Dbfetch

ID   CH471081; SV 1; linear; genomic DNA; CON; HUM; 30372612 BP.
XX
AC   CH471081; AADB02000000;
XX
PR   Project:PRJNA1431;
XX
DT   30-JUL-2005 (Rel. 84, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens 211000035843014 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-30372612
RX   DOI; 10.1126/science.1058040.
RX   PUBMED; 11181995.
RA   Venter J.C., Adams M.D., Myers E.W., Li P.W., Mural R.J., Sutton G.G.,
RA   Smith H.O., Yandell M., Evans C.A., Holt R.A., Gocayne J.D., Amanatides P.,
RA   Ballew R.M., Huson D.H., Wortman J.R., Zhang Q., Kodira C.D., Zheng X.H.,
RA   Chen L., Skupski M., Subramanian G., Thomas P.D., Zhang J.,
RA   Gabor Miklos G.L., Nelson C., Broder S., Clark A.G., Nadeau J.,
RA   McKusick V.A., Zinder N., Levine A.J., Roberts R.J., Simon M., Slayman C.,
RA   Hunkapiller M., Bolanos R., Delcher A., Dew I., Fasulo D., Flanigan M.,
RA   Florea L., Halpern A., Hannenhalli S., Kravitz S., Levy S., Mobarry C.,
RA   Reinert K., Remington K., Abu-Threideh J., Beasley E., Biddick K.,
RA   Bonazzi V., Brandon R., Cargill M., Chandramouliswaran I., Charlab R.,
RA   Chaturvedi K., Deng Z., Di Francesco V., Dunn P., Eilbeck K.,
RA   Evangelista C., Gabrielian A.E., Gan W., Ge W., Gong F., Gu Z., Guan P.,
RA   Heiman T.J., Higgins M.E., Ji R.R., Ke Z., Ketchum K.A., Lai Z., Lei Y.,
RA   Li Z., Li J., Liang Y., Lin X., Lu F., Merkulov G.V., Milshina N.,
RA   Moore H.M., Naik A.K., Narayan V.A., Neelam B., Nusskern D., Rusch D.B.,
RA   Salzberg S., Shao W., Shue B., Sun J., Wang Z., Wang A., Wang X., Wang J.,
RA   Wei M., Wides R., Xiao C., Yan C., Yao A., Ye J., Zhan M., Zhang W.,
RA   Zhang H., Zhao Q., Zheng L., Zhong F., Zhong W., Zhu S., Zhao S.,
RA   Gilbert D., Baumhueter S., Spier G., Carter C., Cravchik A., Woodage T.,
RA   Ali F., An H., Awe A., Baldwin D., Baden H., Barnstead M., Barrow I.,
RA   Beeson K., Busam D., Carver A., Center A., Cheng M.L., Curry L.,
RA   Danaher S., Davenport L., Desilets R., Dietz S., Dodson K., Doup L.,
RA   Ferriera S., Garg N., Gluecksmann A., Hart B., Haynes J., Haynes C.,
RA   Heiner C., Hladun S., Hostin D., Houck J., Howland T., Ibegwam C.,
RA   Johnson J., Kalush F., Kline L., Koduru S., Love A., Mann F., May D.,
RA   McCawley S., McIntosh T., McMullen I., Moy M., Moy L., Murphy B.,
RA   Nelson K., Pfannkoch C., Pratts E., Puri V., Qureshi H., Reardon M.,
RA   Rodriguez R., Rogers Y.H., Romblad D., Ruhfel B., Scott R., Sitter C.,
RA   Smallwood M., Stewart E., Strong R., Suh E., Thomas R., Tint N.N., Tse S.,
RA   Vech C., Wang G., Wetter J., Williams S., Williams M., Windsor S.,
RA   Winn-Deen E., Wolfe K., Zaveri J., Zaveri K., Abril J.F., Guigo R.,
RA   Campbell M.J., Sjolander K.V., Karlak B., Kejariwal A., Mi H., Lazareva B.,
RA   Hatton T., Narechania A., Diemer K., Muruganujan A., Guo N., Sato S.,
RA   Bafna V., Istrail S., Lippert R., Schwartz R., Walenz B., Yooseph S.,
RA   Allen D., Basu A., Baxendale J., Blick L., Caminha M., Carnes-Stine J.,
RA   Caulk P., Chiang Y.H., Coyne M., Dahlke C., Mays A., Dombroski M.,
RA   Donnelly M., Ely D., Esparham S., Fosler C., Gire H., Glanowski S.,
RA   Glasser K., Glodek A., Gorokhov M., Graham K., Gropman B., Harris M.,
RA   Heil J., Henderson S., Hoover J., Jennings D., Jordan C., Jordan J.,
RA   Kasha J., Kagan L., Kraft C., Levitsky A., Lewis M., Liu X., Lopez J.,
RA   Ma D., Majoros W., McDaniel J., Murphy S., Newman M., Nguyen T., Nguyen N.,
RA   Nodell M., Pan S., Peck J., Peterson M., Rowe W., Sanders R., Scott J.,
RA   Simpson M., Smith T., Sprague A., Stockwell T., Turner R., Venter E.,
RA   Wang M., Wen M., Wu D., Wu M., Xia A., Zandieh A., Zhu X.;
RT   "The sequence of the human genome";
RL   Science, e1252229 291(5507):1304-1351(2001).
XX
RN   [2]
RP   1-30372612
RA   Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M.,
RA   Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
RA   Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
RA   Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
RA   Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
RA   Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
RA   Hunkapiller M.W., Myers E.W., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 9dc016306bea7adb65322fedb0ff51f9.
DR   ENA; AADB02000000; SET.
DR   ENA; AADB00000000; SET.
DR   ENA-CON; CM000257.
DR   BioSample; SAMN02981219.
DR   Ensembl-Gn; ENSG00000001084; homo_sapiens.
DR   Ensembl-Gn; ENSG00000001167; homo_sapiens.
DR   Ensembl-Gn; ENSG00000008197; homo_sapiens.
DR   Ensembl-Gn; ENSG00000010030; homo_sapiens.
DR   Ensembl-Gn; ENSG00000012660; homo_sapiens.
DR   Ensembl-Gn; ENSG00000030110; homo_sapiens.
DR   Ensembl-Gn; ENSG00000048544; homo_sapiens.
DR   Ensembl-Gn; ENSG00000048545; homo_sapiens.
DR   Ensembl-Gn; ENSG00000064999; homo_sapiens.
DR   Ensembl-Gn; ENSG00000065029; homo_sapiens.
DR   Ensembl-Gn; ENSG00000065060; homo_sapiens.
DR   Ensembl-Gn; ENSG00000065308; homo_sapiens.
DR   Ensembl-Gn; ENSG00000065491; homo_sapiens.
DR   Ensembl-Gn; ENSG00000066379; homo_sapiens.
DR   Ensembl-Gn; ENSG00000095981; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096060; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096063; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096070; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096080; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096092; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096093; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096150; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096155; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096171; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096395; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096433; homo_sapiens.
DR   Ensembl-Gn; ENSG00000096654; homo_sapiens.
DR   Ensembl-Gn; ENSG00000111971; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112033; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112039; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112053; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112062; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112077; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112078; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112079; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112081; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112115; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112118; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112130; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112139; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112144; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112175; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112210; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112461; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112462; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112473; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112474; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112511; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112559; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112561; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112576; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112624; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112640; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112655; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112658; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112659; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112667; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112759; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112782; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112796; homo_sapiens.
DR   Ensembl-Gn; ENSG00000112818; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124507; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124562; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124574; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124587; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124596; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124602; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124613; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124614; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124615; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124635; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124657; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124678; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124701; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124702; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124713; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124731; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124743; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124762; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124767; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124812; homo_sapiens.
DR   Ensembl-Gn; ENSG00000124818; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137166; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137168; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137171; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137185; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137193; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137204; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137221; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137251; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137288; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137310; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137312; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137313; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137331; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137332; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137337; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137343; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137345; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137392; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137394; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137404; homo_sapiens.
DR   Ensembl-Gn; ENSG00000137409; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146070; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146072; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146085; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146112; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146122; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146143; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146151; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146197; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146223; homo_sapiens.
DR   Ensembl-Gn; ENSG00000146232; homo_sapiens.
DR   Ensembl-Gn; ENSG00000151914; homo_sapiens.
DR   Ensembl-Gn; ENSG00000153291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000153292; homo_sapiens.
DR   Ensembl-Gn; ENSG00000153294; homo_sapiens.
DR   Ensembl-Gn; ENSG00000156564; homo_sapiens.
DR   Ensembl-Gn; ENSG00000156639; homo_sapiens.
DR   Ensembl-Gn; ENSG00000156711; homo_sapiens.
DR   Ensembl-Gn; ENSG00000158406; homo_sapiens.
DR   Ensembl-Gn; ENSG00000158691; homo_sapiens.
DR   Ensembl-Gn; ENSG00000161896; homo_sapiens.
DR   Ensembl-Gn; ENSG00000161904; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164626; homo_sapiens.
DR   Ensembl-Gn; ENSG00000164663; homo_sapiens.
DR   Ensembl-Gn; ENSG00000166278; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168131; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168143; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168394; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168452; homo_sapiens.
DR   Ensembl-Gn; ENSG00000168468; homo_sapiens.
DR   Ensembl-Gn; ENSG00000170734; homo_sapiens.
DR   Ensembl-Gn; ENSG00000170899; homo_sapiens.
DR   Ensembl-Gn; ENSG00000170927; homo_sapiens.
DR   Ensembl-Gn; ENSG00000171462; homo_sapiens.
DR   Ensembl-Gn; ENSG00000172348; homo_sapiens.
DR   Ensembl-Gn; ENSG00000172426; homo_sapiens.
DR   Ensembl-Gn; ENSG00000172432; homo_sapiens.
DR   Ensembl-Gn; ENSG00000172524; homo_sapiens.
DR   Ensembl-Gn; ENSG00000172850; homo_sapiens.
DR   Ensembl-Gn; ENSG00000174156; homo_sapiens.
DR   Ensembl-Gn; ENSG00000179165; homo_sapiens.
DR   Ensembl-Gn; ENSG00000180992; homo_sapiens.
DR   Ensembl-Gn; ENSG00000181577; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183311; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183574; homo_sapiens.
DR   Ensembl-Gn; ENSG00000183826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000184494; homo_sapiens.
DR   Ensembl-Gn; ENSG00000186577; homo_sapiens.
DR   Ensembl-Gn; ENSG00000187626; homo_sapiens.
DR   Ensembl-Gn; ENSG00000187987; homo_sapiens.
DR   Ensembl-Gn; ENSG00000189298; homo_sapiens.
DR   Ensembl-Gn; ENSG00000189325; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196230; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196260; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196284; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196747; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196787; homo_sapiens.
DR   Ensembl-Gn; ENSG00000196821; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197061; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197062; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197238; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197261; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197279; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197283; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197837; homo_sapiens.
DR   Ensembl-Gn; ENSG00000197903; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198087; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198315; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198457; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198563; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198663; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198755; homo_sapiens.
DR   Ensembl-Gn; ENSG00000198937; homo_sapiens.
DR   Ensembl-Gn; ENSG00000203623; homo_sapiens.
DR   Ensembl-Gn; ENSG00000203624; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204140; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204197; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204209; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204221; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204228; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204231; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204248; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204256; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204257; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204264; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204267; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204287; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204304; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204308; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204310; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204314; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204315; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204344; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204348; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204356; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204364; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204366; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204371; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204385; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204386; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204387; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204388; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204392; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204394; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204410; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204420; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204421; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204424; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204428; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204438; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204444; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204469; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204472; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204475; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204482; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204498; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204520; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204531; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204540; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204542; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204544; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204560; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204564; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204568; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204569; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204574; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204576; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204580; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204590; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204599; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204610; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204613; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204614; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204618; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204619; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204655; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204657; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204681; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204687; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204688; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204690; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204692; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204694; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204703; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204704; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204713; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206206; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206208; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206235; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206256; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206268; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206279; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206280; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206281; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206282; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206283; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206285; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206288; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206289; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206290; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206292; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206297; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206298; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206299; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206308; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206314; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206315; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206324; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206329; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206331; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206338; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206342; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206353; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206366; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206372; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206376; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206379; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206380; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206394; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206395; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206396; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206398; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206401; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206402; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206404; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206406; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206408; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206409; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206427; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206428; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206430; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206433; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206437; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206440; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206445; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206454; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206455; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206459; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206461; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206465; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206466; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206467; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206468; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206470; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206471; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206472; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206478; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206480; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206481; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206484; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206485; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206488; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206489; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206491; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206492; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206495; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206500; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206501; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206502; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206509; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206511; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206512; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206515; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206517; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206524; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206525; homo_sapiens.
DR   Ensembl-Gn; ENSG00000212866; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213588; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213654; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213676; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213719; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213722; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213760; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213780; homo_sapiens.
DR   Ensembl-Gn; ENSG00000213886; homo_sapiens.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000215077; homo_sapiens.
DR   Ensembl-Gn; ENSG00000215425; homo_sapiens.
DR   Ensembl-Gn; ENSG00000215522; homo_sapiens.
DR   Ensembl-Gn; ENSG00000215641; homo_sapiens.
DR   Ensembl-Gn; ENSG00000220550; homo_sapiens.
DR   Ensembl-Gn; ENSG00000221974; homo_sapiens.
