"
FT                   /product="aquaporin 9, isoform CRA_b"
FT                   /note="gene_id=hCG40043.4 transcript_id=hCT1971228.1
FT                   protein_id=hCP1783320.1 isoform=CRA_b"
FT                   /protein_id="EAW77534.1"
FT   assembly_gap    14437065..14437084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14473419..14473438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14476899..14476918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14478858..14479243
FT                   /pseudo
FT                   /locus_tag="hCG_40047"
FT                   /note="gene_id=hCG40047.2"
FT   mRNA            14478858..14479243
FT                   /pseudo
FT                   /locus_tag="hCG_40047"
FT                   /note="gene_id=hCG40047.2 transcript_id=hCT31300.1; overlap
FT                   evidence=no; created on 26-AUG-2002"
FT   gene            complement(14492445..14557584)
FT                   /locus_tag="hCG_1646498"
FT                   /note="gene_id=hCG1646498.2"
FT   mRNA            complement(join(14492445..14492546,14503857..14504014,
FT                   14524375..14524542,14557435..14557584))
FT                   /locus_tag="hCG_1646498"
FT                   /product="hCG1646498"
FT                   /note="gene_id=hCG1646498.2 transcript_id=hCT1646625.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(14503905..14504014,14524375..14524542,
FT                   14557435..14557513))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1646498"
FT                   /product="hCG1646498"
FT                   /note="gene_id=hCG1646498.2 transcript_id=hCT1646625.2
FT                   protein_id=hCP1632145.2"
FT                   /protein_id="EAW77535.1"
FT                   FQNKMPVYLLLSGI"
FT   gene            14710238..14847237
FT                   /gene="LIPC"
FT                   /locus_tag="hCG_38884"
FT                   /note="gene_id=hCG38884.3"
FT   mRNA            join(14710238..14710382,14816603..14816787,
FT                   14820055..14820237,14820804..14820921,14824014..14824247,
FT                   14826602..14826844,14839164..14839281,14841804..14842022,
FT                   14847024..14847237)
FT                   /gene="LIPC"
FT                   /locus_tag="hCG_38884"
FT                   /product="lipase, hepatic"
FT                   /note="gene_id=hCG38884.3 transcript_id=hCT30130.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             join(14710295..14710382,14816603..14816787,
FT                   14820055..14820237,14820804..14820921,14824014..14824247,
FT                   14826602..14826844,14839164..14839281,14841804..14842022,
FT                   14847024..14847135)
FT                   /codon_start=1
FT                   /gene="LIPC"
FT                   /locus_tag="hCG_38884"
FT                   /product="lipase, hepatic"
FT                   /note="gene_id=hCG38884.3 transcript_id=hCT30130.3
FT                   protein_id=hCP49802.2"
FT                   /protein_id="EAW77536.1"
FT   gene            14799571..14801631
FT                   /locus_tag="hCG_2045341"
FT                   /note="gene_id=hCG2045341.0"
FT   mRNA            join(14799571..14799906,14800213..14801631)
FT                   /locus_tag="hCG_2045341"
FT                   /product="hCG2045341"
FT                   /note="gene_id=hCG2045341.0 transcript_id=hCT2360176.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             14800675..14800881
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045341"
FT                   /product="hCG2045341"
FT                   /note="gene_id=hCG2045341.0 transcript_id=hCT2360176.0
FT                   protein_id=hCP1925417.0"
FT                   /protein_id="EAW77537.1"
FT   gene            complement(14816841..14818119)
FT                   /locus_tag="hCG_40042"
FT                   /note="gene_id=hCG40042.3"
FT   mRNA            complement(14816841..14818119)
FT                   /locus_tag="hCG_40042"
FT                   /product="hCG40042"
FT                   /note="gene_id=hCG40042.3 transcript_id=hCT31295.3; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(14817413..14817619)
FT                   /codon_start=1
FT                   /locus_tag="hCG_40042"
FT                   /product="hCG40042"
FT                   /note="gene_id=hCG40042.3 transcript_id=hCT31295.3
FT                   protein_id=hCP49805.2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UI57"
FT                   /protein_id="EAW77538.1"
FT   gene            complement(14873462..15027933)
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /note="gene_id=hCG40040.3"
FT   mRNA            complement(join(14873462..14875896,14877853..14877979,
FT                   14888551..14888771,14889253..14889361,14890062..14890245,
FT                   14899410..14899560,14905640..14905823,14911136..14911299,
FT                   14918717..14918900,14921826..14921918,14923995..14924144,
FT                   14943045..14943145,14957072..14957230,14960144..14960262,
FT                   14995526..14995676,15027429..15027933))
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, transcript
FT                   variant hCT31293"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT31293.2; splice
FT                   donor-acceptor pairs covered / total pairs = 15/15; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(14874720..14875624,14875674..14875896,
FT                   14877853..14877979,14888551..14888771,14889253..14889361,
FT                   14890062..14890245,14899410..14899560,14905640..14905823,
FT                   14911136..14911299,14918717..14918900,14921826..14921918,
FT                   14923995..14924144,14943045..14943145,14957072..14957230,
FT                   14960144..14960262,14995526..14995676,15027429..15027933))
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, transcript
FT                   variant hCT2287671"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT2287671.0;
FT                   splice donor-acceptor pairs covered / total pairs = 15/16;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(14874720..14875624,14875674..14875896,
FT                   14877853..14877979,14888551..14888771,14889253..14889361,
FT                   14890062..14890245,14899410..14899560,14905640..14905823,
FT                   14911136..14911299,14918717..14918900,14921826..14921918,
FT                   14923995..14924144,14943045..14943145,14954091..14954235,
FT                   14957068..14957231))
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, transcript
FT                   variant hCT2287670"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT2287670.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/14;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(14875802..14875896,14877853..14877979,
FT                   14888551..14888771,14889253..14889361,14890062..14890245,
FT                   14899410..14899560,14905640..14905823,14911136..14911299,
FT                   14918717..14918900,14921826..14921918,14923995..14924144,
FT                   14943045..14943145,14957072..14957230,14960144..14960262,
FT                   14995526..14995676,15027429..15027483))
FT                   /codon_start=1
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, isoform CRA_b"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT2287671.0
FT                   protein_id=hCP1879002.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5U5"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR027053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U5"
FT                   /protein_id="EAW77540.1"
FT   CDS             complement(join(14875802..14875896,14877853..14877979,
FT                   14888551..14888771,14889253..14889361,14890062..14890245,
FT                   14899410..14899560,14905640..14905823,14911136..14911299,
FT                   14918717..14918900,14921826..14921918,14923995..14924144,
FT                   14943045..14943145,14957072..14957230,14960144..14960262,
FT                   14995526..14995676,15027429..15027483))
FT                   /codon_start=1
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, isoform CRA_b"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT31293.2
FT                   protein_id=hCP49803.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5U5"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR027053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U5"