DR   Ensembl-Gn; ENSG00000221988; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223367; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223448; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223465; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223481; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223501; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223639; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223666; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223752; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223766; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223767; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223775; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223833; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223887; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223898; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223932; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223957; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224105; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224120; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224156; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224200; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224212; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224264; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224290; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224313; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224319; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224393; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224395; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224398; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224399; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224455; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224472; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224496; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224501; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224544; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224552; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224586; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224587; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224708; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224774; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224782; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224841; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224859; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224941; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224979; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224994; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225060; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225073; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225141; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225164; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225211; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225312; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225452; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225454; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225543; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225553; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225589; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225590; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225635; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225682; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225736; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225748; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225859; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225967; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225987; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225989; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225993; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225998; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226033; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226060; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226111; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226171; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226173; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226182; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226187; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226201; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226248; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226257; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226260; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226264; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226404; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226417; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226437; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226467; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226531; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226560; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226589; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226603; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226614; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226618; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226634; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226651; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226710; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226832; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226850; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226882; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226916; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226936; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226979; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227044; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227046; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227122; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227129; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227137; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227147; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227171; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227231; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227246; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227277; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227314; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227315; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227317; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227322; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227333; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227402; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227420; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227460; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227472; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227507; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227565; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227567; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227587; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227600; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227639; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227720; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227739; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227761; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227780; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227801; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227804; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227816; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227993; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228001; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228090; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228116; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228128; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228163; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228177; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228186; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228250; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228263; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228333; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228377; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228405; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228425; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228515; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228575; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228581; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228582; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228605; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228628; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228652; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228691; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228712; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228736; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228760; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228854; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228859; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228867; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228875; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228881; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228883; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228892; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228896; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228907; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228913; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228977; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228987; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229006; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229058; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229061; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229071; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229077; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229094; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229125; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229185; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229202; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229253; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229300; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229328; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229363; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229381; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229408; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229432; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229470; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229488; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229496; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229524; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229684; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229698; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229802; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229861; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229929; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229998; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230034; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230060; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230072; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230128; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230141; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230143; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230230; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230279; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230293; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230308; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230332; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230336; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230341; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230456; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230467; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230475; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230514; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230624; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230669; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230700; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230705; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230726; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230780; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230791; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230885; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230900; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230907; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230930; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230961; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230995; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231002; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231003; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231044; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231094; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231116; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231129; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231135; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231225; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231257; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231268; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231314; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231319; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231325; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231370; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231377; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231408; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231479; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231488; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231500; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231502; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231543; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231555; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231558; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231617; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231618; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231624; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231631; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231641; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231737; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231825; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231852; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231925; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231968; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231974; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232005; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232040; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232045; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232127; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232143; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232169; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232180; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232280; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232289; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232312; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232326; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232367; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232414; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232421; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232569; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232575; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232616; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232641; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232804; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232839; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232957; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232960; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232962; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232984; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233046; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233049; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233051; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233054; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233076; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233141; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233149; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233151; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233164; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233180; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233314; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233348; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233418; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233450; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233481; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233561; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233564; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233599; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233641; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233687; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233734; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233795; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233801; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233813; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233822; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233890; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233911; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234000; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234012; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234046; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234058; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234078; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234096; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234127; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234154; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234196; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234243; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234343; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234347; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234370; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234443; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234475; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234495; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234507; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234508; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234514; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234530; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234539; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234549; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234605; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234623; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234651; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234668; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234674; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234704; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234728; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234729; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234794; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234798; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234809; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234836; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234846; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234852; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234920; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234947; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234954; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235017; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235022; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235025; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235030; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235067; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235068; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235109; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235125; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235132; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235134; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235155; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235176; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235222; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235259; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235302; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235307; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235336; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235360; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235443; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235452; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235588; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235650; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235658; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235676; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235692; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235696; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235708; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235712; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235744; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235754; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235758; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235769; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235773; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235844; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235863; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235915; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235925; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235941; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235956; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235960; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235966; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235985; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235986; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236011; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236014; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236063; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236104; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236149; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236177; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236183; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236196; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236210; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236222; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236237; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236250; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236315; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236342; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236353; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236443; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236515; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236560; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236561; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236649; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236697; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236759; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236765; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236802; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236808; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236843; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236873; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236895; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236902; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236925; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236949; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236967; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236979; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237012; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237046; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237051; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237052; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237056; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237071; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237100; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237112; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237155; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237192; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237258; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237284; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237335; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237344; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237405; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237441; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237459; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237482; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237495; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237508; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237582; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237649; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237703; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237724; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237727; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237733; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237808; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237814; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237825; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237829; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237834; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237900; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238056; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238104; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238114; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238134; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239285; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239329; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239457; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239497; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239741; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239754; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239836; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239927; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239974; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240008; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240053; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240065; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240118; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240433; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240508; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240592; homo_sapiens.
DR   Ensembl-Gn; ENSG00000240957; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241106; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241132; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241253; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241296; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241370; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241386; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241404; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241534; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241674; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241713; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241779; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241822; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241863; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241910; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242022; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242038; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242092; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242335; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242361; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242386; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242574; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242711; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242726; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243003; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243009; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243067; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243189; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243215; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243441; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243570; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243594; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243612; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243649; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243719; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243729; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243804; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243897; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243955; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243958; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244067; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244355; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244444; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244672; homo_sapiens.
DR   Ensembl-Gn; ENSG00000244694; homo_sapiens.
DR   Ensembl-Gn; ENSG00000254405; homo_sapiens.
DR   Ensembl-Gn; ENSG00000255152; homo_sapiens.
DR   Ensembl-Gn; ENSG00000255552; homo_sapiens.
DR   Ensembl-Gn; ENSG00000257770; homo_sapiens.
DR   Ensembl-Gn; ENSG00000266027; homo_sapiens.
DR   Ensembl-Gn; ENSG00000266442; homo_sapiens.
DR   Ensembl-Gn; ENSG00000270276; homo_sapiens.
DR   Ensembl-Gn; ENSG00000270882; homo_sapiens.
DR   Ensembl-Gn; ENSG00000272325; homo_sapiens.
DR   Ensembl-Gn; ENSG00000273542; homo_sapiens.
DR   Ensembl-Gn; ENSG00000274618; homo_sapiens.
DR   Ensembl-Gn; ENSG00000274997; homo_sapiens.
DR   Ensembl-Gn; ENSG00000275126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000275221; homo_sapiens.
DR   Ensembl-Gn; ENSG00000276180; homo_sapiens.
DR   Ensembl-Gn; ENSG00000276368; homo_sapiens.
DR   Ensembl-Gn; ENSG00000276903; homo_sapiens.
DR   Ensembl-Gn; ENSG00000276966; homo_sapiens.
DR   Ensembl-Gn; ENSG00000277157; homo_sapiens.
DR   Ensembl-Gn; ENSG00000278224; homo_sapiens.
DR   Ensembl-Gn; ENSG00000278637; homo_sapiens.
DR   Ensembl-Gn; ENSG00000278677; homo_sapiens.
DR   Ensembl-Gn; ENSG00000278705; homo_sapiens.
DR   Ensembl-Gn; ENSG00000280236; homo_sapiens.
DR   Ensembl-Gn; ENSG00000281185; homo_sapiens.
DR   Ensembl-Tr; ENST00000008391; homo_sapiens.
DR   Ensembl-Tr; ENST00000053468; homo_sapiens.
DR   Ensembl-Tr; ENST00000053469; homo_sapiens.
DR   Ensembl-Tr; ENST00000182527; homo_sapiens.
DR   Ensembl-Tr; ENST00000185206; homo_sapiens.
DR   Ensembl-Tr; ENST00000211122; homo_sapiens.
DR   Ensembl-Tr; ENST00000211287; homo_sapiens.
DR   Ensembl-Tr; ENST00000211314; homo_sapiens.
DR   Ensembl-Tr; ENST00000211372; homo_sapiens.
DR   Ensembl-Tr; ENST00000211377; homo_sapiens.
DR   Ensembl-Tr; ENST00000211379; homo_sapiens.
DR   Ensembl-Tr; ENST00000211402; homo_sapiens.
DR   Ensembl-Tr; ENST00000211413; homo_sapiens.
DR   Ensembl-Tr; ENST00000211936; homo_sapiens.
DR   Ensembl-Tr; ENST00000229416; homo_sapiens.
DR   Ensembl-Tr; ENST00000229725; homo_sapiens.
DR   Ensembl-Tr; ENST00000229729; homo_sapiens.
DR   Ensembl-Tr; ENST00000229769; homo_sapiens.
DR   Ensembl-Tr; ENST00000229794; homo_sapiens.
DR   Ensembl-Tr; ENST00000229795; homo_sapiens.
DR   Ensembl-Tr; ENST00000229812; homo_sapiens.
DR   Ensembl-Tr; ENST00000229829; homo_sapiens.
DR   Ensembl-Tr; ENST00000229854; homo_sapiens.
DR   Ensembl-Tr; ENST00000229866; homo_sapiens.
DR   Ensembl-Tr; ENST00000230223; homo_sapiens.
DR   Ensembl-Tr; ENST00000230236; homo_sapiens.
DR   Ensembl-Tr; ENST00000230321; homo_sapiens.
DR   Ensembl-Tr; ENST00000230323; homo_sapiens.
DR   Ensembl-Tr; ENST00000230418; homo_sapiens.
DR   Ensembl-Tr; ENST00000230419; homo_sapiens.
DR   Ensembl-Tr; ENST00000230431; homo_sapiens.
DR   Ensembl-Tr; ENST00000230565; homo_sapiens.
DR   Ensembl-Tr; ENST00000230588; homo_sapiens.
DR   Ensembl-Tr; ENST00000244360; homo_sapiens.
DR   Ensembl-Tr; ENST00000244458; homo_sapiens.
DR   Ensembl-Tr; ENST00000244520; homo_sapiens.
DR   Ensembl-Tr; ENST00000244537; homo_sapiens.
DR   Ensembl-Tr; ENST00000244546; homo_sapiens.
DR   Ensembl-Tr; ENST00000244565; homo_sapiens.
DR   Ensembl-Tr; ENST00000244576; homo_sapiens.
DR   Ensembl-Tr; ENST00000244623; homo_sapiens.
DR   Ensembl-Tr; ENST00000244645; homo_sapiens.
DR   Ensembl-Tr; ENST00000244669; homo_sapiens.
DR   Ensembl-Tr; ENST00000244709; homo_sapiens.
DR   Ensembl-Tr; ENST00000244741; homo_sapiens.
DR   Ensembl-Tr; ENST00000244751; homo_sapiens.
DR   Ensembl-Tr; ENST00000252050; homo_sapiens.
DR   Ensembl-Tr; ENST00000252207; homo_sapiens.
DR   Ensembl-Tr; ENST00000252211; homo_sapiens.
DR   Ensembl-Tr; ENST00000259708; homo_sapiens.
DR   Ensembl-Tr; ENST00000259748; homo_sapiens.
DR   Ensembl-Tr; ENST00000259751; homo_sapiens.
DR   Ensembl-Tr; ENST00000259782; homo_sapiens.
DR   Ensembl-Tr; ENST00000259870; homo_sapiens.
DR   Ensembl-Tr; ENST00000259873; homo_sapiens.
DR   Ensembl-Tr; ENST00000259875; homo_sapiens.
DR   Ensembl-Tr; ENST00000259881; homo_sapiens.
DR   Ensembl-Tr; ENST00000259891; homo_sapiens.
DR   Ensembl-Tr; ENST00000259895; homo_sapiens.
DR   Ensembl-Tr; ENST00000259915; homo_sapiens.
DR   Ensembl-Tr; ENST00000259930; homo_sapiens.
DR   Ensembl-Tr; ENST00000259938; homo_sapiens.
DR   Ensembl-Tr; ENST00000259941; homo_sapiens.
DR   Ensembl-Tr; ENST00000259951; homo_sapiens.
DR   Ensembl-Tr; ENST00000259953; homo_sapiens.
DR   Ensembl-Tr; ENST00000265354; homo_sapiens.
DR   Ensembl-Tr; ENST00000266000; homo_sapiens.
DR   Ensembl-Tr; ENST00000266003; homo_sapiens.
DR   Ensembl-Tr; ENST00000274793; homo_sapiens.
DR   Ensembl-Tr; ENST00000274813; homo_sapiens.
DR   Ensembl-Tr; ENST00000274853; homo_sapiens.
DR   Ensembl-Tr; ENST00000274867; homo_sapiens.
DR   Ensembl-Tr; ENST00000274891; homo_sapiens.
DR   Ensembl-Tr; ENST00000274901; homo_sapiens.
DR   Ensembl-Tr; ENST00000274938; homo_sapiens.
DR   Ensembl-Tr; ENST00000275015; homo_sapiens.
DR   Ensembl-Tr; ENST00000283303; homo_sapiens.
DR   Ensembl-Tr; ENST00000287218; homo_sapiens.
DR   Ensembl-Tr; ENST00000293709; homo_sapiens.
DR   Ensembl-Tr; ENST00000293756; homo_sapiens.
DR   Ensembl-Tr; ENST00000293760; homo_sapiens.
DR   Ensembl-Tr; ENST00000296861; homo_sapiens.
DR   Ensembl-Tr; ENST00000299367; homo_sapiens.
DR   Ensembl-Tr; ENST00000303324; homo_sapiens.
DR   Ensembl-Tr; ENST00000303757; homo_sapiens.
DR   Ensembl-Tr; ENST00000303892; homo_sapiens.
DR   Ensembl-Tr; ENST00000304434; homo_sapiens.
DR   Ensembl-Tr; ENST00000304611; homo_sapiens.
DR   Ensembl-Tr; ENST00000304734; homo_sapiens.
DR   Ensembl-Tr; ENST00000306764; homo_sapiens.
DR   Ensembl-Tr; ENST00000306858; homo_sapiens.
DR   Ensembl-Tr; ENST00000307126; homo_sapiens.
DR   Ensembl-Tr; ENST00000307859; homo_sapiens.
DR   Ensembl-Tr; ENST00000307972; homo_sapiens.
DR   Ensembl-Tr; ENST00000308161; homo_sapiens.
DR   Ensembl-Tr; ENST00000310795; homo_sapiens.
DR   Ensembl-Tr; ENST00000311565; homo_sapiens.
DR   Ensembl-Tr; ENST00000311875; homo_sapiens.
DR   Ensembl-Tr; ENST00000314073; homo_sapiens.
DR   Ensembl-Tr; ENST00000314100; homo_sapiens.
DR   Ensembl-Tr; ENST00000316606; homo_sapiens.
DR   Ensembl-Tr; ENST00000317483; homo_sapiens.
DR   Ensembl-Tr; ENST00000318999; homo_sapiens.
DR   Ensembl-Tr; ENST00000319027; homo_sapiens.
DR   Ensembl-Tr; ENST00000322203; homo_sapiens.
DR   Ensembl-Tr; ENST00000324540; homo_sapiens.
DR   Ensembl-Tr; ENST00000324771; homo_sapiens.
DR   Ensembl-Tr; ENST00000324816; homo_sapiens.
DR   Ensembl-Tr; ENST00000326199; homo_sapiens.
DR   Ensembl-Tr; ENST00000326974; homo_sapiens.
DR   Ensembl-Tr; ENST00000327357; homo_sapiens.
DR   Ensembl-Tr; ENST00000327753; homo_sapiens.
DR   Ensembl-Tr; ENST00000327800; homo_sapiens.
DR   Ensembl-Tr; ENST00000327892; homo_sapiens.
DR   Ensembl-Tr; ENST00000329992; homo_sapiens.
DR   Ensembl-Tr; ENST00000330083; homo_sapiens.
DR   Ensembl-Tr; ENST00000330236; homo_sapiens.
DR   Ensembl-Tr; ENST00000330430; homo_sapiens.
DR   Ensembl-Tr; ENST00000332435; homo_sapiens.
DR   Ensembl-Tr; ENST00000333151; homo_sapiens.
DR   Ensembl-Tr; ENST00000333845; homo_sapiens.
DR   Ensembl-Tr; ENST00000334575; homo_sapiens.
DR   Ensembl-Tr; ENST00000334668; homo_sapiens.
DR   Ensembl-Tr; ENST00000335847; homo_sapiens.
DR   Ensembl-Tr; ENST00000336600; homo_sapiens.
DR   Ensembl-Tr; ENST00000336984; homo_sapiens.
DR   Ensembl-Tr; ENST00000337400; homo_sapiens.
DR   Ensembl-Tr; ENST00000337523; homo_sapiens.
DR   Ensembl-Tr; ENST00000338305; homo_sapiens.
DR   Ensembl-Tr; ENST00000339139; homo_sapiens.
DR   Ensembl-Tr; ENST00000339411; homo_sapiens.
DR   Ensembl-Tr; ENST00000339488; homo_sapiens.
DR   Ensembl-Tr; ENST00000339530; homo_sapiens.
DR   Ensembl-Tr; ENST00000339561; homo_sapiens.
DR   Ensembl-Tr; ENST00000339717; homo_sapiens.
DR   Ensembl-Tr; ENST00000339796; homo_sapiens.
DR   Ensembl-Tr; ENST00000339812; homo_sapiens.
DR   Ensembl-Tr; ENST00000340027; homo_sapiens.