FT                   /protein_id="EAW77541.1"
FT   CDS             complement(join(14875802..14875896,14877853..14877979,
FT                   14888551..14888771,14889253..14889361,14890062..14890245,
FT                   14899410..14899560,14905640..14905823,14911136..14911299,
FT                   14918717..14918900,14921826..14921918,14923995..14924144,
FT                   14943045..14943086))
FT                   /codon_start=1
FT                   /gene="ADAM10"
FT                   /locus_tag="hCG_40040"
FT                   /product="ADAM metallopeptidase domain 10, isoform CRA_a"
FT                   /note="gene_id=hCG40040.3 transcript_id=hCT2287670.0
FT                   protein_id=hCP1879000.0 isoform=CRA_a"
FT                   /protein_id="EAW77539.1"
FT   gene            14950203..14950964
FT                   /pseudo
FT                   /locus_tag="hCG_1791373"
FT                   /note="gene_id=hCG1791373.1"
FT   mRNA            14950203..14950964
FT                   /pseudo
FT                   /locus_tag="hCG_1791373"
FT                   /note="gene_id=hCG1791373.1 transcript_id=hCT1830633.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            14964330..14965523
FT                   /pseudo
FT                   /locus_tag="hCG_40041"
FT                   /note="gene_id=hCG40041.1"
FT   mRNA            14964330..14965523
FT                   /pseudo
FT                   /locus_tag="hCG_40041"
FT                   /note="gene_id=hCG40041.1 transcript_id=hCT31294.3; overlap
FT                   evidence=no; created on 02-FEB-2004"
FT   gene            complement(14968399..>14971073)
FT                   /locus_tag="hCG_1786469"
FT                   /note="gene_id=hCG1786469.2"
FT   mRNA            complement(join(14968399..14969600,14969913..>14971073))
FT                   /locus_tag="hCG_1786469"
FT                   /product="hCG1786469"
FT                   /note="gene_id=hCG1786469.2 transcript_id=hCT1825507.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(14970120..14971073)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1786469"
FT                   /product="hCG1786469"
FT                   /note="gene_id=hCG1786469.2 transcript_id=hCT1825507.2
FT                   protein_id=hCP1733662.1"
FT                   /protein_id="EAW77542.1"
FT   gene            complement(15046029..>15048929)
FT                   /locus_tag="hCG_2038273"
FT                   /note="gene_id=hCG2038273.0"
FT   mRNA            complement(join(15046029..15046834,15048342..>15048929))
FT                   /locus_tag="hCG_2038273"
FT                   /product="hCG2038273"
FT                   /note="gene_id=hCG2038273.0 transcript_id=hCT2342699.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 07-APR-2003"
FT   CDS             complement(15046054..>15046287)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038273"
FT                   /product="hCG2038273"
FT                   /note="gene_id=hCG2038273.0 transcript_id=hCT2342699.0
FT                   protein_id=hCP1908371.0"
FT                   /protein_id="EAW77543.1"
FT   gene            15049145..15135841
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /note="gene_id=hCG40045.4"
FT   mRNA            join(15049145..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15125258..15125431,15129732..15129926,15132446..15135494)
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   transcript variant hCT2355776"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355776.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15049155..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15109731..15109873,15125258..15125431,15129732..15129926,
FT                   15132446..15135841)
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   transcript variant hCT31298"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT31298.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   mRNA            join(15049237..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088227,15099664..15099770,
FT                   15109731..15109873,15125258..15125431,15129732..15129926,
FT                   15132443..15132522)
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   transcript variant hCT2355775"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355775.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15049269..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15109731..15109873,15125258..15125431,15129732..15129926,
FT                   15132443..>15132521)
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   transcript variant hCT2355777"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355777.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   CDS             join(15049351..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15109731..15109873,15125258..15125431,15129732..15129926,
FT                   15132446..15132571)
FT                   /codon_start=1
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT31298.3
FT                   protein_id=hCP49808.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8NBR6"
FT                   /db_xref="HGNC:HGNC:26954"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NBR6"
FT                   /protein_id="EAW77546.1"
FT   CDS             join(15049351..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15109731..15109873,15125258..15125431,15129732..15129926,
FT                   15132443..>15132521)
FT                   /codon_start=1
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355777.0
FT                   protein_id=hCP1921005.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8NBR6"
FT                   /db_xref="HGNC:HGNC:26954"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NBR6"
FT                   /protein_id="EAW77545.1"
FT   CDS             join(15049351..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088329,15099664..15099766,
FT                   15125258..15125301)
FT                   /codon_start=1
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355776.0
FT                   protein_id=hCP1921004.0 isoform=CRA_d"
FT                   /db_xref="GOA:J3KNL7"
FT                   /db_xref="HGNC:HGNC:26954"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniProtKB/TrEMBL:J3KNL7"
FT                   /protein_id="EAW77547.1"
FT   CDS             join(15049351..15050190,15065862..15065919,
FT                   15080254..15080318,15088171..15088227,15099664..15099770,
FT                   15109731..15109743)
FT                   /codon_start=1
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2355775.0
FT                   protein_id=hCP1921003.0 isoform=CRA_e"
FT                   /db_xref="GOA:H0YM15"
FT                   /db_xref="HGNC:HGNC:26954"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniProtKB/TrEMBL:H0YM15"
FT                   /protein_id="EAW77548.1"
FT   mRNA            join(15049519..15049657,15050002..15050190,
FT                   15065862..15065919,15080254..15080318,15088171..15088329,
FT                   15099664..15099766,15109731..15109873,15125258..15125431,
FT                   15129732..15129926,15132446..15135841)
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   transcript variant hCT2287545"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2287545.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             join(15065877..15065919,15080254..15080318,
FT                   15088171..15088329,15099664..15099766,15109731..15109873,
FT                   15125258..15125431,15129732..15129926,15132446..15132571)
FT                   /codon_start=1
FT                   /gene="FAM63B"
FT                   /locus_tag="hCG_40045"
FT                   /product="family with sequence similarity 63, member B,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG40045.4 transcript_id=hCT2287545.0
FT                   protein_id=hCP1879015.0 isoform=CRA_a"
FT                   /protein_id="EAW77544.1"
FT   gene            complement(15142398..>15144224)
FT                   /locus_tag="hCG_1820884"
FT                   /note="gene_id=hCG1820884.1"
FT   mRNA            complement(join(15142398..15143247,15144127..>15144224))
FT                   /locus_tag="hCG_1820884"
FT                   /product="hCG1820884"
FT                   /note="gene_id=hCG1820884.1 transcript_id=hCT1971348.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(15142507..>15143085)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820884"