DR   Ensembl-Tr; ENST00000340057; homo_sapiens.
DR   Ensembl-Tr; ENST00000340181; homo_sapiens.
DR   Ensembl-Tr; ENST00000340994; homo_sapiens.
DR   Ensembl-Tr; ENST00000341464; homo_sapiens.
DR   Ensembl-Tr; ENST00000341947; homo_sapiens.
DR   Ensembl-Tr; ENST00000344279; homo_sapiens.
DR   Ensembl-Tr; ENST00000345201; homo_sapiens.
DR   Ensembl-Tr; ENST00000347162; homo_sapiens.
DR   Ensembl-Tr; ENST00000349241; homo_sapiens.
DR   Ensembl-Tr; ENST00000350082; homo_sapiens.
DR   Ensembl-Tr; ENST00000352931; homo_sapiens.
DR   Ensembl-Tr; ENST00000353205; homo_sapiens.
DR   Ensembl-Tr; ENST00000353801; homo_sapiens.
DR   Ensembl-Tr; ENST00000354038; homo_sapiens.
DR   Ensembl-Tr; ENST00000354258; homo_sapiens.
DR   Ensembl-Tr; ENST00000355057; homo_sapiens.
DR   Ensembl-Tr; ENST00000355190; homo_sapiens.
DR   Ensembl-Tr; ENST00000355574; homo_sapiens.
DR   Ensembl-Tr; ENST00000355973; homo_sapiens.
DR   Ensembl-Tr; ENST00000356950; homo_sapiens.
DR   Ensembl-Tr; ENST00000356971; homo_sapiens.
DR   Ensembl-Tr; ENST00000357266; homo_sapiens.
DR   Ensembl-Tr; ENST00000357338; homo_sapiens.
DR   Ensembl-Tr; ENST00000357641; homo_sapiens.
DR   Ensembl-Tr; ENST00000358064; homo_sapiens.
DR   Ensembl-Tr; ENST00000358739; homo_sapiens.
DR   Ensembl-Tr; ENST00000359076; homo_sapiens.
DR   Ensembl-Tr; ENST00000359086; homo_sapiens.
DR   Ensembl-Tr; ENST00000359193; homo_sapiens.
DR   Ensembl-Tr; ENST00000359314; homo_sapiens.
DR   Ensembl-Tr; ENST00000359359; homo_sapiens.
DR   Ensembl-Tr; ENST00000359374; homo_sapiens.
DR   Ensembl-Tr; ENST00000359534; homo_sapiens.
DR   Ensembl-Tr; ENST00000359539; homo_sapiens.
DR   Ensembl-Tr; ENST00000359611; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000360359; homo_sapiens.
DR   Ensembl-Tr; ENST00000360694; homo_sapiens.
DR   Ensembl-Tr; ENST00000361028; homo_sapiens.
DR   Ensembl-Tr; ENST00000361076; homo_sapiens.
DR   Ensembl-Tr; ENST00000361568; homo_sapiens.
DR   Ensembl-Tr; ENST00000361917; homo_sapiens.
DR   Ensembl-Tr; ENST00000362049; homo_sapiens.
DR   Ensembl-Tr; ENST00000366431; homo_sapiens.
DR   Ensembl-Tr; ENST00000366432; homo_sapiens.
DR   Ensembl-Tr; ENST00000370687; homo_sapiens.
DR   Ensembl-Tr; ENST00000370830; homo_sapiens.
DR   Ensembl-Tr; ENST00000370852; homo_sapiens.
DR   Ensembl-Tr; ENST00000370862; homo_sapiens.
DR   Ensembl-Tr; ENST00000370888; homo_sapiens.
DR   Ensembl-Tr; ENST00000370905; homo_sapiens.
DR   Ensembl-Tr; ENST00000370913; homo_sapiens.
DR   Ensembl-Tr; ENST00000370918; homo_sapiens.
DR   Ensembl-Tr; ENST00000370959; homo_sapiens.
DR   Ensembl-Tr; ENST00000370960; homo_sapiens.
DR   Ensembl-Tr; ENST00000370963; homo_sapiens.
DR   Ensembl-Tr; ENST00000370968; homo_sapiens.
DR   Ensembl-Tr; ENST00000371068; homo_sapiens.
DR   Ensembl-Tr; ENST00000371117; homo_sapiens.
DR   Ensembl-Tr; ENST00000371175; homo_sapiens.
DR   Ensembl-Tr; ENST00000371194; homo_sapiens.
DR   Ensembl-Tr; ENST00000371243; homo_sapiens.
DR   Ensembl-Tr; ENST00000371253; homo_sapiens.
DR   Ensembl-Tr; ENST00000371347; homo_sapiens.
DR   Ensembl-Tr; ENST00000371374; homo_sapiens.
DR   Ensembl-Tr; ENST00000371383; homo_sapiens.
DR   Ensembl-Tr; ENST00000371459; homo_sapiens.
DR   Ensembl-Tr; ENST00000371554; homo_sapiens.
DR   Ensembl-Tr; ENST00000371646; homo_sapiens.
DR   Ensembl-Tr; ENST00000371708; homo_sapiens.
DR   Ensembl-Tr; ENST00000371713; homo_sapiens.
DR   Ensembl-Tr; ENST00000371724; homo_sapiens.
DR   Ensembl-Tr; ENST00000371731; homo_sapiens.
DR   Ensembl-Tr; ENST00000371740; homo_sapiens.
DR   Ensembl-Tr; ENST00000371755; homo_sapiens.
DR   Ensembl-Tr; ENST00000372014; homo_sapiens.
DR   Ensembl-Tr; ENST00000372077; homo_sapiens.
DR   Ensembl-Tr; ENST00000372116; homo_sapiens.
DR   Ensembl-Tr; ENST00000372133; homo_sapiens.
DR   Ensembl-Tr; ENST00000372163; homo_sapiens.
DR   Ensembl-Tr; ENST00000372165; homo_sapiens.
DR   Ensembl-Tr; ENST00000372236; homo_sapiens.
DR   Ensembl-Tr; ENST00000372444; homo_sapiens.
DR   Ensembl-Tr; ENST00000372452; homo_sapiens.
DR   Ensembl-Tr; ENST00000372488; homo_sapiens.
DR   Ensembl-Tr; ENST00000372530; homo_sapiens.
DR   Ensembl-Tr; ENST00000372574; homo_sapiens.
DR   Ensembl-Tr; ENST00000372585; homo_sapiens.
DR   Ensembl-Tr; ENST00000372589; homo_sapiens.
DR   Ensembl-Tr; ENST00000372808; homo_sapiens.
DR   Ensembl-Tr; ENST00000372958; homo_sapiens.
DR   Ensembl-Tr; ENST00000372988; homo_sapiens.
DR   Ensembl-Tr; ENST00000372991; homo_sapiens.
DR   Ensembl-Tr; ENST00000373006; homo_sapiens.
DR   Ensembl-Tr; ENST00000373018; homo_sapiens.
DR   Ensembl-Tr; ENST00000373033; homo_sapiens.
DR   Ensembl-Tr; ENST00000373051; homo_sapiens.
DR   Ensembl-Tr; ENST00000373057; homo_sapiens.
DR   Ensembl-Tr; ENST00000373060; homo_sapiens.
DR   Ensembl-Tr; ENST00000373063; homo_sapiens.
DR   Ensembl-Tr; ENST00000373154; homo_sapiens.
DR   Ensembl-Tr; ENST00000373164; homo_sapiens.
DR   Ensembl-Tr; ENST00000373188; homo_sapiens.
DR   Ensembl-Tr; ENST00000373227; homo_sapiens.
DR   Ensembl-Tr; ENST00000373229; homo_sapiens.
DR   Ensembl-Tr; ENST00000373365; homo_sapiens.
DR   Ensembl-Tr; ENST00000373408; homo_sapiens.
DR   Ensembl-Tr; ENST00000373479; homo_sapiens.
DR   Ensembl-Tr; ENST00000373491; homo_sapiens.
DR   Ensembl-Tr; ENST00000373509; homo_sapiens.
DR   Ensembl-Tr; ENST00000373616; homo_sapiens.
DR   Ensembl-Tr; ENST00000373627; homo_sapiens.
DR   Ensembl-Tr; ENST00000373685; homo_sapiens.
DR   Ensembl-Tr; ENST00000373699; homo_sapiens.
DR   Ensembl-Tr; ENST00000373711; homo_sapiens.
DR   Ensembl-Tr; ENST00000373715; homo_sapiens.
DR   Ensembl-Tr; ENST00000373731; homo_sapiens.
DR   Ensembl-Tr; ENST00000373737; homo_sapiens.
DR   Ensembl-Tr; ENST00000373738; homo_sapiens.
DR   Ensembl-Tr; ENST00000373766; homo_sapiens.
DR   Ensembl-Tr; ENST00000373825; homo_sapiens.
DR   Ensembl-Tr; ENST00000373861; homo_sapiens.
DR   Ensembl-Tr; ENST00000373953; homo_sapiens.
DR   Ensembl-Tr; ENST00000373974; homo_sapiens.
DR   Ensembl-Tr; ENST00000373979; homo_sapiens.
DR   Ensembl-Tr; ENST00000374023; homo_sapiens.
DR   Ensembl-Tr; ENST00000374026; homo_sapiens.
DR   Ensembl-Tr; ENST00000374316; homo_sapiens.
DR   Ensembl-Tr; ENST00000374467; homo_sapiens.
DR   Ensembl-Tr; ENST00000374512; homo_sapiens.
DR   Ensembl-Tr; ENST00000374516; homo_sapiens.
DR   Ensembl-Tr; ENST00000374523; homo_sapiens.
DR   Ensembl-Tr; ENST00000374542; homo_sapiens.
DR   Ensembl-Tr; ENST00000374572; homo_sapiens.
DR   Ensembl-Tr; ENST00000374606; homo_sapiens.
DR   Ensembl-Tr; ENST00000374607; homo_sapiens.
DR   Ensembl-Tr; ENST00000374610; homo_sapiens.
DR   Ensembl-Tr; ENST00000374662; homo_sapiens.
DR   Ensembl-Tr; ENST00000374675; homo_sapiens.
DR   Ensembl-Tr; ENST00000374677; homo_sapiens.
DR   Ensembl-Tr; ENST00000374680; homo_sapiens.
DR   Ensembl-Tr; ENST00000374808; homo_sapiens.
DR   Ensembl-Tr; ENST00000374825; homo_sapiens.
DR   Ensembl-Tr; ENST00000374831; homo_sapiens.
DR   Ensembl-Tr; ENST00000374843; homo_sapiens.
DR   Ensembl-Tr; ENST00000374859; homo_sapiens.
DR   Ensembl-Tr; ENST00000374881; homo_sapiens.
DR   Ensembl-Tr; ENST00000374882; homo_sapiens.
DR   Ensembl-Tr; ENST00000374897; homo_sapiens.
DR   Ensembl-Tr; ENST00000374899; homo_sapiens.
DR   Ensembl-Tr; ENST00000375040; homo_sapiens.
DR   Ensembl-Tr; ENST00000375043; homo_sapiens.
DR   Ensembl-Tr; ENST00000375050; homo_sapiens.
DR   Ensembl-Tr; ENST00000375055; homo_sapiens.
DR   Ensembl-Tr; ENST00000375067; homo_sapiens.
DR   Ensembl-Tr; ENST00000375069; homo_sapiens.
DR   Ensembl-Tr; ENST00000375076; homo_sapiens.
DR   Ensembl-Tr; ENST00000375094; homo_sapiens.
DR   Ensembl-Tr; ENST00000375104; homo_sapiens.
DR   Ensembl-Tr; ENST00000375107; homo_sapiens.
DR   Ensembl-Tr; ENST00000375137; homo_sapiens.
DR   Ensembl-Tr; ENST00000375143; homo_sapiens.
DR   Ensembl-Tr; ENST00000375150; homo_sapiens.
DR   Ensembl-Tr; ENST00000375156; homo_sapiens.
DR   Ensembl-Tr; ENST00000375201; homo_sapiens.
DR   Ensembl-Tr; ENST00000375203; homo_sapiens.
DR   Ensembl-Tr; ENST00000375331; homo_sapiens.
DR   Ensembl-Tr; ENST00000375333; homo_sapiens.
DR   Ensembl-Tr; ENST00000375349; homo_sapiens.
DR   Ensembl-Tr; ENST00000375356; homo_sapiens.
DR   Ensembl-Tr; ENST00000375425; homo_sapiens.
DR   Ensembl-Tr; ENST00000375429; homo_sapiens.
DR   Ensembl-Tr; ENST00000375510; homo_sapiens.
DR   Ensembl-Tr; ENST00000375525; homo_sapiens.
DR   Ensembl-Tr; ENST00000375527; homo_sapiens.
DR   Ensembl-Tr; ENST00000375530; homo_sapiens.
DR   Ensembl-Tr; ENST00000375537; homo_sapiens.
DR   Ensembl-Tr; ENST00000375562; homo_sapiens.
DR   Ensembl-Tr; ENST00000375631; homo_sapiens.
DR   Ensembl-Tr; ENST00000375633; homo_sapiens.
DR   Ensembl-Tr; ENST00000375635; homo_sapiens.
DR   Ensembl-Tr; ENST00000375638; homo_sapiens.
DR   Ensembl-Tr; ENST00000375639; homo_sapiens.
DR   Ensembl-Tr; ENST00000375640; homo_sapiens.
DR   Ensembl-Tr; ENST00000375641; homo_sapiens.
DR   Ensembl-Tr; ENST00000375642; homo_sapiens.
DR   Ensembl-Tr; ENST00000375650; homo_sapiens.
DR   Ensembl-Tr; ENST00000375651; homo_sapiens.
DR   Ensembl-Tr; ENST00000375661; homo_sapiens.
DR   Ensembl-Tr; ENST00000375663; homo_sapiens.
DR   Ensembl-Tr; ENST00000375703; homo_sapiens.
DR   Ensembl-Tr; ENST00000375740; homo_sapiens.
DR   Ensembl-Tr; ENST00000375750; homo_sapiens.
DR   Ensembl-Tr; ENST00000375755; homo_sapiens.
DR   Ensembl-Tr; ENST00000375779; homo_sapiens.
DR   Ensembl-Tr; ENST00000375780; homo_sapiens.
DR   Ensembl-Tr; ENST00000375784; homo_sapiens.
DR   Ensembl-Tr; ENST00000375787; homo_sapiens.
DR   Ensembl-Tr; ENST00000375789; homo_sapiens.
DR   Ensembl-Tr; ENST00000375792; homo_sapiens.
DR   Ensembl-Tr; ENST00000375804; homo_sapiens.
DR   Ensembl-Tr; ENST00000375805; homo_sapiens.
DR   Ensembl-Tr; ENST00000375806; homo_sapiens.
DR   Ensembl-Tr; ENST00000375809; homo_sapiens.
DR   Ensembl-Tr; ENST00000375810; homo_sapiens.
DR   Ensembl-Tr; ENST00000375814; homo_sapiens.
DR   Ensembl-Tr; ENST00000375819; homo_sapiens.
DR   Ensembl-Tr; ENST00000375825; homo_sapiens.
DR   Ensembl-Tr; ENST00000375832; homo_sapiens.
DR   Ensembl-Tr; ENST00000375864; homo_sapiens.