FT                   /product="hCG1820884"
FT                   /note="gene_id=hCG1820884.1 transcript_id=hCT1971348.0
FT                   protein_id=hCP1783695.0"
FT                   /protein_id="EAW77549.1"
FT   gene            15147578..15148131
FT                   /pseudo
FT                   /locus_tag="hCG_1786479"
FT                   /note="gene_id=hCG1786479.2"
FT   mRNA            15147578..15148131
FT                   /pseudo
FT                   /locus_tag="hCG_1786479"
FT                   /note="gene_id=hCG1786479.2 transcript_id=hCT1825517.0;
FT                   overlap evidence=no; created on 08-JAN-2004"
FT   gene            complement(15157009..15212086)
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /note="gene_id=hCG1818525.1"
FT   mRNA            complement(join(15157009..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177901,15179224..15179251,15194896..15194960,
FT                   15211364..15212086))
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, transcript
FT                   variant hCT1963882"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963882.1;
FT                   splice donor-acceptor pairs covered / total pairs = 16/17;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(15157009..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177901,15179224..15179251,15190536..15190583,
FT                   15191472..15191669,15194896..15194960,15210316..15210403,
FT                   15211364..15212086))
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, transcript
FT                   variant hCT1963883"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963883.1;
FT                   splice donor-acceptor pairs covered / total pairs = 20/20;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(15157013..15157737,15157941..15158068,
FT                   15161587..15161747,15164936..15165080,15165187..15165501,
FT                   15166346..15166516,15167391..15167515,15168242..15168422,
FT                   15170858..15171021,15171240..15171325,15171782..15171948,
FT                   15172051..15172154,15172394..15172543,15175075..15175193,
FT                   15176767..15176816,15177433..15177901,15179224..15179251,
FT                   15194896..15194960,15211364..15212086))
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, transcript
FT                   variant hCT1963880"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963880.1;
FT                   splice donor-acceptor pairs covered / total pairs = 17/18;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(15157013..15157737,15157941..15158068,
FT                   15161587..15161747,15164936..15165080,15165187..15165501,
FT                   15166346..15166516,15167391..15167515,15168242..15168422,
FT                   15170858..15171021,15171240..15171325,15171782..15171948,
FT                   15172051..15172154,15172394..15172543,15175075..15175193,
FT                   15176767..15176816,15177433..15177901,15179224..15179251,
FT                   15190536..15190583,15191472..15191669,15194896..15194960,
FT                   15210316..15210403,15211364..15212086))
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, transcript
FT                   variant hCT1963881"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963881.1;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(15157960..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177901,15179224..15179251,15190536..15190583,
FT                   15191472..15191669,15194896..15194960,15210316..15210403,
FT                   15211364..15211927))
FT                   /codon_start=1
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963883.1
FT                   protein_id=hCP1778568.1 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5X3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X3"
FT                   /protein_id="EAW77552.1"
FT                   RF"
FT   CDS             complement(join(15157960..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177901,15179224..15179251,15190536..15190583,
FT                   15191472..15191669,15194896..15194960,15210316..15210403,
FT                   15211364..15211927))
FT                   /codon_start=1
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963881.1
FT                   protein_id=hCP1778573.1 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5X3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5X3"
FT                   /protein_id="EAW77553.1"
FT                   RF"
FT   CDS             complement(join(15157960..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177806))
FT                   /codon_start=1
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963882.1
FT                   protein_id=hCP1778574.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5U7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U7"
FT                   /protein_id="EAW77550.1"
FT   CDS             complement(join(15157960..15158068,15161587..15161747,
FT                   15164936..15165080,15165187..15165501,15166346..15166516,
FT                   15167391..15167515,15168242..15168422,15170858..15171021,
FT                   15171240..15171325,15171782..15171948,15172051..15172154,
FT                   15172394..15172543,15175075..15175193,15176767..15176816,
FT                   15177433..15177806))
FT                   /codon_start=1
FT                   /gene="SLTM"
FT                   /locus_tag="hCG_1818525"
FT                   /product="SAFB-like, transcription modulator, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1818525.1 transcript_id=hCT1963880.1
FT                   protein_id=hCP1778567.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5U7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5U7"
FT                   /protein_id="EAW77551.1"
FT   gene            15265638..15375020
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /note="gene_id=hCG1811968.2"
FT   mRNA            join(15265638..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344730..15345049,15353923..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15374390)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2355740"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355740.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15265639..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344730..15345049,15353920..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15374396)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2355742"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355742.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15265684..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344730..15345049,15353920..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15373044,
FT                   15373100..15375018)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2288051"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288051.0;
FT                   splice donor-acceptor pairs covered / total pairs = 14/14;
FT                   created on 26-AUG-2002"
FT   mRNA            join(15265684..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344937..15345049,15353920..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15375018)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT1955462"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT1955462.1;
FT                   splice donor-acceptor pairs covered / total pairs = 12/13;
FT                   created on 26-AUG-2002"
FT   mRNA            join(15265684..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344937..15345049,15353920..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15373044,
FT                   15373100..15375018)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2288049"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288049.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/14;
FT                   created on 26-AUG-2002"
FT   mRNA            join(15265927..15266043,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344730..15345049,15353920..15354181,15358902..15359250,
FT                   15362068..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15375020)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2355741"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355741.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15266120..15266380,15308770..15309668,
FT                   15330271..15330397,15333648..15333811,15336322..15336516,