DR   Ensembl-Tr; ENST00000375865; homo_sapiens.
DR   Ensembl-Tr; ENST00000375866; homo_sapiens.
DR   Ensembl-Tr; ENST00000375882; homo_sapiens.
DR   Ensembl-Tr; ENST00000375885; homo_sapiens.
DR   Ensembl-Tr; ENST00000375893; homo_sapiens.
DR   Ensembl-Tr; ENST00000375895; homo_sapiens.
DR   Ensembl-Tr; ENST00000375896; homo_sapiens.
DR   Ensembl-Tr; ENST00000375900; homo_sapiens.
DR   Ensembl-Tr; ENST00000375906; homo_sapiens.
DR   Ensembl-Tr; ENST00000375911; homo_sapiens.
DR   Ensembl-Tr; ENST00000375916; homo_sapiens.
DR   Ensembl-Tr; ENST00000375920; homo_sapiens.
DR   Ensembl-Tr; ENST00000375964; homo_sapiens.
DR   Ensembl-Tr; ENST00000375976; homo_sapiens.
DR   Ensembl-Tr; ENST00000376007; homo_sapiens.
DR   Ensembl-Tr; ENST00000376033; homo_sapiens.
DR   Ensembl-Tr; ENST00000376049; homo_sapiens.
DR   Ensembl-Tr; ENST00000376059; homo_sapiens.
DR   Ensembl-Tr; ENST00000376071; homo_sapiens.
DR   Ensembl-Tr; ENST00000376072; homo_sapiens.
DR   Ensembl-Tr; ENST00000376073; homo_sapiens.
DR   Ensembl-Tr; ENST00000376086; homo_sapiens.
DR   Ensembl-Tr; ENST00000376089; homo_sapiens.
DR   Ensembl-Tr; ENST00000376092; homo_sapiens.
DR   Ensembl-Tr; ENST00000376093; homo_sapiens.
DR   Ensembl-Tr; ENST00000376096; homo_sapiens.
DR   Ensembl-Tr; ENST00000376110; homo_sapiens.
DR   Ensembl-Tr; ENST00000376117; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000376148; homo_sapiens.
DR   Ensembl-Tr; ENST00000376151; homo_sapiens.
DR   Ensembl-Tr; ENST00000376243; homo_sapiens.
DR   Ensembl-Tr; ENST00000376255; homo_sapiens.
DR   Ensembl-Tr; ENST00000376257; homo_sapiens.
DR   Ensembl-Tr; ENST00000376296; homo_sapiens.
DR   Ensembl-Tr; ENST00000376316; homo_sapiens.
DR   Ensembl-Tr; ENST00000376326; homo_sapiens.
DR   Ensembl-Tr; ENST00000376377; homo_sapiens.
DR   Ensembl-Tr; ENST00000376389; homo_sapiens.
DR   Ensembl-Tr; ENST00000376406; homo_sapiens.
DR   Ensembl-Tr; ENST00000376420; homo_sapiens.
DR   Ensembl-Tr; ENST00000376421; homo_sapiens.
DR   Ensembl-Tr; ENST00000376437; homo_sapiens.
DR   Ensembl-Tr; ENST00000376442; homo_sapiens.
DR   Ensembl-Tr; ENST00000376473; homo_sapiens.
DR   Ensembl-Tr; ENST00000376483; homo_sapiens.
DR   Ensembl-Tr; ENST00000376485; homo_sapiens.
DR   Ensembl-Tr; ENST00000376511; homo_sapiens.
DR   Ensembl-Tr; ENST00000376545; homo_sapiens.
DR   Ensembl-Tr; ENST00000376560; homo_sapiens.
DR   Ensembl-Tr; ENST00000376567; homo_sapiens.
DR   Ensembl-Tr; ENST00000376568; homo_sapiens.
DR   Ensembl-Tr; ENST00000376569; homo_sapiens.
DR   Ensembl-Tr; ENST00000376570; homo_sapiens.
DR   Ensembl-Tr; ENST00000376575; homo_sapiens.
DR   Ensembl-Tr; ENST00000376621; homo_sapiens.
DR   Ensembl-Tr; ENST00000376642; homo_sapiens.
DR   Ensembl-Tr; ENST00000376656; homo_sapiens.
DR   Ensembl-Tr; ENST00000376659; homo_sapiens.
DR   Ensembl-Tr; ENST00000376694; homo_sapiens.
DR   Ensembl-Tr; ENST00000376704; homo_sapiens.
DR   Ensembl-Tr; ENST00000376724; homo_sapiens.
DR   Ensembl-Tr; ENST00000376750; homo_sapiens.
DR   Ensembl-Tr; ENST00000376751; homo_sapiens.
DR   Ensembl-Tr; ENST00000376772; homo_sapiens.
DR   Ensembl-Tr; ENST00000376782; homo_sapiens.
DR   Ensembl-Tr; ENST00000376785; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000376848; homo_sapiens.
DR   Ensembl-Tr; ENST00000376861; homo_sapiens.
DR   Ensembl-Tr; ENST00000376888; homo_sapiens.
DR   Ensembl-Tr; ENST00000376891; homo_sapiens.
DR   Ensembl-Tr; ENST00000376894; homo_sapiens.
DR   Ensembl-Tr; ENST00000376898; homo_sapiens.
DR   Ensembl-Tr; ENST00000376917; homo_sapiens.
DR   Ensembl-Tr; ENST00000376947; homo_sapiens.
DR   Ensembl-Tr; ENST00000376977; homo_sapiens.
DR   Ensembl-Tr; ENST00000377012; homo_sapiens.
DR   Ensembl-Tr; ENST00000377016; homo_sapiens.
DR   Ensembl-Tr; ENST00000377034; homo_sapiens.
DR   Ensembl-Tr; ENST00000377050; homo_sapiens.
DR   Ensembl-Tr; ENST00000377127; homo_sapiens.
DR   Ensembl-Tr; ENST00000377132; homo_sapiens.
DR   Ensembl-Tr; ENST00000377133; homo_sapiens.
DR   Ensembl-Tr; ENST00000377136; homo_sapiens.
DR   Ensembl-Tr; ENST00000377140; homo_sapiens.
DR   Ensembl-Tr; ENST00000377147; homo_sapiens.
DR   Ensembl-Tr; ENST00000377148; homo_sapiens.
DR   Ensembl-Tr; ENST00000377149; homo_sapiens.
DR   Ensembl-Tr; ENST00000377154; homo_sapiens.
DR   Ensembl-Tr; ENST00000377173; homo_sapiens.
DR   Ensembl-Tr; ENST00000377175; homo_sapiens.
DR   Ensembl-Tr; ENST00000377194; homo_sapiens.
DR   Ensembl-Tr; ENST00000377199; homo_sapiens.
DR   Ensembl-Tr; ENST00000377255; homo_sapiens.
DR   Ensembl-Tr; ENST00000377294; homo_sapiens.
DR   Ensembl-Tr; ENST00000377325; homo_sapiens.
DR   Ensembl-Tr; ENST00000377419; homo_sapiens.
DR   Ensembl-Tr; ENST00000377459; homo_sapiens.
DR   Ensembl-Tr; ENST00000377727; homo_sapiens.
DR   Ensembl-Tr; ENST00000377745; homo_sapiens.
DR   Ensembl-Tr; ENST00000377803; homo_sapiens.
DR   Ensembl-Tr; ENST00000383062; homo_sapiens.
DR   Ensembl-Tr; ENST00000383066; homo_sapiens.
DR   Ensembl-Tr; ENST00000383087; homo_sapiens.
DR   Ensembl-Tr; ENST00000383088; homo_sapiens.
DR   Ensembl-Tr; ENST00000383108; homo_sapiens.
DR   Ensembl-Tr; ENST00000383114; homo_sapiens.
DR   Ensembl-Tr; ENST00000383118; homo_sapiens.
DR   Ensembl-Tr; ENST00000383119; homo_sapiens.
DR   Ensembl-Tr; ENST00000383127; homo_sapiens.
DR   Ensembl-Tr; ENST00000383156; homo_sapiens.
DR   Ensembl-Tr; ENST00000383174; homo_sapiens.
DR   Ensembl-Tr; ENST00000383194; homo_sapiens.
DR   Ensembl-Tr; ENST00000383196; homo_sapiens.
DR   Ensembl-Tr; ENST00000383197; homo_sapiens.
DR   Ensembl-Tr; ENST00000383198; homo_sapiens.
DR   Ensembl-Tr; ENST00000383204; homo_sapiens.
DR   Ensembl-Tr; ENST00000383207; homo_sapiens.
DR   Ensembl-Tr; ENST00000383209; homo_sapiens.
DR   Ensembl-Tr; ENST00000383210; homo_sapiens.
DR   Ensembl-Tr; ENST00000383213; homo_sapiens.
DR   Ensembl-Tr; ENST00000383214; homo_sapiens.
DR   Ensembl-Tr; ENST00000383217; homo_sapiens.
DR   Ensembl-Tr; ENST00000383224; homo_sapiens.
DR   Ensembl-Tr; ENST00000383226; homo_sapiens.
DR   Ensembl-Tr; ENST00000383230; homo_sapiens.
DR   Ensembl-Tr; ENST00000383231; homo_sapiens.
DR   Ensembl-Tr; ENST00000383234; homo_sapiens.
DR   Ensembl-Tr; ENST00000383235; homo_sapiens.
DR   Ensembl-Tr; ENST00000383236; homo_sapiens.
DR   Ensembl-Tr; ENST00000383237; homo_sapiens.
DR   Ensembl-Tr; ENST00000383238; homo_sapiens.
DR   Ensembl-Tr; ENST00000383239; homo_sapiens.
DR   Ensembl-Tr; ENST00000383240; homo_sapiens.
DR   Ensembl-Tr; ENST00000383259; homo_sapiens.
DR   Ensembl-Tr; ENST00000383265; homo_sapiens.
DR   Ensembl-Tr; ENST00000383269; homo_sapiens.
DR   Ensembl-Tr; ENST00000383270; homo_sapiens.
DR   Ensembl-Tr; ENST00000383275; homo_sapiens.
DR   Ensembl-Tr; ENST00000383279; homo_sapiens.
DR   Ensembl-Tr; ENST00000383294; homo_sapiens.
DR   Ensembl-Tr; ENST00000383301; homo_sapiens.
DR   Ensembl-Tr; ENST00000383309; homo_sapiens.
DR   Ensembl-Tr; ENST00000383321; homo_sapiens.
DR   Ensembl-Tr; ENST00000383322; homo_sapiens.
DR   Ensembl-Tr; ENST00000383327; homo_sapiens.
DR   Ensembl-Tr; ENST00000383330; homo_sapiens.
DR   Ensembl-Tr; ENST00000383336; homo_sapiens.
DR   Ensembl-Tr; ENST00000383343; homo_sapiens.
DR   Ensembl-Tr; ENST00000383362; homo_sapiens.
DR   Ensembl-Tr; ENST00000383372; homo_sapiens.
DR   Ensembl-Tr; ENST00000383373; homo_sapiens.
DR   Ensembl-Tr; ENST00000383377; homo_sapiens.
DR   Ensembl-Tr; ENST00000383379; homo_sapiens.
DR   Ensembl-Tr; ENST00000383382; homo_sapiens.
DR   Ensembl-Tr; ENST00000383383; homo_sapiens.
DR   Ensembl-Tr; ENST00000383384; homo_sapiens.
DR   Ensembl-Tr; ENST00000383385; homo_sapiens.
DR   Ensembl-Tr; ENST00000383391; homo_sapiens.
DR   Ensembl-Tr; ENST00000383404; homo_sapiens.
DR   Ensembl-Tr; ENST00000383405; homo_sapiens.
DR   Ensembl-Tr; ENST00000383409; homo_sapiens.
DR   Ensembl-Tr; ENST00000383410; homo_sapiens.
DR   Ensembl-Tr; ENST00000383411; homo_sapiens.
DR   Ensembl-Tr; ENST00000383412; homo_sapiens.
DR   Ensembl-Tr; ENST00000383413; homo_sapiens.
DR   Ensembl-Tr; ENST00000383420; homo_sapiens.
DR   Ensembl-Tr; ENST00000383425; homo_sapiens.
DR   Ensembl-Tr; ENST00000383427; homo_sapiens.
DR   Ensembl-Tr; ENST00000383433; homo_sapiens.
DR   Ensembl-Tr; ENST00000383434; homo_sapiens.
DR   Ensembl-Tr; ENST00000383436; homo_sapiens.
DR   Ensembl-Tr; ENST00000383438; homo_sapiens.
DR   Ensembl-Tr; ENST00000383446; homo_sapiens.
DR   Ensembl-Tr; ENST00000383448; homo_sapiens.
DR   Ensembl-Tr; ENST00000383455; homo_sapiens.
DR   Ensembl-Tr; ENST00000383464; homo_sapiens.
DR   Ensembl-Tr; ENST00000383473; homo_sapiens.
DR   Ensembl-Tr; ENST00000383474; homo_sapiens.
DR   Ensembl-Tr; ENST00000383476; homo_sapiens.
DR   Ensembl-Tr; ENST00000383477; homo_sapiens.
DR   Ensembl-Tr; ENST00000383478; homo_sapiens.
DR   Ensembl-Tr; ENST00000383480; homo_sapiens.
DR   Ensembl-Tr; ENST00000383482; homo_sapiens.
DR   Ensembl-Tr; ENST00000383484; homo_sapiens.
DR   Ensembl-Tr; ENST00000383486; homo_sapiens.
DR   Ensembl-Tr; ENST00000383493; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000383500; homo_sapiens.
DR   Ensembl-Tr; ENST00000383503; homo_sapiens.
DR   Ensembl-Tr; ENST00000383508; homo_sapiens.
DR   Ensembl-Tr; ENST00000383515; homo_sapiens.
DR   Ensembl-Tr; ENST00000383521; homo_sapiens.
DR   Ensembl-Tr; ENST00000383524; homo_sapiens.
DR   Ensembl-Tr; ENST00000383525; homo_sapiens.
DR   Ensembl-Tr; ENST00000383526; homo_sapiens.
DR   Ensembl-Tr; ENST00000383530; homo_sapiens.
DR   Ensembl-Tr; ENST00000383532; homo_sapiens.
DR   Ensembl-Tr; ENST00000383537; homo_sapiens.
DR   Ensembl-Tr; ENST00000383539; homo_sapiens.
DR   Ensembl-Tr; ENST00000383541; homo_sapiens.
DR   Ensembl-Tr; ENST00000383542; homo_sapiens.
DR   Ensembl-Tr; ENST00000383543; homo_sapiens.
DR   Ensembl-Tr; ENST00000383546; homo_sapiens.
DR   Ensembl-Tr; ENST00000383547; homo_sapiens.
DR   Ensembl-Tr; ENST00000383549; homo_sapiens.
DR   Ensembl-Tr; ENST00000383550; homo_sapiens.
DR   Ensembl-Tr; ENST00000383551; homo_sapiens.
DR   Ensembl-Tr; ENST00000383556; homo_sapiens.
DR   Ensembl-Tr; ENST00000383560; homo_sapiens.
DR   Ensembl-Tr; ENST00000383562; homo_sapiens.
DR   Ensembl-Tr; ENST00000383564; homo_sapiens.
DR   Ensembl-Tr; ENST00000383566; homo_sapiens.
DR   Ensembl-Tr; ENST00000383570; homo_sapiens.
DR   Ensembl-Tr; ENST00000383571; homo_sapiens.
DR   Ensembl-Tr; ENST00000383573; homo_sapiens.
DR   Ensembl-Tr; ENST00000383581; homo_sapiens.
DR   Ensembl-Tr; ENST00000383582; homo_sapiens.
DR   Ensembl-Tr; ENST00000383583; homo_sapiens.
DR   Ensembl-Tr; ENST00000383584; homo_sapiens.
DR   Ensembl-Tr; ENST00000383585; homo_sapiens.
DR   Ensembl-Tr; ENST00000383586; homo_sapiens.
DR   Ensembl-Tr; ENST00000383587; homo_sapiens.
DR   Ensembl-Tr; ENST00000383592; homo_sapiens.
DR   Ensembl-Tr; ENST00000383596; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000383601; homo_sapiens.
DR   Ensembl-Tr; ENST00000383602; homo_sapiens.
DR   Ensembl-Tr; ENST00000383603; homo_sapiens.
DR   Ensembl-Tr; ENST00000383607; homo_sapiens.
DR   Ensembl-Tr; ENST00000383610; homo_sapiens.
DR   Ensembl-Tr; ENST00000383612; homo_sapiens.
DR   Ensembl-Tr; ENST00000383613; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000383630; homo_sapiens.
DR   Ensembl-Tr; ENST00000383631; homo_sapiens.
DR   Ensembl-Tr; ENST00000383636; homo_sapiens.
DR   Ensembl-Tr; ENST00000383637; homo_sapiens.
DR   Ensembl-Tr; ENST00000383638; homo_sapiens.
DR   Ensembl-Tr; ENST00000383639; homo_sapiens.
DR   Ensembl-Tr; ENST00000383640; homo_sapiens.
DR   Ensembl-Tr; ENST00000383643; homo_sapiens.
DR   Ensembl-Tr; ENST00000383644; homo_sapiens.
DR   Ensembl-Tr; ENST00000383645; homo_sapiens.
DR   Ensembl-Tr; ENST00000383653; homo_sapiens.
DR   Ensembl-Tr; ENST00000383654; homo_sapiens.
DR   Ensembl-Tr; ENST00000391548; homo_sapiens.
DR   Ensembl-Tr; ENST00000391555; homo_sapiens.
DR   Ensembl-Tr; ENST00000393189; homo_sapiens.
DR   Ensembl-Tr; ENST00000393699; homo_sapiens.
DR   Ensembl-Tr; ENST00000393841; homo_sapiens.
DR   Ensembl-Tr; ENST00000393844; homo_sapiens.
DR   Ensembl-Tr; ENST00000393987; homo_sapiens.
DR   Ensembl-Tr; ENST00000394056; homo_sapiens.
DR   Ensembl-Tr; ENST00000394110; homo_sapiens.
DR   Ensembl-Tr; ENST00000394168; homo_sapiens.
DR   Ensembl-Tr; ENST00000394237; homo_sapiens.
DR   Ensembl-Tr; ENST00000394253; homo_sapiens.
DR   Ensembl-Tr; ENST00000394259; homo_sapiens.
DR   Ensembl-Tr; ENST00000394260; homo_sapiens.
DR   Ensembl-Tr; ENST00000394263; homo_sapiens.
DR   Ensembl-Tr; ENST00000394602; homo_sapiens.
DR   Ensembl-Tr; ENST00000395064; homo_sapiens.
DR   Ensembl-Tr; ENST00000395114; homo_sapiens.
DR   Ensembl-Tr; ENST00000395131; homo_sapiens.
DR   Ensembl-Tr; ENST00000395194; homo_sapiens.
DR   Ensembl-Tr; ENST00000395287; homo_sapiens.
DR   Ensembl-Tr; ENST00000395312; homo_sapiens.
DR   Ensembl-Tr; ENST00000395330; homo_sapiens.
DR   Ensembl-Tr; ENST00000395388; homo_sapiens.
DR   Ensembl-Tr; ENST00000395496; homo_sapiens.
DR   Ensembl-Tr; ENST00000395497; homo_sapiens.
DR   Ensembl-Tr; ENST00000395499; homo_sapiens.
DR   Ensembl-Tr; ENST00000395512; homo_sapiens.
DR   Ensembl-Tr; ENST00000395523; homo_sapiens.
DR   Ensembl-Tr; ENST00000395788; homo_sapiens.
DR   Ensembl-Tr; ENST00000395789; homo_sapiens.
DR   Ensembl-Tr; ENST00000395892; homo_sapiens.
DR   Ensembl-Tr; ENST00000396172; homo_sapiens.
DR   Ensembl-Tr; ENST00000396547; homo_sapiens.
DR   Ensembl-Tr; ENST00000396548; homo_sapiens.
DR   Ensembl-Tr; ENST00000396551; homo_sapiens.
DR   Ensembl-Tr; ENST00000396558; homo_sapiens.
DR   Ensembl-Tr; ENST00000396581; homo_sapiens.
DR   Ensembl-Tr; ENST00000396701; homo_sapiens.
DR   Ensembl-Tr; ENST00000396704; homo_sapiens.
DR   Ensembl-Tr; ENST00000396792; homo_sapiens.
DR   Ensembl-Tr; ENST00000396806; homo_sapiens.
DR   Ensembl-Tr; ENST00000396827; homo_sapiens.
DR   Ensembl-Tr; ENST00000396838; homo_sapiens.
DR   Ensembl-Tr; ENST00000396980; homo_sapiens.
DR   Ensembl-Tr; ENST00000398661; homo_sapiens.
DR   Ensembl-Tr; ENST00000398776; homo_sapiens.
DR   Ensembl-Tr; ENST00000398904; homo_sapiens.
DR   Ensembl-Tr; ENST00000399060; homo_sapiens.
DR   Ensembl-Tr; ENST00000399199; homo_sapiens.
DR   Ensembl-Tr; ENST00000399344; homo_sapiens.
DR   Ensembl-Tr; ENST00000399371; homo_sapiens.
DR   Ensembl-Tr; ENST00000399383; homo_sapiens.
DR   Ensembl-Tr; ENST00000399385; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000399527; homo_sapiens.
DR   Ensembl-Tr; ENST00000399528; homo_sapiens.
DR   Ensembl-Tr; ENST00000399529; homo_sapiens.
DR   Ensembl-Tr; ENST00000399607; homo_sapiens.
DR   Ensembl-Tr; ENST00000399648; homo_sapiens.
DR   Ensembl-Tr; ENST00000399825; homo_sapiens.
DR   Ensembl-Tr; ENST00000399827; homo_sapiens.
DR   Ensembl-Tr; ENST00000399829; homo_sapiens.
DR   Ensembl-Tr; ENST00000399830; homo_sapiens.
DR   Ensembl-Tr; ENST00000399833; homo_sapiens.
DR   Ensembl-Tr; ENST00000399856; homo_sapiens.
DR   Ensembl-Tr; ENST00000399859; homo_sapiens.
DR   Ensembl-Tr; ENST00000399860; homo_sapiens.
DR   Ensembl-Tr; ENST00000399936; homo_sapiens.
DR   Ensembl-Tr; ENST00000399937; homo_sapiens.
DR   Ensembl-Tr; ENST00000399981; homo_sapiens.
DR   Ensembl-Tr; ENST00000400034; homo_sapiens.
DR   Ensembl-Tr; ENST00000400035; homo_sapiens.
DR   Ensembl-Tr; ENST00000400037; homo_sapiens.
DR   Ensembl-Tr; ENST00000400038; homo_sapiens.
DR   Ensembl-Tr; ENST00000400039; homo_sapiens.
DR   Ensembl-Tr; ENST00000400052; homo_sapiens.
DR   Ensembl-Tr; ENST00000400058; homo_sapiens.
DR   Ensembl-Tr; ENST00000400062; homo_sapiens.
DR   Ensembl-Tr; ENST00000400063; homo_sapiens.
DR   Ensembl-Tr; ENST00000400067; homo_sapiens.
DR   Ensembl-Tr; ENST00000400071; homo_sapiens.
DR   Ensembl-Tr; ENST00000400080; homo_sapiens.
DR   Ensembl-Tr; ENST00000400110; homo_sapiens.
DR   Ensembl-Tr; ENST00000400116; homo_sapiens.
DR   Ensembl-Tr; ENST00000400129; homo_sapiens.
DR   Ensembl-Tr; ENST00000400134; homo_sapiens.
DR   Ensembl-Tr; ENST00000400139; homo_sapiens.
DR   Ensembl-Tr; ENST00000400157; homo_sapiens.
DR   Ensembl-Tr; ENST00000400241; homo_sapiens.
DR   Ensembl-Tr; ENST00000400250; homo_sapiens.
DR   Ensembl-Tr; ENST00000400257; homo_sapiens.
DR   Ensembl-Tr; ENST00000400261; homo_sapiens.
DR   Ensembl-Tr; ENST00000400262; homo_sapiens.
DR   Ensembl-Tr; ENST00000400263; homo_sapiens.
DR   Ensembl-Tr; ENST00000400264; homo_sapiens.
DR   Ensembl-Tr; ENST00000400265; homo_sapiens.
DR   Ensembl-Tr; ENST00000400279; homo_sapiens.
DR   Ensembl-Tr; ENST00000400285; homo_sapiens.
DR   Ensembl-Tr; ENST00000400295; homo_sapiens.
DR   Ensembl-Tr; ENST00000400296; homo_sapiens.
DR   Ensembl-Tr; ENST00000400401; homo_sapiens.
DR   Ensembl-Tr; ENST00000400410; homo_sapiens.
DR   Ensembl-Tr; ENST00000400411; homo_sapiens.
DR   Ensembl-Tr; ENST00000400414; homo_sapiens.
DR   Ensembl-Tr; ENST00000400450; homo_sapiens.
DR   Ensembl-Tr; ENST00000400486; homo_sapiens.
DR   Ensembl-Tr; ENST00000400488; homo_sapiens.
DR   Ensembl-Tr; ENST00000400489; homo_sapiens.
DR   Ensembl-Tr; ENST00000400491; homo_sapiens.
DR   Ensembl-Tr; ENST00000400492; homo_sapiens.
DR   Ensembl-Tr; ENST00000400509; homo_sapiens.
DR   Ensembl-Tr; ENST00000400554; homo_sapiens.
DR   Ensembl-Tr; ENST00000400575; homo_sapiens.
DR   Ensembl-Tr; ENST00000400576; homo_sapiens.
DR   Ensembl-Tr; ENST00000400644; homo_sapiens.
DR   Ensembl-Tr; ENST00000400651; homo_sapiens.
DR   Ensembl-Tr; ENST00000400659; homo_sapiens.
DR   Ensembl-Tr; ENST00000400660; homo_sapiens.
DR   Ensembl-Tr; ENST00000400662; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400669; homo_sapiens.
DR   Ensembl-Tr; ENST00000400671; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000400688; homo_sapiens.
DR   Ensembl-Tr; ENST00000400689; homo_sapiens.
DR   Ensembl-Tr; ENST00000400691; homo_sapiens.
DR   Ensembl-Tr; ENST00000400693; homo_sapiens.
DR   Ensembl-Tr; ENST00000400694; homo_sapiens.
DR   Ensembl-Tr; ENST00000400696; homo_sapiens.
DR   Ensembl-Tr; ENST00000400698; homo_sapiens.
DR   Ensembl-Tr; ENST00000400712; homo_sapiens.
DR   Ensembl-Tr; ENST00000400713; homo_sapiens.
DR   Ensembl-Tr; ENST00000400714; homo_sapiens.
DR   Ensembl-Tr; ENST00000400715; homo_sapiens.
DR   Ensembl-Tr; ENST00000400720; homo_sapiens.
DR   Ensembl-Tr; ENST00000403298; homo_sapiens.
DR   Ensembl-Tr; ENST00000405375; homo_sapiens.
DR   Ensembl-Tr; ENST00000407079; homo_sapiens.
DR   Ensembl-Tr; ENST00000409525; homo_sapiens.
DR   Ensembl-Tr; ENST00000411447; homo_sapiens.
DR   Ensembl-Tr; ENST00000411456; homo_sapiens.
DR   Ensembl-Tr; ENST00000411490; homo_sapiens.
DR   Ensembl-Tr; ENST00000411524; homo_sapiens.
DR   Ensembl-Tr; ENST00000411574; homo_sapiens.
DR   Ensembl-Tr; ENST00000411608; homo_sapiens.
DR   Ensembl-Tr; ENST00000411689; homo_sapiens.
DR   Ensembl-Tr; ENST00000411724; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000411774; homo_sapiens.
DR   Ensembl-Tr; ENST00000411784; homo_sapiens.
DR   Ensembl-Tr; ENST00000411803; homo_sapiens.
DR   Ensembl-Tr; ENST00000411967; homo_sapiens.
DR   Ensembl-Tr; ENST00000412012; homo_sapiens.
DR   Ensembl-Tr; ENST00000412041; homo_sapiens.
DR   Ensembl-Tr; ENST00000412070; homo_sapiens.
DR   Ensembl-Tr; ENST00000412106; homo_sapiens.
DR   Ensembl-Tr; ENST00000412155; homo_sapiens.
DR   Ensembl-Tr; ENST00000412166; homo_sapiens.
DR   Ensembl-Tr; ENST00000412168; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000412289; homo_sapiens.
DR   Ensembl-Tr; ENST00000412329; homo_sapiens.
DR   Ensembl-Tr; ENST00000412330; homo_sapiens.
DR   Ensembl-Tr; ENST00000412396; homo_sapiens.
DR   Ensembl-Tr; ENST00000412443; homo_sapiens.
DR   Ensembl-Tr; ENST00000412451; homo_sapiens.
DR   Ensembl-Tr; ENST00000412470; homo_sapiens.
DR   Ensembl-Tr; ENST00000412603; homo_sapiens.
DR   Ensembl-Tr; ENST00000412623; homo_sapiens.
DR   Ensembl-Tr; ENST00000412651; homo_sapiens.
DR   Ensembl-Tr; ENST00000412687; homo_sapiens.
DR   Ensembl-Tr; ENST00000412706; homo_sapiens.
DR   Ensembl-Tr; ENST00000412760; homo_sapiens.
DR   Ensembl-Tr; ENST00000412802; homo_sapiens.
DR   Ensembl-Tr; ENST00000412823; homo_sapiens.
DR   Ensembl-Tr; ENST00000412851; homo_sapiens.
DR   Ensembl-Tr; ENST00000412948; homo_sapiens.
DR   Ensembl-Tr; ENST00000412956; homo_sapiens.
DR   Ensembl-Tr; ENST00000413055; homo_sapiens.
DR   Ensembl-Tr; ENST00000413113; homo_sapiens.
DR   Ensembl-Tr; ENST00000413136; homo_sapiens.
DR   Ensembl-Tr; ENST00000413314; homo_sapiens.
DR   Ensembl-Tr; ENST00000413349; homo_sapiens.
DR   Ensembl-Tr; ENST00000413426; homo_sapiens.
DR   Ensembl-Tr; ENST00000413532; homo_sapiens.
DR   Ensembl-Tr; ENST00000413548; homo_sapiens.
DR   Ensembl-Tr; ENST00000413638; homo_sapiens.