FT                   15344730..15345049,15353920..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370479..15370606,15372749..15374397)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2355739"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355739.0;
FT                   splice donor-acceptor pairs covered / total pairs = 13/13;
FT                   created on 14-JUL-2004"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344730..15345049,
FT                   15353920..15354181,15358902..15359250,15362068..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_f"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355741.0
FT                   protein_id=hCP1920919.0 isoform=CRA_f"
FT                   /db_xref="GOA:Q6ZNA4"
FT                   /db_xref="HGNC:HGNC:17384"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029306"
FT                   /db_xref="PDB:2KIZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ZNA4"
FT                   /protein_id="EAW77561.1"
FT                   QLPSES"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344730..15345049,
FT                   15353920..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370479..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_d"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355739.0
FT                   protein_id=hCP1920917.0 isoform=CRA_d"
FT                   /protein_id="EAW77558.1"
FT                   LPSES"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344730..15345049,
FT                   15353920..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_c"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288051.0
FT                   protein_id=hCP1879046.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5T5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T5"
FT                   /protein_id="EAW77556.1"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344730..15345049,
FT                   15353920..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_c"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355742.0
FT                   protein_id=hCP1920920.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A024R5T5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T5"
FT                   /protein_id="EAW77557.1"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344730..15345049,
FT                   15353923..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_g"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2355740.0
FT                   protein_id=hCP1920918.0 isoform=CRA_g"
FT                   /protein_id="EAW77562.1"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344937..15345049,
FT                   15353920..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_b"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT1955462.1
FT                   protein_id=hCP1764801.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5V6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V6"
FT                   /protein_id="EAW77555.1"
FT   CDS             join(15308789..15309668,15330271..15330397,
FT                   15333648..15333811,15336322..15336516,15344937..15345049,
FT                   15353920..15354181,15358902..15359250,15362095..15362220,
FT                   15363625..15363751,15367633..15367725,15369025..15369120,
FT                   15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_b"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288049.0
FT                   protein_id=hCP1879048.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5V6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR029306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V6"
FT                   /protein_id="EAW77560.1"
FT   mRNA            join(15344957..15345049,15353923..15354181,
FT                   15358902..15359250,15362095..15362220,15363625..15363751,
FT                   15367633..15367725,15369025..15369120,15370479..15370606,
FT                   15372749..15373044,15373100..15375018)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2288047"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288047.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 26-AUG-2002"
FT   CDS             join(15354106..15354181,15358902..15359250,
FT                   15362095..15362220,15363625..15363751,15367633..15367725,
FT                   15369025..15369120,15370479..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_e"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288047.0
FT                   protein_id=hCP1879047.0 isoform=CRA_e"
FT                   /protein_id="EAW77559.1"
FT   mRNA            join(15363553..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15375018)
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, transcript variant
FT                   hCT2288044"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288044.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(15363749..15363751,15367633..15367725,
FT                   15369025..15369120,15370503..15370606,15372749..15372866)
FT                   /codon_start=1
FT                   /gene="RNF111"
FT                   /locus_tag="hCG_1811968"
FT                   /product="ring finger protein 111, isoform CRA_a"
FT                   /note="gene_id=hCG1811968.2 transcript_id=hCT2288044.0
FT                   protein_id=hCP1879044.0 isoform=CRA_a"
FT                   /protein_id="EAW77554.1"
FT   gene            15382603..15403658
FT                   /gene="CCNB2"
FT                   /locus_tag="hCG_37790"
FT                   /note="gene_id=hCG37790.3"
FT   mRNA            join(15382603..15383258,15385288..15385416,
FT                   15385523..15385636,15392410..15392580,15392684..15392842,
FT                   15394656..15394892,15395194..15395334,15401483..15401593,
FT                   15402733..15403658)
FT                   /gene="CCNB2"
FT                   /locus_tag="hCG_37790"
FT                   /product="cyclin B2"
FT                   /note="gene_id=hCG37790.3 transcript_id=hCT29024.3; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 26-AUG-2002"
FT   CDS             join(15383235..15383258,15385288..15385416,
FT                   15385523..15385636,15392410..15392580,15392684..15392842,
FT                   15394656..15394892,15395194..15395334,15401483..15401593,
FT                   15402733..15402843)
FT                   /codon_start=1
FT                   /gene="CCNB2"
FT                   /locus_tag="hCG_37790"
FT                   /product="cyclin B2"
FT                   /note="gene_id=hCG37790.3 transcript_id=hCT29024.3
FT                   protein_id=hCP48499.2"
FT                   /db_xref="GOA:O95067"
FT                   /db_xref="HGNC:HGNC:1580"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/Swiss-Prot:O95067"
FT                   /protein_id="EAW77563.1"
FT   gene            complement(15414329..15650846)
FT                   /gene="MYO1E"
FT                   /locus_tag="hCG_38672"
FT                   /note="gene_id=hCG38672.3"
FT   mRNA            complement(join(15414329..15415422,15416164..15416333,
FT                   15431555..15431756,15436252..15436344,15439038..15439195,
FT                   15441122..15441268,15449862..15450007,15451715..15451884,
FT                   15452095..15452209,15456365..15456509,15466088..15466186,
FT                   15473431..15473537,15480297..15480378,15483371..15483456,
FT                   15486652..15486819,15488484..15488570,15492195..15492281,
FT                   15492607..15492687,15495858..15496054,15501026..15501158,
FT                   15502656..15502790,15505426..15505557,15509669..15509758,
FT                   15514547..15514634,15534251..15534345,15539387..15539476,
FT                   15550279..15550422,15650472..15650846))
FT                   /gene="MYO1E"
FT                   /locus_tag="hCG_38672"
FT                   /product="myosin IE"
FT                   /note="gene_id=hCG38672.3 transcript_id=hCT2288675.0;
FT                   splice donor-acceptor pairs covered / total pairs = 27/27;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(15415346..15415422,15416164..15416333,
FT                   15431555..15431756,15436252..15436344,15439038..15439195,
FT                   15441122..15441268,15449862..15450007,15451715..15451884,
FT                   15452095..15452209,15456365..15456509,15466088..15466186,
FT                   15473431..15473537,15480297..15480378,15483371..15483456,