DR   Ensembl-Tr; ENST00000413655; homo_sapiens.
DR   Ensembl-Tr; ENST00000413678; homo_sapiens.
DR   Ensembl-Tr; ENST00000413715; homo_sapiens.
DR   Ensembl-Tr; ENST00000413733; homo_sapiens.
DR   Ensembl-Tr; ENST00000413786; homo_sapiens.
DR   Ensembl-Tr; ENST00000413853; homo_sapiens.
DR   Ensembl-Tr; ENST00000413922; homo_sapiens.
DR   Ensembl-Tr; ENST00000413924; homo_sapiens.
DR   Ensembl-Tr; ENST00000414015; homo_sapiens.
DR   Ensembl-Tr; ENST00000414052; homo_sapiens.
DR   Ensembl-Tr; ENST00000414083; homo_sapiens.
DR   Ensembl-Tr; ENST00000414092; homo_sapiens.
DR   Ensembl-Tr; ENST00000414111; homo_sapiens.
DR   Ensembl-Tr; ENST00000414145; homo_sapiens.
DR   Ensembl-Tr; ENST00000414149; homo_sapiens.
DR   Ensembl-Tr; ENST00000414187; homo_sapiens.
DR   Ensembl-Tr; ENST00000414200; homo_sapiens.
DR   Ensembl-Tr; ENST00000414266; homo_sapiens.
DR   Ensembl-Tr; ENST00000414356; homo_sapiens.
DR   Ensembl-Tr; ENST00000414391; homo_sapiens.
DR   Ensembl-Tr; ENST00000414415; homo_sapiens.
DR   Ensembl-Tr; ENST00000414429; homo_sapiens.
DR   Ensembl-Tr; ENST00000414434; homo_sapiens.
DR   Ensembl-Tr; ENST00000414440; homo_sapiens.
DR   Ensembl-Tr; ENST00000414455; homo_sapiens.
DR   Ensembl-Tr; ENST00000414463; homo_sapiens.
DR   Ensembl-Tr; ENST00000414467; homo_sapiens.
DR   Ensembl-Tr; ENST00000414520; homo_sapiens.
DR   Ensembl-Tr; ENST00000414528; homo_sapiens.
DR   Ensembl-Tr; ENST00000414536; homo_sapiens.
DR   Ensembl-Tr; ENST00000414687; homo_sapiens.
DR   Ensembl-Tr; ENST00000414696; homo_sapiens.
DR   Ensembl-Tr; ENST00000414698; homo_sapiens.
DR   Ensembl-Tr; ENST00000414731; homo_sapiens.
DR   Ensembl-Tr; ENST00000414839; homo_sapiens.
DR   Ensembl-Tr; ENST00000414873; homo_sapiens.
DR   Ensembl-Tr; ENST00000414889; homo_sapiens.
DR   Ensembl-Tr; ENST00000414933; homo_sapiens.
DR   Ensembl-Tr; ENST00000414934; homo_sapiens.
DR   Ensembl-Tr; ENST00000414956; homo_sapiens.
DR   Ensembl-Tr; ENST00000414980; homo_sapiens.
DR   Ensembl-Tr; ENST00000415092; homo_sapiens.
DR   Ensembl-Tr; ENST00000415123; homo_sapiens.
DR   Ensembl-Tr; ENST00000415157; homo_sapiens.
DR   Ensembl-Tr; ENST00000415173; homo_sapiens.
DR   Ensembl-Tr; ENST00000415179; homo_sapiens.
DR   Ensembl-Tr; ENST00000415247; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415322; homo_sapiens.
DR   Ensembl-Tr; ENST00000415345; homo_sapiens.
DR   Ensembl-Tr; ENST00000415373; homo_sapiens.
DR   Ensembl-Tr; ENST00000415419; homo_sapiens.
DR   Ensembl-Tr; ENST00000415490; homo_sapiens.
DR   Ensembl-Tr; ENST00000415497; homo_sapiens.
DR   Ensembl-Tr; ENST00000415517; homo_sapiens.
DR   Ensembl-Tr; ENST00000415525; homo_sapiens.
DR   Ensembl-Tr; ENST00000415546; homo_sapiens.
DR   Ensembl-Tr; ENST00000415581; homo_sapiens.
DR   Ensembl-Tr; ENST00000415583; homo_sapiens.
DR   Ensembl-Tr; ENST00000415631; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000415689; homo_sapiens.
DR   Ensembl-Tr; ENST00000415728; homo_sapiens.
DR   Ensembl-Tr; ENST00000415781; homo_sapiens.
DR   Ensembl-Tr; ENST00000415802; homo_sapiens.
DR   Ensembl-Tr; ENST00000415830; homo_sapiens.
DR   Ensembl-Tr; ENST00000415909; homo_sapiens.
DR   Ensembl-Tr; ENST00000415923; homo_sapiens.
DR   Ensembl-Tr; ENST00000415972; homo_sapiens.
DR   Ensembl-Tr; ENST00000415976; homo_sapiens.
DR   Ensembl-Tr; ENST00000415984; homo_sapiens.
DR   Ensembl-Tr; ENST00000416027; homo_sapiens.
DR   Ensembl-Tr; ENST00000416097; homo_sapiens.
DR   Ensembl-Tr; ENST00000416134; homo_sapiens.
DR   Ensembl-Tr; ENST00000416252; homo_sapiens.
DR   Ensembl-Tr; ENST00000416324; homo_sapiens.
DR   Ensembl-Tr; ENST00000416335; homo_sapiens.
DR   Ensembl-Tr; ENST00000416336; homo_sapiens.
DR   Ensembl-Tr; ENST00000416363; homo_sapiens.
DR   Ensembl-Tr; ENST00000416369; homo_sapiens.
DR   Ensembl-Tr; ENST00000416384; homo_sapiens.
DR   Ensembl-Tr; ENST00000416422; homo_sapiens.
DR   Ensembl-Tr; ENST00000416433; homo_sapiens.
DR   Ensembl-Tr; ENST00000416435; homo_sapiens.
DR   Ensembl-Tr; ENST00000416548; homo_sapiens.
DR   Ensembl-Tr; ENST00000416549; homo_sapiens.
DR   Ensembl-Tr; ENST00000416564; homo_sapiens.
DR   Ensembl-Tr; ENST00000416582; homo_sapiens.
DR   Ensembl-Tr; ENST00000416714; homo_sapiens.
DR   Ensembl-Tr; ENST00000416773; homo_sapiens.
DR   Ensembl-Tr; ENST00000416863; homo_sapiens.
DR   Ensembl-Tr; ENST00000416883; homo_sapiens.
DR   Ensembl-Tr; ENST00000416884; homo_sapiens.
DR   Ensembl-Tr; ENST00000416886; homo_sapiens.
DR   Ensembl-Tr; ENST00000416917; homo_sapiens.
DR   Ensembl-Tr; ENST00000416977; homo_sapiens.
DR   Ensembl-Tr; ENST00000417019; homo_sapiens.
DR   Ensembl-Tr; ENST00000417059; homo_sapiens.
DR   Ensembl-Tr; ENST00000417144; homo_sapiens.
DR   Ensembl-Tr; ENST00000417183; homo_sapiens.
DR   Ensembl-Tr; ENST00000417261; homo_sapiens.
DR   Ensembl-Tr; ENST00000417275; homo_sapiens.
DR   Ensembl-Tr; ENST00000417308; homo_sapiens.
DR   Ensembl-Tr; ENST00000417388; homo_sapiens.
DR   Ensembl-Tr; ENST00000417411; homo_sapiens.
DR   Ensembl-Tr; ENST00000417428; homo_sapiens.
DR   Ensembl-Tr; ENST00000417541; homo_sapiens.
DR   Ensembl-Tr; ENST00000417610; homo_sapiens.
DR   Ensembl-Tr; ENST00000417660; homo_sapiens.
DR   Ensembl-Tr; ENST00000417738; homo_sapiens.
DR   Ensembl-Tr; ENST00000417759; homo_sapiens.
DR   Ensembl-Tr; ENST00000417834; homo_sapiens.
DR   Ensembl-Tr; ENST00000417890; homo_sapiens.
DR   Ensembl-Tr; ENST00000417894; homo_sapiens.
DR   Ensembl-Tr; ENST00000418003; homo_sapiens.
DR   Ensembl-Tr; ENST00000418107; homo_sapiens.
DR   Ensembl-Tr; ENST00000418117; homo_sapiens.
DR   Ensembl-Tr; ENST00000418205; homo_sapiens.
DR   Ensembl-Tr; ENST00000418230; homo_sapiens.
DR   Ensembl-Tr; ENST00000418248; homo_sapiens.
DR   Ensembl-Tr; ENST00000418252; homo_sapiens.
DR   Ensembl-Tr; ENST00000418285; homo_sapiens.
DR   Ensembl-Tr; ENST00000418357; homo_sapiens.
DR   Ensembl-Tr; ENST00000418376; homo_sapiens.
DR   Ensembl-Tr; ENST00000418386; homo_sapiens.
DR   Ensembl-Tr; ENST00000418477; homo_sapiens.
DR   Ensembl-Tr; ENST00000418485; homo_sapiens.
DR   Ensembl-Tr; ENST00000418502; homo_sapiens.
DR   Ensembl-Tr; ENST00000418507; homo_sapiens.
DR   Ensembl-Tr; ENST00000418521; homo_sapiens.
DR   Ensembl-Tr; ENST00000418540; homo_sapiens.
DR   Ensembl-Tr; ENST00000418560; homo_sapiens.
DR   Ensembl-Tr; ENST00000418635; homo_sapiens.
DR   Ensembl-Tr; ENST00000418692; homo_sapiens.
DR   Ensembl-Tr; ENST00000418693; homo_sapiens.
DR   Ensembl-Tr; ENST00000418724; homo_sapiens.
DR   Ensembl-Tr; ENST00000418753; homo_sapiens.
DR   Ensembl-Tr; ENST00000418800; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000418936; homo_sapiens.
DR   Ensembl-Tr; ENST00000418967; homo_sapiens.
DR   Ensembl-Tr; ENST00000419000; homo_sapiens.
DR   Ensembl-Tr; ENST00000419086; homo_sapiens.
DR   Ensembl-Tr; ENST00000419095; homo_sapiens.
DR   Ensembl-Tr; ENST00000419122; homo_sapiens.
DR   Ensembl-Tr; ENST00000419269; homo_sapiens.
DR   Ensembl-Tr; ENST00000419274; homo_sapiens.
DR   Ensembl-Tr; ENST00000419277; homo_sapiens.
DR   Ensembl-Tr; ENST00000419309; homo_sapiens.
DR   Ensembl-Tr; ENST00000419321; homo_sapiens.
DR   Ensembl-Tr; ENST00000419376; homo_sapiens.
DR   Ensembl-Tr; ENST00000419389; homo_sapiens.
DR   Ensembl-Tr; ENST00000419411; homo_sapiens.
DR   Ensembl-Tr; ENST00000419412; homo_sapiens.
DR   Ensembl-Tr; ENST00000419471; homo_sapiens.
DR   Ensembl-Tr; ENST00000419623; homo_sapiens.
DR   Ensembl-Tr; ENST00000419655; homo_sapiens.
DR   Ensembl-Tr; ENST00000419674; homo_sapiens.
DR   Ensembl-Tr; ENST00000419706; homo_sapiens.
DR   Ensembl-Tr; ENST00000419728; homo_sapiens.
DR   Ensembl-Tr; ENST00000419767; homo_sapiens.
DR   Ensembl-Tr; ENST00000419773; homo_sapiens.
DR   Ensembl-Tr; ENST00000419790; homo_sapiens.
DR   Ensembl-Tr; ENST00000419792; homo_sapiens.
DR   Ensembl-Tr; ENST00000419797; homo_sapiens.
DR   Ensembl-Tr; ENST00000419847; homo_sapiens.
DR   Ensembl-Tr; ENST00000419873; homo_sapiens.
DR   Ensembl-Tr; ENST00000419920; homo_sapiens.
DR   Ensembl-Tr; ENST00000419939; homo_sapiens.
DR   Ensembl-Tr; ENST00000420019; homo_sapiens.
DR   Ensembl-Tr; ENST00000420035; homo_sapiens.
DR   Ensembl-Tr; ENST00000420041; homo_sapiens.
DR   Ensembl-Tr; ENST00000420045; homo_sapiens.
DR   Ensembl-Tr; ENST00000420067; homo_sapiens.
DR   Ensembl-Tr; ENST00000420100; homo_sapiens.
DR   Ensembl-Tr; ENST00000420157; homo_sapiens.
DR   Ensembl-Tr; ENST00000420178; homo_sapiens.
DR   Ensembl-Tr; ENST00000420182; homo_sapiens.
DR   Ensembl-Tr; ENST00000420214; homo_sapiens.
DR   Ensembl-Tr; ENST00000420257; homo_sapiens.
DR   Ensembl-Tr; ENST00000420320; homo_sapiens.
DR   Ensembl-Tr; ENST00000420333; homo_sapiens.
DR   Ensembl-Tr; ENST00000420336; homo_sapiens.
DR   Ensembl-Tr; ENST00000420378; homo_sapiens.
DR   Ensembl-Tr; ENST00000420402; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000420432; homo_sapiens.
DR   Ensembl-Tr; ENST00000420458; homo_sapiens.
DR   Ensembl-Tr; ENST00000420485; homo_sapiens.
DR   Ensembl-Tr; ENST00000420540; homo_sapiens.
DR   Ensembl-Tr; ENST00000420556; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000420586; homo_sapiens.
DR   Ensembl-Tr; ENST00000420676; homo_sapiens.
DR   Ensembl-Tr; ENST00000420731; homo_sapiens.
DR   Ensembl-Tr; ENST00000420778; homo_sapiens.
DR   Ensembl-Tr; ENST00000420785; homo_sapiens.
DR   Ensembl-Tr; ENST00000420797; homo_sapiens.
DR   Ensembl-Tr; ENST00000420874; homo_sapiens.
DR   Ensembl-Tr; ENST00000420949; homo_sapiens.
DR   Ensembl-Tr; ENST00000421027; homo_sapiens.
DR   Ensembl-Tr; ENST00000421039; homo_sapiens.
DR   Ensembl-Tr; ENST00000421042; homo_sapiens.
DR   Ensembl-Tr; ENST00000421095; homo_sapiens.
DR   Ensembl-Tr; ENST00000421125; homo_sapiens.
DR   Ensembl-Tr; ENST00000421229; homo_sapiens.
DR   Ensembl-Tr; ENST00000421268; homo_sapiens.
DR   Ensembl-Tr; ENST00000421396; homo_sapiens.
DR   Ensembl-Tr; ENST00000421445; homo_sapiens.
DR   Ensembl-Tr; ENST00000421473; homo_sapiens.
DR   Ensembl-Tr; ENST00000421519; homo_sapiens.
DR   Ensembl-Tr; ENST00000421553; homo_sapiens.
DR   Ensembl-Tr; ENST00000421596; homo_sapiens.
DR   Ensembl-Tr; ENST00000421605; homo_sapiens.
DR   Ensembl-Tr; ENST00000421634; homo_sapiens.
DR   Ensembl-Tr; ENST00000421766; homo_sapiens.
DR   Ensembl-Tr; ENST00000421781; homo_sapiens.
DR   Ensembl-Tr; ENST00000421789; homo_sapiens.
DR   Ensembl-Tr; ENST00000421808; homo_sapiens.
DR   Ensembl-Tr; ENST00000421859; homo_sapiens.
DR   Ensembl-Tr; ENST00000421926; homo_sapiens.
DR   Ensembl-Tr; ENST00000421981; homo_sapiens.
DR   Ensembl-Tr; ENST00000421984; homo_sapiens.
DR   Ensembl-Tr; ENST00000422012; homo_sapiens.
DR   Ensembl-Tr; ENST00000422035; homo_sapiens.
DR   Ensembl-Tr; ENST00000422131; homo_sapiens.
DR   Ensembl-Tr; ENST00000422167; homo_sapiens.
DR   Ensembl-Tr; ENST00000422181; homo_sapiens.
DR   Ensembl-Tr; ENST00000422261; homo_sapiens.
DR   Ensembl-Tr; ENST00000422316; homo_sapiens.
DR   Ensembl-Tr; ENST00000422349; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000422433; homo_sapiens.
DR   Ensembl-Tr; ENST00000422504; homo_sapiens.
DR   Ensembl-Tr; ENST00000422530; homo_sapiens.
DR   Ensembl-Tr; ENST00000422533; homo_sapiens.
DR   Ensembl-Tr; ENST00000422567; homo_sapiens.
DR   Ensembl-Tr; ENST00000422650; homo_sapiens.
DR   Ensembl-Tr; ENST00000422664; homo_sapiens.
DR   Ensembl-Tr; ENST00000422674; homo_sapiens.
DR   Ensembl-Tr; ENST00000422694; homo_sapiens.
DR   Ensembl-Tr; ENST00000422729; homo_sapiens.
DR   Ensembl-Tr; ENST00000422747; homo_sapiens.
DR   Ensembl-Tr; ENST00000422756; homo_sapiens.
DR   Ensembl-Tr; ENST00000422771; homo_sapiens.
DR   Ensembl-Tr; ENST00000422962; homo_sapiens.
DR   Ensembl-Tr; ENST00000422978; homo_sapiens.
DR   Ensembl-Tr; ENST00000422988; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423043; homo_sapiens.
DR   Ensembl-Tr; ENST00000423055; homo_sapiens.
DR   Ensembl-Tr; ENST00000423107; homo_sapiens.
DR   Ensembl-Tr; ENST00000423143; homo_sapiens.
DR   Ensembl-Tr; ENST00000423325; homo_sapiens.
DR   Ensembl-Tr; ENST00000423338; homo_sapiens.
DR   Ensembl-Tr; ENST00000423347; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000423382; homo_sapiens.
DR   Ensembl-Tr; ENST00000423604; homo_sapiens.
DR   Ensembl-Tr; ENST00000423640; homo_sapiens.
DR   Ensembl-Tr; ENST00000423654; homo_sapiens.
DR   Ensembl-Tr; ENST00000423671; homo_sapiens.
DR   Ensembl-Tr; ENST00000423804; homo_sapiens.
DR   Ensembl-Tr; ENST00000423871; homo_sapiens.
DR   Ensembl-Tr; ENST00000423881; homo_sapiens.
DR   Ensembl-Tr; ENST00000423895; homo_sapiens.
DR   Ensembl-Tr; ENST00000423916; homo_sapiens.
DR   Ensembl-Tr; ENST00000424030; homo_sapiens.
DR   Ensembl-Tr; ENST00000424104; homo_sapiens.
DR   Ensembl-Tr; ENST00000424121; homo_sapiens.
DR   Ensembl-Tr; ENST00000424266; homo_sapiens.
DR   Ensembl-Tr; ENST00000424353; homo_sapiens.
DR   Ensembl-Tr; ENST00000424446; homo_sapiens.
DR   Ensembl-Tr; ENST00000424502; homo_sapiens.
DR   Ensembl-Tr; ENST00000424520; homo_sapiens.
DR   Ensembl-Tr; ENST00000424575; homo_sapiens.
DR   Ensembl-Tr; ENST00000424616; homo_sapiens.
DR   Ensembl-Tr; ENST00000424652; homo_sapiens.
DR   Ensembl-Tr; ENST00000424672; homo_sapiens.
DR   Ensembl-Tr; ENST00000424727; homo_sapiens.
DR   Ensembl-Tr; ENST00000424790; homo_sapiens.
DR   Ensembl-Tr; ENST00000424822; homo_sapiens.
DR   Ensembl-Tr; ENST00000424897; homo_sapiens.
DR   Ensembl-Tr; ENST00000424944; homo_sapiens.
DR   Ensembl-Tr; ENST00000424962; homo_sapiens.
DR   Ensembl-Tr; ENST00000424975; homo_sapiens.
DR   Ensembl-Tr; ENST00000425054; homo_sapiens.
DR   Ensembl-Tr; ENST00000425097; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000425138; homo_sapiens.
DR   Ensembl-Tr; ENST00000425145; homo_sapiens.
DR   Ensembl-Tr; ENST00000425177; homo_sapiens.
DR   Ensembl-Tr; ENST00000425204; homo_sapiens.
DR   Ensembl-Tr; ENST00000425238; homo_sapiens.
DR   Ensembl-Tr; ENST00000425260; homo_sapiens.
DR   Ensembl-Tr; ENST00000425368; homo_sapiens.
DR   Ensembl-Tr; ENST00000425378; homo_sapiens.
DR   Ensembl-Tr; ENST00000425448; homo_sapiens.
DR   Ensembl-Tr; ENST00000425464; homo_sapiens.
DR   Ensembl-Tr; ENST00000425468; homo_sapiens.
DR   Ensembl-Tr; ENST00000425523; homo_sapiens.
DR   Ensembl-Tr; ENST00000425571; homo_sapiens.
DR   Ensembl-Tr; ENST00000425572; homo_sapiens.
DR   Ensembl-Tr; ENST00000425575; homo_sapiens.
DR   Ensembl-Tr; ENST00000425581; homo_sapiens.
DR   Ensembl-Tr; ENST00000425739; homo_sapiens.
DR   Ensembl-Tr; ENST00000425748; homo_sapiens.
DR   Ensembl-Tr; ENST00000425760; homo_sapiens.
DR   Ensembl-Tr; ENST00000425831; homo_sapiens.
DR   Ensembl-Tr; ENST00000425878; homo_sapiens.
DR   Ensembl-Tr; ENST00000425956; homo_sapiens.
DR   Ensembl-Tr; ENST00000425998; homo_sapiens.
DR   Ensembl-Tr; ENST00000426070; homo_sapiens.
DR   Ensembl-Tr; ENST00000426138; homo_sapiens.
DR   Ensembl-Tr; ENST00000426149; homo_sapiens.
DR   Ensembl-Tr; ENST00000426202; homo_sapiens.
DR   Ensembl-Tr; ENST00000426239; homo_sapiens.
DR   Ensembl-Tr; ENST00000426299; homo_sapiens.
DR   Ensembl-Tr; ENST00000426326; homo_sapiens.
DR   Ensembl-Tr; ENST00000426469; homo_sapiens.
DR   Ensembl-Tr; ENST00000426498; homo_sapiens.
DR   Ensembl-Tr; ENST00000426644; homo_sapiens.
DR   Ensembl-Tr; ENST00000426685; homo_sapiens.
DR   Ensembl-Tr; ENST00000426729; homo_sapiens.
DR   Ensembl-Tr; ENST00000426782; homo_sapiens.
DR   Ensembl-Tr; ENST00000426800; homo_sapiens.
DR   Ensembl-Tr; ENST00000426802; homo_sapiens.
DR   Ensembl-Tr; ENST00000426843; homo_sapiens.
DR   Ensembl-Tr; ENST00000426845; homo_sapiens.
DR   Ensembl-Tr; ENST00000426938; homo_sapiens.
DR   Ensembl-Tr; ENST00000426945; homo_sapiens.
DR   Ensembl-Tr; ENST00000426977; homo_sapiens.
DR   Ensembl-Tr; ENST00000426996; homo_sapiens.
DR   Ensembl-Tr; ENST00000427005; homo_sapiens.
DR   Ensembl-Tr; ENST00000427053; homo_sapiens.
DR   Ensembl-Tr; ENST00000427061; homo_sapiens.
DR   Ensembl-Tr; ENST00000427091; homo_sapiens.
DR   Ensembl-Tr; ENST00000427126; homo_sapiens.
DR   Ensembl-Tr; ENST00000427136; homo_sapiens.
DR   Ensembl-Tr; ENST00000427186; homo_sapiens.
DR   Ensembl-Tr; ENST00000427264; homo_sapiens.
DR   Ensembl-Tr; ENST00000427289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427295; homo_sapiens.
DR   Ensembl-Tr; ENST00000427406; homo_sapiens.
DR   Ensembl-Tr; ENST00000427477; homo_sapiens.
DR   Ensembl-Tr; ENST00000427507; homo_sapiens.
DR   Ensembl-Tr; ENST00000427527; homo_sapiens.
DR   Ensembl-Tr; ENST00000427535; homo_sapiens.
DR   Ensembl-Tr; ENST00000427556; homo_sapiens.
DR   Ensembl-Tr; ENST00000427627; homo_sapiens.
DR   Ensembl-Tr; ENST00000427689; homo_sapiens.
DR   Ensembl-Tr; ENST00000427690; homo_sapiens.
DR   Ensembl-Tr; ENST00000427729; homo_sapiens.
DR   Ensembl-Tr; ENST00000427735; homo_sapiens.
DR   Ensembl-Tr; ENST00000427763; homo_sapiens.
DR   Ensembl-Tr; ENST00000427822; homo_sapiens.
DR   Ensembl-Tr; ENST00000427851; homo_sapiens.
DR   Ensembl-Tr; ENST00000427869; homo_sapiens.
DR   Ensembl-Tr; ENST00000427870; homo_sapiens.
DR   Ensembl-Tr; ENST00000427888; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   Ensembl-Tr; ENST00000427944; homo_sapiens.
DR   Ensembl-Tr; ENST00000428040; homo_sapiens.
DR   Ensembl-Tr; ENST00000428121; homo_sapiens.
DR   Ensembl-Tr; ENST00000428144; homo_sapiens.
DR   Ensembl-Tr; ENST00000428189; homo_sapiens.
DR   Ensembl-Tr; ENST00000428227; homo_sapiens.
DR   Ensembl-Tr; ENST00000428302; homo_sapiens.
DR   Ensembl-Tr; ENST00000428405; homo_sapiens.
DR   Ensembl-Tr; ENST00000428420; homo_sapiens.
DR   Ensembl-Tr; ENST00000428467; homo_sapiens.
DR   Ensembl-Tr; ENST00000428483; homo_sapiens.
DR   Ensembl-Tr; ENST00000428486; homo_sapiens.
DR   Ensembl-Tr; ENST00000428498; homo_sapiens.
DR   Ensembl-Tr; ENST00000428608; homo_sapiens.
DR   Ensembl-Tr; ENST00000428611; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428719; homo_sapiens.
DR   Ensembl-Tr; ENST00000428764; homo_sapiens.
DR   Ensembl-Tr; ENST00000428775; homo_sapiens.
DR   Ensembl-Tr; ENST00000428842; homo_sapiens.
DR   Ensembl-Tr; ENST00000428849; homo_sapiens.
DR   Ensembl-Tr; ENST00000428898; homo_sapiens.
DR   Ensembl-Tr; ENST00000428913; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000428957; homo_sapiens.
DR   Ensembl-Tr; ENST00000429209; homo_sapiens.
DR   Ensembl-Tr; ENST00000429266; homo_sapiens.
DR   Ensembl-Tr; ENST00000429290; homo_sapiens.
DR   Ensembl-Tr; ENST00000429299; homo_sapiens.
DR   Ensembl-Tr; ENST00000429314; homo_sapiens.
DR   Ensembl-Tr; ENST00000429465; homo_sapiens.
DR   Ensembl-Tr; ENST00000429471; homo_sapiens.
DR   Ensembl-Tr; ENST00000429506; homo_sapiens.
DR   Ensembl-Tr; ENST00000429558; homo_sapiens.
DR   Ensembl-Tr; ENST00000429592; homo_sapiens.
DR   Ensembl-Tr; ENST00000429597; homo_sapiens.
DR   Ensembl-Tr; ENST00000429603; homo_sapiens.
DR   Ensembl-Tr; ENST00000429633; homo_sapiens.
DR   Ensembl-Tr; ENST00000429645; homo_sapiens.
DR   Ensembl-Tr; ENST00000429699; homo_sapiens.
DR   Ensembl-Tr; ENST00000429735; homo_sapiens.
DR   Ensembl-Tr; ENST00000429857; homo_sapiens.
DR   Ensembl-Tr; ENST00000429874; homo_sapiens.
DR   Ensembl-Tr; ENST00000429910; homo_sapiens.
DR   Ensembl-Tr; ENST00000430065; homo_sapiens.
DR   Ensembl-Tr; ENST00000430124; homo_sapiens.
DR   Ensembl-Tr; ENST00000430141; homo_sapiens.
DR   Ensembl-Tr; ENST00000430148; homo_sapiens.
DR   Ensembl-Tr; ENST00000430226; homo_sapiens.
DR   Ensembl-Tr; ENST00000430237; homo_sapiens.
DR   Ensembl-Tr; ENST00000430264; homo_sapiens.
DR   Ensembl-Tr; ENST00000430282; homo_sapiens.
DR   Ensembl-Tr; ENST00000430351; homo_sapiens.
DR   Ensembl-Tr; ENST00000430402; homo_sapiens.
DR   Ensembl-Tr; ENST00000430482; homo_sapiens.
DR   Ensembl-Tr; ENST00000430501; homo_sapiens.
DR   Ensembl-Tr; ENST00000430502; homo_sapiens.
DR   Ensembl-Tr; ENST00000430599; homo_sapiens.
DR   Ensembl-Tr; ENST00000430611; homo_sapiens.
DR   Ensembl-Tr; ENST00000430632; homo_sapiens.
DR   Ensembl-Tr; ENST00000430680; homo_sapiens.
DR   Ensembl-Tr; ENST00000430690; homo_sapiens.
DR   Ensembl-Tr; ENST00000430737; homo_sapiens.
DR   Ensembl-Tr; ENST00000430777; homo_sapiens.
DR   Ensembl-Tr; ENST00000430784; homo_sapiens.
DR   Ensembl-Tr; ENST00000430900; homo_sapiens.
DR   Ensembl-Tr; ENST00000430933; homo_sapiens.
DR   Ensembl-Tr; ENST00000430947; homo_sapiens.
DR   Ensembl-Tr; ENST00000430961; homo_sapiens.
DR   Ensembl-Tr; ENST00000430971; homo_sapiens.
DR   Ensembl-Tr; ENST00000430997; homo_sapiens.
DR   Ensembl-Tr; ENST00000431032; homo_sapiens.
DR   Ensembl-Tr; ENST00000431059; homo_sapiens.
DR   Ensembl-Tr; ENST00000431114; homo_sapiens.
DR   Ensembl-Tr; ENST00000431123; homo_sapiens.
DR   Ensembl-Tr; ENST00000431256; homo_sapiens.
DR   Ensembl-Tr; ENST00000431258; homo_sapiens.
DR   Ensembl-Tr; ENST00000431272; homo_sapiens.