FT                   15486652..15486819,15488484..15488570,15492195..15492281,
FT                   15492607..15492687,15495858..15496054,15501026..15501158,
FT                   15502656..15502790,15505426..15505557,15509669..15509758,
FT                   15514547..15514634,15534251..15534345,15539387..15539476,
FT                   15550279..15550422,15650472..15650474))
FT                   /codon_start=1
FT                   /gene="MYO1E"
FT                   /locus_tag="hCG_38672"
FT                   /product="myosin IE"
FT                   /note="gene_id=hCG38672.3 transcript_id=hCT2288675.0
FT                   protein_id=hCP1879028.0"
FT                   /db_xref="GOA:Q4KMR3"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KMR3"
FT                   /protein_id="EAW77564.1"
FT                   I"
FT   gene            15425571..15426213
FT                   /locus_tag="hCG_38666"
FT                   /note="gene_id=hCG38666.1"
FT   mRNA            15425571..15426213
FT                   /locus_tag="hCG_38666"
FT                   /product="hCG38666"
FT                   /note="gene_id=hCG38666.1 transcript_id=hCT29910.0; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   CDS             15425676..15425864
FT                   /codon_start=1
FT                   /locus_tag="hCG_38666"
FT                   /product="hCG38666"
FT                   /note="gene_id=hCG38666.1 transcript_id=hCT29910.0
FT                   protein_id=hCP48500.1"
FT                   /protein_id="EAW77565.1"
FT                   ASLGCPFPALQPTMPEA"
FT   gene            15484787..15486479
FT                   /gene="LDHAL6B"
FT                   /locus_tag="hCG_1643332"
FT                   /note="gene_id=hCG1643332.1"
FT   mRNA            15484787..15486479
FT                   /gene="LDHAL6B"
FT                   /locus_tag="hCG_1643332"
FT                   /product="lactate dehydrogenase A-like 6B"
FT                   /note="gene_id=hCG1643332.1 transcript_id=hCT1643459.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             15484912..15486057
FT                   /codon_start=1
FT                   /gene="LDHAL6B"
FT                   /locus_tag="hCG_1643332"
FT                   /product="lactate dehydrogenase A-like 6B"
FT                   /note="gene_id=hCG1643332.1 transcript_id=hCT1643459.2
FT                   protein_id=hCP1631375.1"
FT                   /protein_id="EAW77566.1"
FT   gene            complement(15679030..15680034)
FT                   /pseudo
FT                   /locus_tag="hCG_38667"
FT                   /note="gene_id=hCG38667.2"
FT   mRNA            complement(15679030..15680034)
FT                   /pseudo
FT                   /locus_tag="hCG_38667"
FT                   /note="gene_id=hCG38667.2 transcript_id=hCT29911.1; overlap
FT                   evidence=no; created on 26-AUG-2002"
FT   gene            complement(<15685045..>15687649)
FT                   /locus_tag="hCG_38670"
FT                   /note="gene_id=hCG38670.2"
FT   mRNA            complement(join(<15685045..15685101,15685562..15685799,
FT                   15687543..>15687649))
FT                   /locus_tag="hCG_38670"
FT                   /product="hCG38670, transcript variant hCT2288672"
FT                   /note="gene_id=hCG38670.2 transcript_id=hCT2288672.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<15685045..15685101,15685562..15685799,
FT                   15687543..15687649))
FT                   /codon_start=1
FT                   /locus_tag="hCG_38670"
FT                   /product="hCG38670, isoform CRA_a"
FT                   /note="gene_id=hCG38670.2 transcript_id=hCT2288672.0
FT                   protein_id=hCP1879026.0 isoform=CRA_a"
FT                   /protein_id="EAW77567.1"
FT   mRNA            complement(join(15685262..15685804,15686032..>15686112))
FT                   /locus_tag="hCG_38670"
FT                   /product="hCG38670, transcript variant hCT29914"
FT                   /note="gene_id=hCG38670.2 transcript_id=hCT29914.1; splice
FT                   donor-acceptor pairs covered / total pairs = 0/1; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(15685433..15685804,15686032..15686112))
FT                   /codon_start=1
FT                   /locus_tag="hCG_38670"
FT                   /product="hCG38670, isoform CRA_b"
FT                   /note="gene_id=hCG38670.2 transcript_id=hCT29914.1
FT                   protein_id=hCP48495.1 isoform=CRA_b"
FT                   /protein_id="EAW77568.1"
FT   gene            15715779..15800811
FT                   /gene="FAM81A"
FT                   /locus_tag="hCG_33304"
FT                   /note="gene_id=hCG33304.3"
FT   mRNA            join(15715779..15715888,15736155..15736251,
FT                   15737538..15737811,15769862..15769980,15784804..15784933,
FT                   15786454..15786560,15791880..15792015,15794236..15794431,
FT                   15798847..15800581)
FT                   /gene="FAM81A"
FT                   /locus_tag="hCG_33304"
FT                   /product="family with sequence similarity 81, member A,
FT                   transcript variant hCT2355743"
FT                   /note="gene_id=hCG33304.3 transcript_id=hCT2355743.0;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 14-JUL-2004"
FT   mRNA            join(15715850..15715888,15716630..15716670,
FT                   15717561..15717729,15736155..15736251,15737538..15737811,
FT                   15769862..15769980,15784804..15784933,15786454..15786560,
FT                   15791880..15792019,15794240..15794431,15798847..15800811)
FT                   /gene="FAM81A"
FT                   /locus_tag="hCG_33304"
FT                   /product="family with sequence similarity 81, member A,
FT                   transcript variant hCT24499"
FT                   /note="gene_id=hCG33304.3 transcript_id=hCT24499.2; splice
FT                   donor-acceptor pairs covered / total pairs = 9/10; created
FT                   on 26-AUG-2002"
FT   CDS             join(15736232..15736251,15737538..15737811,
FT                   15769862..15769980,15784804..15784933,15786454..15786560,
FT                   15791880..15792019,15794240..15794431,15798847..15798971)
FT                   /codon_start=1
FT                   /gene="FAM81A"
FT                   /locus_tag="hCG_33304"
FT                   /product="family with sequence similarity 81, member A,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG33304.3 transcript_id=hCT24499.2
FT                   protein_id=hCP46655.2 isoform=CRA_a"
FT                   /protein_id="EAW77569.1"
FT   CDS             join(15736232..15736251,15737538..15737811,
FT                   15769862..15769980,15784804..15784933,15786454..15786560,
FT                   15791880..15792015,15794236..15794431,15798847..15798971)
FT                   /codon_start=1
FT                   /gene="FAM81A"
FT                   /locus_tag="hCG_33304"
FT                   /product="family with sequence similarity 81, member A,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG33304.3 transcript_id=hCT2355743.0
FT                   protein_id=hCP1920937.0 isoform=CRA_b"
FT                   /protein_id="EAW77570.1"
FT   gene            complement(15829988..15830572)
FT                   /pseudo
FT                   /locus_tag="hCG_1786481"
FT                   /note="gene_id=hCG1786481.1"
FT   mRNA            complement(15829988..15830572)
FT                   /pseudo
FT                   /locus_tag="hCG_1786481"
FT                   /note="gene_id=hCG1786481.1 transcript_id=hCT1825519.1;
FT                   overlap evidence=no; created on 19-JUN-2003"
FT   assembly_gap    15888344..15889449
FT                   /estimated_length=1106
FT                   /gap_type="unknown"
FT   gene            15889769..15898037
FT                   /gene="GCNT3"
FT                   /locus_tag="hCG_32377"
FT                   /note="gene_id=hCG32377.3"
FT   mRNA            join(15889769..15889957,15894668..15894857,
FT                   15896155..15898037)
FT                   /gene="GCNT3"
FT                   /locus_tag="hCG_32377"
FT                   /product="glucosaminyl (N-acetyl) transferase 3, mucin
FT                   type, transcript variant hCT1958150"
FT                   /note="gene_id=hCG32377.3 transcript_id=hCT1958150.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   mRNA            join(15894565..15894857,15896155..15898037)
FT                   /gene="GCNT3"
FT                   /locus_tag="hCG_32377"
FT                   /product="glucosaminyl (N-acetyl) transferase 3, mucin
FT                   type, transcript variant hCT23565"
FT                   /note="gene_id=hCG32377.3 transcript_id=hCT23565.2; splice
FT                   donor-acceptor pairs covered / total pairs = 1/1; created
FT                   on 26-AUG-2002"
FT   CDS             15896215..15897531
FT                   /codon_start=1
FT                   /gene="GCNT3"
FT                   /locus_tag="hCG_32377"
FT                   /product="glucosaminyl (N-acetyl) transferase 3, mucin
FT                   type, isoform CRA_a"
FT                   /note="gene_id=hCG32377.3 transcript_id=hCT23565.2
FT                   protein_id=hCP46647.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5T9"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T9"
FT                   /protein_id="EAW77571.1"
FT   CDS             15896215..15897531
FT                   /codon_start=1
FT                   /gene="GCNT3"
FT                   /locus_tag="hCG_32377"
FT                   /product="glucosaminyl (N-acetyl) transferase 3, mucin
FT                   type, isoform CRA_a"
FT                   /note="gene_id=hCG32377.3 transcript_id=hCT1958150.1
FT                   protein_id=hCP1764790.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5T9"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5T9"
FT                   /protein_id="EAW77572.1"
FT   gene            complement(15916055..15935511)
FT                   /gene="GTF2A2"
FT                   /locus_tag="hCG_33298"
FT                   /note="gene_id=hCG33298.4"
FT   mRNA            complement(join(15916055..15917148,15920103..15920229,
FT                   15928637..15928741,15930174..15930294,15935374..15935511))
FT                   /gene="GTF2A2"
FT                   /locus_tag="hCG_33298"
FT                   /product="general transcription factor IIA, 2, 12kDa,
FT                   transcript variant hCT1962468"
FT                   /note="gene_id=hCG33298.4 transcript_id=hCT1962468.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(15916739..15916803,15916924..15917148,
FT                   15920103..15920229,15928637..15928741,15930174..15930294,
FT                   15935371..15935453))
FT                   /gene="GTF2A2"
FT                   /locus_tag="hCG_33298"
FT                   /product="general transcription factor IIA, 2, 12kDa,
FT                   transcript variant hCT1971172"
FT                   /note="gene_id=hCG33298.4 transcript_id=hCT1971172.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(15917123..15917148,15920103..15920229,
FT                   15928637..15928741,15930174..15930245))
FT                   /codon_start=1
FT                   /gene="GTF2A2"
FT                   /locus_tag="hCG_33298"
FT                   /product="general transcription factor IIA, 2, 12kDa,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG33298.4 transcript_id=hCT1962468.1
FT                   protein_id=hCP1777178.0 isoform=CRA_a"
FT                   /db_xref="GOA:P52657"
FT                   /db_xref="HGNC:HGNC:4647"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="PDB:1NVP"
FT                   /db_xref="PDB:5FUR"
FT                   /db_xref="PDB:5IY6"
FT                   /db_xref="PDB:5IY7"
FT                   /db_xref="PDB:5IY8"
FT                   /db_xref="PDB:5IY9"
FT                   /db_xref="PDB:5IYA"
FT                   /db_xref="PDB:5IYB"
FT                   /db_xref="PDB:5IYC"
FT                   /db_xref="PDB:5IYD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52657"
FT                   /protein_id="EAW77573.1"
FT                   SNTTE"
FT   CDS             complement(join(15917123..15917148,15920103..15920229,
FT                   15928637..15928741,15930174..15930245))
FT                   /codon_start=1
FT                   /gene="GTF2A2"
FT                   /locus_tag="hCG_33298"
FT                   /product="general transcription factor IIA, 2, 12kDa,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG33298.4 transcript_id=hCT1971172.1
FT                   protein_id=hCP1783350.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024R5Z5"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z5"
FT                   /protein_id="EAW77574.1"
FT                   SNTTE"
FT   gene            complement(15940240..>15967319)
FT                   /gene="BNIP2"
FT                   /locus_tag="hCG_33305"
FT                   /note="gene_id=hCG33305.2"
FT   mRNA            complement(join(15940240..15942093,15946865..15946963,
FT                   15947249..15947335,15949156..15949287,15950610..15950712,
FT                   15955884..15956060,15957565..15957741,15958214..15958281,
FT                   15960379..15960485,15967107..>15967319))
FT                   /gene="BNIP2"
FT                   /locus_tag="hCG_33305"
FT                   /product="BCL2/adenovirus E1B 19kDa interacting protein 2,
FT                   transcript variant hCT24500"
FT                   /note="gene_id=hCG33305.2 transcript_id=hCT24500.3; splice
FT                   donor-acceptor pairs covered / total pairs = 9/9; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(15940240..15942093,15946076..15946111,
FT                   15946865..15946963,15947249..15947335,15949156..15949287,
FT                   15950610..15950712,15955884..15956060,15957565..15957741,
FT                   15958214..15958281,15960379..15960485,15967107..>15967319))
FT                   /gene="BNIP2"
FT                   /locus_tag="hCG_33305"
FT                   /product="BCL2/adenovirus E1B 19kDa interacting protein 2,
FT                   transcript variant hCT1971178"
FT                   /note="gene_id=hCG33305.2 transcript_id=hCT1971178.1;
FT                   splice donor-acceptor pairs covered / total pairs = 10/10;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(15942042..15942093,15946865..15946963,
FT                   15947249..15947335,15949156..15949287,15950610..15950712,
FT                   15955884..15956060,15957565..15957741,15958214..15958281,
FT                   15960379..15960485,15967107..15967319))
FT                   /codon_start=1
FT                   /gene="BNIP2"
FT                   /locus_tag="hCG_33305"
FT                   /product="BCL2/adenovirus E1B 19kDa interacting protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG33305.2 transcript_id=hCT24500.3
FT                   protein_id=hCP46644.3 isoform=CRA_a"
FT                   /protein_id="EAW77575.1"
FT                   PKNEQ"
FT   CDS             complement(join(15942042..15942093,15946076..15946111,
FT                   15946865..15946963,15947249..15947335,15949156..15949287,
FT                   15950610..15950712,15955884..15956060,15957565..15957741,
FT                   15958214..15958281,15960379..15960485,15967107..15967319))
FT                   /codon_start=1
FT                   /gene="BNIP2"
FT                   /locus_tag="hCG_33305"
FT                   /product="BCL2/adenovirus E1B 19kDa interacting protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG33305.2 transcript_id=hCT1971178.1
FT                   protein_id=hCP1783309.1 isoform=CRA_b"
FT                   /protein_id="EAW77576.1"
FT                   RVDQELNGKQDEPKNEQ"
FT   gene            15954349..15955827
FT                   /pseudo
FT                   /locus_tag="hCG_33297"
FT                   /note="gene_id=hCG33297.1"
FT   mRNA            15954349..15955827
FT                   /pseudo
FT                   /locus_tag="hCG_33297"
FT                   /note="gene_id=hCG33297.1 transcript_id=hCT24492.1; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   gene            16046314..16047212
FT                   /locus_tag="hCG_33299"
FT                   /note="gene_id=hCG33299.3"
FT   mRNA            16046314..16047212
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, transcript variant hCT24494"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT24494.3; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   mRNA            join(16046317..16046405,16046697..16047181)
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, transcript variant hCT2288101"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT2288101.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   mRNA            join(16046317..16046975,16047009..16047178)
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, transcript variant hCT2288096"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT2288096.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             16046343..16047137
FT                   /codon_start=1
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, isoform CRA_a"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT24494.3
FT                   protein_id=hCP46651.2 isoform=CRA_a"
FT                   /protein_id="EAW77577.1"
FT   CDS             join(16046343..16046975,16047009..16047137)
FT                   /codon_start=1
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, isoform CRA_c"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT2288096.0
FT                   protein_id=hCP1879060.0 isoform=CRA_c"
FT                   /protein_id="EAW77579.1"
FT   CDS             join(16046343..16046405,16046697..16047137)
FT                   /codon_start=1
FT                   /locus_tag="hCG_33299"
FT                   /product="hCG33299, isoform CRA_b"
FT                   /note="gene_id=hCG33299.3 transcript_id=hCT2288101.0
FT                   protein_id=hCP1879061.0 isoform=CRA_b"
FT                   /protein_id="EAW77578.1"
FT                   QESV"
FT   gene            complement(16149732..>16214922)
FT                   /locus_tag="hCG_1811199"
FT                   /note="gene_id=hCG1811199.1"
FT   mRNA            complement(join(16149732..16150352,16150387..16150783,
FT                   16150813..16151038,16151145..16151383,16178118..16178342,
FT                   16185679..16185799,16186437..16186603,16195947..16196063,
FT                   16208852..16208926,16212484..16212549,16213379..16213493,
FT                   16214857..>16214922))
FT                   /locus_tag="hCG_1811199"
FT                   /product="hCG1811199"
FT                   /note="gene_id=hCG1811199.1 transcript_id=hCT1951811.1;
FT                   splice donor-acceptor pairs covered / total pairs = 0/11;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(16150644..16150783,16150813..16151038,
FT                   16151145..16151383,16178118..16178342,16185679..16185799,
FT                   16186437..16186603,16195947..16196063,16208852..16208926,
FT                   16212484..16212549,16213379..16213493,16214857..16214922))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811199"
FT                   /product="hCG1811199"
FT                   /note="gene_id=hCG1811199.1 transcript_id=hCT1951811.1
FT                   protein_id=hCP1750892.1"
FT                   /protein_id="EAW77580.1"
FT                   G"
FT   gene            16282197..16284058
FT                   /gene="FOXB1"
FT                   /locus_tag="hCG_1641620"
FT                   /note="gene_id=hCG1641620.3"
FT   mRNA            16282197..16284058
FT                   /gene="FOXB1"
FT                   /locus_tag="hCG_1641620"
FT                   /product="forkhead box B1"
FT                   /note="gene_id=hCG1641620.3 transcript_id=hCT1641747.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             16282940..16283917
FT                   /codon_start=1
FT                   /gene="FOXB1"
FT                   /locus_tag="hCG_1641620"
FT                   /product="forkhead box B1"
FT                   /note="gene_id=hCG1641620.3 transcript_id=hCT1641747.2
FT                   protein_id=hCP1625914.2"
FT                   /db_xref="GOA:Q99853"
FT                   /db_xref="HGNC:HGNC:3799"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99853"
FT                   /protein_id="EAW77581.1"
FT   gene            complement(16580594..16681095)
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /note="gene_id=hCG2004404.0"
FT   mRNA            complement(join(16580594..16580799,16584322..16584372,
FT                   16591260..16591349,16625569..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16680981..16681095))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290471"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290471.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(16580594..16580799,16584322..16584372,
FT                   16591260..16591349,16625569..16625698,16627085..16627196,
FT                   16629357..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16680981..16681095))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290473"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290473.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(16580594..16580799,16584322..16584372,
FT                   16591260..16591349,16625569..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16676138..16676228))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290475"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290475.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/15;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(16584308..16584372,16591260..16591352,
FT                   16625570..16625698,16627085..16627207,16629367..16629425,
FT                   16629898..16629993,16630557..16630650,16632328..16632387,
FT                   16634094..16634173,16635321..16635411,16639116..16639229,
FT                   16642597..16642691,16660557..16660656,16664243..16664301,
FT                   16676138..16676228))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290472"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290472.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/14;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(16625153..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16676138..16676228))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290469"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290469.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(16625153..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16676066..16676170))
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, transcript variant hCT2290467"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290467.0;
FT                   splice donor-acceptor pairs covered / total pairs = 12/12;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(16625639..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664301,16676066..16676108))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_a"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290467.0
FT                   protein_id=hCP1879075.0 isoform=CRA_a"
FT                   /protein_id="EAW77582.1"
FT                   TKGDYQKALLYLCGGDD"
FT   CDS             complement(join(16625639..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664290))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_b"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290475.0
FT                   protein_id=hCP1879077.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Z7"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002389"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z7"
FT                   /protein_id="EAW77583.1"
FT   CDS             complement(join(16625639..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664290))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_b"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290472.0
FT                   protein_id=hCP1879076.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Z7"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002389"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z7"
FT                   /protein_id="EAW77584.1"
FT   CDS             complement(join(16625639..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664290))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_b"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290471.0
FT                   protein_id=hCP1879078.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Z7"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002389"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z7"
FT                   /protein_id="EAW77585.1"
FT   CDS             complement(join(16625639..16625698,16627085..16627207,
FT                   16629367..16629425,16629898..16629993,16630557..16630650,
FT                   16632328..16632387,16634094..16634173,16635321..16635411,
FT                   16639116..16639229,16642597..16642691,16660557..16660656,
FT                   16664243..16664290))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_b"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290469.0
FT                   protein_id=hCP1879074.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5Z7"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002389"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5Z7"
FT                   /protein_id="EAW77586.1"
FT   CDS             complement(join(16627180..16627196,16629357..16629425,
FT                   16629898..16629993,16630557..16630650,16632328..16632387,
FT                   16634094..16634173,16635321..16635411,16639116..16639229,
FT                   16642597..16642691,16660557..16660656,16664243..16664290))
FT                   /codon_start=1
FT                   /gene="ANXA2"
FT                   /locus_tag="hCG_2004404"
FT                   /product="annexin A2, isoform CRA_c"
FT                   /note="gene_id=hCG2004404.0 transcript_id=hCT2290473.0
FT                   protein_id=hCP1879079.0 isoform=CRA_c"
FT                   /protein_id="EAW77587.1"
FT                   AGEIRS"
FT   assembly_gap    16644336..16645752
FT                   /estimated_length=1417
FT                   /gap_type="unknown"
FT   assembly_gap    16682525..16682544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16683072..16683658
FT                   /pseudo
FT                   /locus_tag="hCG_33300"
FT                   /note="gene_id=hCG33300.3"
FT   mRNA            16683072..16683658
FT                   /pseudo
FT                   /locus_tag="hCG_33300"
FT                   /note="gene_id=hCG33300.3 transcript_id=hCT24495.4; overlap
FT                   evidence=yes; created on 28-JAN-2004"
FT   gene            complement(16699498..16757832)
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /note="gene_id=hCG2004402.1"
FT   mRNA            complement(join(16699498..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745400,16746748..16746849,16754751..16754855,
FT                   16756625..16756757,16757691..16757832))
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, transcript variant
FT                   hCT2290464"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290464.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 02-OCT-2003"
FT   mRNA            complement(join(16699498..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745400,16746748..16747009,16754751..16754855,
FT                   16756625..16756757,16757691..16757832))
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, transcript variant
FT                   hCT2290463"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290463.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 02-OCT-2003"
FT   mRNA            complement(join(16699498..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745400,16746748..16747009,16754751..16754855,
FT                   16756625..16756757,16757256..16757619))
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, transcript variant
FT                   hCT2290465"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290465.1;
FT                   splice donor-acceptor pairs covered / total pairs = 15/15;
FT                   created on 02-OCT-2003"
FT   CDS             complement(join(16702282..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745400,16746748..16747009,16754751..16754855,
FT                   16756625..16756665))
FT                   /codon_start=1
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, isoform CRA_b"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290465.1
FT                   protein_id=hCP1879070.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q659A1"
FT                   /db_xref="HGNC:HGNC:29885"
FT                   /db_xref="InterPro:IPR019535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q659A1"
FT                   /protein_id="EAW77589.1"
FT   CDS             complement(join(16702282..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745400,16746748..16747009,16754751..16754855,
FT                   16756625..16756665))
FT                   /codon_start=1
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, isoform CRA_b"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290463.1
FT                   protein_id=hCP1879071.1 isoform=CRA_b"
FT                   /db_xref="GOA:A0A024R5V9"
FT                   /db_xref="InterPro:IPR019535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024R5V9"
FT                   /protein_id="EAW77590.1"
FT   CDS             complement(join(16702282..16702410,16707105..16707363,
FT                   16710620..16710670,16714826..16714910,16721095..16721224,
FT                   16726649..16726824,16727527..16728520,16732282..16732463,
FT                   16733682..16733841,16734005..16734121,16735342..16735479,
FT                   16745281..16745397))
FT                   /codon_start=1
FT                   /gene="NARG2"
FT                   /locus_tag="hCG_2004402"
FT                   /product="NMDA receptor regulated 2, isoform CRA_a"
FT                   /note="gene_id=hCG2004402.1 transcript_id=hCT2290464.1
FT                   protein_id=hCP1879072.0 isoform=CRA_a"
FT                   /protein_id="EAW77588.1"
FT   gene            16757860..16826471
FT                   /locus_tag="hCG_2002746"
FT                   /note="gene_id=hCG2002746.0"
FT   mRNA            join(16757860..16758087,16767215..16767282,
FT                   16789043..16789168,16807165..16807312,16824774..16824975,
FT                   16826227..16826471)
FT                   /locus_tag="hCG_2002746"
FT                   /product="hCG2002746"
FT                   /note="gene_id=hCG2002746.0 transcript_id=hCT2287807.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   gene            complement(16772360..16774391)
FT                   /locus_tag="hCG_2045355"
FT                   /note="gene_id=hCG2045355.0"
FT   mRNA            complement(join(16772360..16772579,16774079..16774391))
FT                   /locus_tag="hCG_2045355"
FT                   /product="hCG2045355"
FT                   /note="gene_id=hCG2045355.0 transcript_id=hCT2360190.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 16-AUG-2004"
FT   CDS             complement(16774131..16774268)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2045355"
FT                   /product="hCG2045355"
FT                   /note="gene_id=hCG2045355.0 transcript_id=hCT2360190.0
FT                   protein_id=hCP1925411.0"
FT                   /protein_id="EAW77592.1"
FT                   "
FT   gene            complement(16775959..>16957157)
FT                   /gene="RORA"
FT                   /locus_tag="hCG_1787044"
FT                   /note="gene_id=hCG1787044.3"
FT   mRNA            complement(join(16775959..16776314,16778587..16778699,
FT                   16779654..16779764,16781395..16781502,16782170..16782302,
FT                   16784143..16784264,16789861..16790256,16793251..16793392,
FT                   16810351..16810436,16957128..>16957157))
FT                   /gene="RORA"
FT                   /locus_tag="hCG_1787044"
FT                   /product="RAR-related orphan receptor A, transcript variant
FT                   hCT1826099"
FT                   /note="gene_id=hCG1787044.3 transcript_id=hCT1826099.2;
FT                   splice donor-acceptor pairs covered / total pairs = 9/9;
FT                   created on 02-OCT-2003"
FT   mRNA            complement(join(16775959..16776314,16778587..16778699,
FT                   16779654..16779764,16781395..16781502,16782170..16782302,
FT                   16784143..16784264,16789861..16790256,16793251..16793392,
FT                   16810351..16810436,16835362..16835437,16836734..16836815,
FT                   16905729..16906030))
FT                   /gene="RORA"
FT                   /locus_tag="hCG_1787044"
FT                   /product="RAR-related orphan receptor A, transcript variant
FT                   hCT1958125"
FT                   /note="gene_id=hCG1787044.3 transcript_id=hCT1958125.2;
FT                   splice donor-acceptor pairs covered / total pairs = 11/11;
FT                   created on 02-OCT-2003"
FT   mRNA            complement(join(16775959..16776314,16778587..16778699,
FT                   16779654..16779764,16781395..16781502,16782170..16782302,
FT                   16784143..16784264,16789861..16790256,16793251..16793392,
FT                   16810351..16810436,16893390..16893523,16905729..16906030))
FT                   /gene="RORA"
FT                   /locus_tag="hCG_1787044"
FT                   /product="RAR-related orphan receptor A, transcript variant
FT                   hCT1826095"
FT                   /note="gene_id=hCG178