DR   Ensembl-Tr; ENST00000431322; homo_sapiens.
DR   Ensembl-Tr; ENST00000431360; homo_sapiens.
DR   Ensembl-Tr; ENST00000431383; homo_sapiens.
DR   Ensembl-Tr; ENST00000431416; homo_sapiens.
DR   Ensembl-Tr; ENST00000431424; homo_sapiens.
DR   Ensembl-Tr; ENST00000431476; homo_sapiens.
DR   Ensembl-Tr; ENST00000431537; homo_sapiens.
DR   Ensembl-Tr; ENST00000431658; homo_sapiens.
DR   Ensembl-Tr; ENST00000431735; homo_sapiens.
DR   Ensembl-Tr; ENST00000431798; homo_sapiens.
DR   Ensembl-Tr; ENST00000431820; homo_sapiens.
DR   Ensembl-Tr; ENST00000431830; homo_sapiens.
DR   Ensembl-Tr; ENST00000431845; homo_sapiens.
DR   Ensembl-Tr; ENST00000431888; homo_sapiens.
DR   Ensembl-Tr; ENST00000431921; homo_sapiens.
DR   Ensembl-Tr; ENST00000431977; homo_sapiens.
DR   Ensembl-Tr; ENST00000432009; homo_sapiens.
DR   Ensembl-Tr; ENST00000432044; homo_sapiens.
DR   Ensembl-Tr; ENST00000432110; homo_sapiens.
DR   Ensembl-Tr; ENST00000432122; homo_sapiens.
DR   Ensembl-Tr; ENST00000432160; homo_sapiens.
DR   Ensembl-Tr; ENST00000432164; homo_sapiens.
DR   Ensembl-Tr; ENST00000432227; homo_sapiens.
DR   Ensembl-Tr; ENST00000432252; homo_sapiens.
DR   Ensembl-Tr; ENST00000432271; homo_sapiens.
DR   Ensembl-Tr; ENST00000432290; homo_sapiens.
DR   Ensembl-Tr; ENST00000432326; homo_sapiens.
DR   Ensembl-Tr; ENST00000432356; homo_sapiens.
DR   Ensembl-Tr; ENST00000432371; homo_sapiens.
DR   Ensembl-Tr; ENST00000432391; homo_sapiens.
DR   Ensembl-Tr; ENST00000432392; homo_sapiens.
DR   Ensembl-Tr; ENST00000432462; homo_sapiens.
DR   Ensembl-Tr; ENST00000432545; homo_sapiens.
DR   Ensembl-Tr; ENST00000432598; homo_sapiens.
DR   Ensembl-Tr; ENST00000432609; homo_sapiens.
DR   Ensembl-Tr; ENST00000432616; homo_sapiens.
DR   Ensembl-Tr; ENST00000432617; homo_sapiens.
DR   Ensembl-Tr; ENST00000432643; homo_sapiens.
DR   Ensembl-Tr; ENST00000432647; homo_sapiens.
DR   Ensembl-Tr; ENST00000432676; homo_sapiens.
DR   Ensembl-Tr; ENST00000432831; homo_sapiens.
DR   Ensembl-Tr; ENST00000432871; homo_sapiens.
DR   Ensembl-Tr; ENST00000432904; homo_sapiens.
DR   Ensembl-Tr; ENST00000432933; homo_sapiens.
DR   Ensembl-Tr; ENST00000433004; homo_sapiens.
DR   Ensembl-Tr; ENST00000433063; homo_sapiens.
DR   Ensembl-Tr; ENST00000433076; homo_sapiens.
DR   Ensembl-Tr; ENST00000433264; homo_sapiens.
DR   Ensembl-Tr; ENST00000433305; homo_sapiens.
DR   Ensembl-Tr; ENST00000433314; homo_sapiens.
DR   Ensembl-Tr; ENST00000433334; homo_sapiens.
DR   Ensembl-Tr; ENST00000433348; homo_sapiens.
DR   Ensembl-Tr; ENST00000433364; homo_sapiens.
DR   Ensembl-Tr; ENST00000433376; homo_sapiens.
DR   Ensembl-Tr; ENST00000433397; homo_sapiens.
DR   Ensembl-Tr; ENST00000433482; homo_sapiens.
DR   Ensembl-Tr; ENST00000433487; homo_sapiens.
DR   Ensembl-Tr; ENST00000433500; homo_sapiens.
DR   Ensembl-Tr; ENST00000433503; homo_sapiens.
DR   Ensembl-Tr; ENST00000433552; homo_sapiens.
DR   Ensembl-Tr; ENST00000433654; homo_sapiens.
DR   Ensembl-Tr; ENST00000433676; homo_sapiens.
DR   Ensembl-Tr; ENST00000433697; homo_sapiens.
DR   Ensembl-Tr; ENST00000433713; homo_sapiens.
DR   Ensembl-Tr; ENST00000433748; homo_sapiens.
DR   Ensembl-Tr; ENST00000433752; homo_sapiens.
DR   Ensembl-Tr; ENST00000433769; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000433857; homo_sapiens.
DR   Ensembl-Tr; ENST00000433880; homo_sapiens.
DR   Ensembl-Tr; ENST00000433896; homo_sapiens.
DR   Ensembl-Tr; ENST00000433900; homo_sapiens.
DR   Ensembl-Tr; ENST00000433916; homo_sapiens.
DR   Ensembl-Tr; ENST00000434026; homo_sapiens.
DR   Ensembl-Tr; ENST00000434122; homo_sapiens.
DR   Ensembl-Tr; ENST00000434125; homo_sapiens.
DR   Ensembl-Tr; ENST00000434151; homo_sapiens.
DR   Ensembl-Tr; ENST00000434177; homo_sapiens.
DR   Ensembl-Tr; ENST00000434202; homo_sapiens.
DR   Ensembl-Tr; ENST00000434217; homo_sapiens.
DR   Ensembl-Tr; ENST00000434226; homo_sapiens.
DR   Ensembl-Tr; ENST00000434282; homo_sapiens.
DR   Ensembl-Tr; ENST00000434314; homo_sapiens.
DR   Ensembl-Tr; ENST00000434332; homo_sapiens.
DR   Ensembl-Tr; ENST00000434335; homo_sapiens.
DR   Ensembl-Tr; ENST00000434337; homo_sapiens.
DR   Ensembl-Tr; ENST00000434407; homo_sapiens.
DR   Ensembl-Tr; ENST00000434446; homo_sapiens.
DR   Ensembl-Tr; ENST00000434464; homo_sapiens.
DR   Ensembl-Tr; ENST00000434471; homo_sapiens.
DR   Ensembl-Tr; ENST00000434496; homo_sapiens.
DR   Ensembl-Tr; ENST00000434515; homo_sapiens.
DR   Ensembl-Tr; ENST00000434614; homo_sapiens.
DR   Ensembl-Tr; ENST00000434616; homo_sapiens.
DR   Ensembl-Tr; ENST00000434618; homo_sapiens.
DR   Ensembl-Tr; ENST00000434660; homo_sapiens.
DR   Ensembl-Tr; ENST00000434837; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000434915; homo_sapiens.
DR   Ensembl-Tr; ENST00000435007; homo_sapiens.
DR   Ensembl-Tr; ENST00000435051; homo_sapiens.
DR   Ensembl-Tr; ENST00000435122; homo_sapiens.
DR   Ensembl-Tr; ENST00000435232; homo_sapiens.
DR   Ensembl-Tr; ENST00000435242; homo_sapiens.
DR   Ensembl-Tr; ENST00000435318; homo_sapiens.
DR   Ensembl-Tr; ENST00000435369; homo_sapiens.
DR   Ensembl-Tr; ENST00000435498; homo_sapiens.
DR   Ensembl-Tr; ENST00000435528; homo_sapiens.
DR   Ensembl-Tr; ENST00000435657; homo_sapiens.
DR   Ensembl-Tr; ENST00000435664; homo_sapiens.
DR   Ensembl-Tr; ENST00000435674; homo_sapiens.
DR   Ensembl-Tr; ENST00000435700; homo_sapiens.
DR   Ensembl-Tr; ENST00000435768; homo_sapiens.
DR   Ensembl-Tr; ENST00000435856; homo_sapiens.
DR   Ensembl-Tr; ENST00000435938; homo_sapiens.
DR   Ensembl-Tr; ENST00000435958; homo_sapiens.
DR   Ensembl-Tr; ENST00000435971; homo_sapiens.
DR   Ensembl-Tr; ENST00000435978; homo_sapiens.
DR   Ensembl-Tr; ENST00000436030; homo_sapiens.
DR   Ensembl-Tr; ENST00000436037; homo_sapiens.
DR   Ensembl-Tr; ENST00000436091; homo_sapiens.
DR   Ensembl-Tr; ENST00000436109; homo_sapiens.
DR   Ensembl-Tr; ENST00000436149; homo_sapiens.
DR   Ensembl-Tr; ENST00000436155; homo_sapiens.
DR   Ensembl-Tr; ENST00000436167; homo_sapiens.
DR   Ensembl-Tr; ENST00000436169; homo_sapiens.
DR   Ensembl-Tr; ENST00000436185; homo_sapiens.
DR   Ensembl-Tr; ENST00000436192; homo_sapiens.
DR   Ensembl-Tr; ENST00000436205; homo_sapiens.
DR   Ensembl-Tr; ENST00000436219; homo_sapiens.
DR   Ensembl-Tr; ENST00000436253; homo_sapiens.
DR   Ensembl-Tr; ENST00000436311; homo_sapiens.
DR   Ensembl-Tr; ENST00000436442; homo_sapiens.
DR   Ensembl-Tr; ENST00000436456; homo_sapiens.
DR   Ensembl-Tr; ENST00000436495; homo_sapiens.
DR   Ensembl-Tr; ENST00000436519; homo_sapiens.
DR   Ensembl-Tr; ENST00000436558; homo_sapiens.
DR   Ensembl-Tr; ENST00000436591; homo_sapiens.
DR   Ensembl-Tr; ENST00000436607; homo_sapiens.
DR   Ensembl-Tr; ENST00000436623; homo_sapiens.
DR   Ensembl-Tr; ENST00000436627; homo_sapiens.
DR   Ensembl-Tr; ENST00000436628; homo_sapiens.
DR   Ensembl-Tr; ENST00000436692; homo_sapiens.
DR   Ensembl-Tr; ENST00000436753; homo_sapiens.
DR   Ensembl-Tr; ENST00000436822; homo_sapiens.
DR   Ensembl-Tr; ENST00000436931; homo_sapiens.
DR   Ensembl-Tr; ENST00000436951; homo_sapiens.
DR   Ensembl-Tr; ENST00000436979; homo_sapiens.
DR   Ensembl-Tr; ENST00000436988; homo_sapiens.
DR   Ensembl-Tr; ENST00000437089; homo_sapiens.
DR   Ensembl-Tr; ENST00000437121; homo_sapiens.
DR   Ensembl-Tr; ENST00000437137; homo_sapiens.
DR   Ensembl-Tr; ENST00000437153; homo_sapiens.
DR   Ensembl-Tr; ENST00000437160; homo_sapiens.
DR   Ensembl-Tr; ENST00000437373; homo_sapiens.
DR   Ensembl-Tr; ENST00000437432; homo_sapiens.
DR   Ensembl-Tr; ENST00000437436; homo_sapiens.
DR   Ensembl-Tr; ENST00000437470; homo_sapiens.
DR   Ensembl-Tr; ENST00000437507; homo_sapiens.
DR   Ensembl-Tr; ENST00000437517; homo_sapiens.
DR   Ensembl-Tr; ENST00000437525; homo_sapiens.
DR   Ensembl-Tr; ENST00000437563; homo_sapiens.
DR   Ensembl-Tr; ENST00000437635; homo_sapiens.
DR   Ensembl-Tr; ENST00000437747; homo_sapiens.
DR   Ensembl-Tr; ENST00000437812; homo_sapiens.
DR   Ensembl-Tr; ENST00000437889; homo_sapiens.
DR   Ensembl-Tr; ENST00000437917; homo_sapiens.
DR   Ensembl-Tr; ENST00000437937; homo_sapiens.
DR   Ensembl-Tr; ENST00000438075; homo_sapiens.
DR   Ensembl-Tr; ENST00000438076; homo_sapiens.
DR   Ensembl-Tr; ENST00000438094; homo_sapiens.
DR   Ensembl-Tr; ENST00000438194; homo_sapiens.
DR   Ensembl-Tr; ENST00000438221; homo_sapiens.
DR   Ensembl-Tr; ENST00000438256; homo_sapiens.
DR   Ensembl-Tr; ENST00000438335; homo_sapiens.
DR   Ensembl-Tr; ENST00000438348; homo_sapiens.
DR   Ensembl-Tr; ENST00000438349; homo_sapiens.
DR   Ensembl-Tr; ENST00000438381; homo_sapiens.
DR   Ensembl-Tr; ENST00000438384; homo_sapiens.
DR   Ensembl-Tr; ENST00000438385; homo_sapiens.
DR   Ensembl-Tr; ENST00000438442; homo_sapiens.
DR   Ensembl-Tr; ENST00000438502; homo_sapiens.
DR   Ensembl-Tr; ENST00000438569; homo_sapiens.
DR   Ensembl-Tr; ENST00000438663; homo_sapiens.
DR   Ensembl-Tr; ENST00000438708; homo_sapiens.
DR   Ensembl-Tr; ENST00000438750; homo_sapiens.
DR   Ensembl-Tr; ENST00000438763; homo_sapiens.
DR   Ensembl-Tr; ENST00000438803; homo_sapiens.
DR   Ensembl-Tr; ENST00000438815; homo_sapiens.
DR   Ensembl-Tr; ENST00000438840; homo_sapiens.
DR   Ensembl-Tr; ENST00000438859; homo_sapiens.
DR   Ensembl-Tr; ENST00000438908; homo_sapiens.
DR   Ensembl-Tr; ENST00000438945; homo_sapiens.
DR   Ensembl-Tr; ENST00000438987; homo_sapiens.
DR   Ensembl-Tr; ENST00000439039; homo_sapiens.
DR   Ensembl-Tr; ENST00000439094; homo_sapiens.
DR   Ensembl-Tr; ENST00000439158; homo_sapiens.
DR   Ensembl-Tr; ENST00000439190; homo_sapiens.
DR   Ensembl-Tr; ENST00000439240; homo_sapiens.
DR   Ensembl-Tr; ENST00000439425; homo_sapiens.
DR   Ensembl-Tr; ENST00000439457; homo_sapiens.
DR   Ensembl-Tr; ENST00000439572; homo_sapiens.
DR   Ensembl-Tr; ENST00000439584; homo_sapiens.
DR   Ensembl-Tr; ENST00000439602; homo_sapiens.
DR   Ensembl-Tr; ENST00000439634; homo_sapiens.
DR   Ensembl-Tr; ENST00000439648; homo_sapiens.
DR   Ensembl-Tr; ENST00000439687; homo_sapiens.
DR   Ensembl-Tr; ENST00000439710; homo_sapiens.
DR   Ensembl-Tr; ENST00000439723; homo_sapiens.
DR   Ensembl-Tr; ENST00000439762; homo_sapiens.
DR   Ensembl-Tr; ENST00000439774; homo_sapiens.
DR   Ensembl-Tr; ENST00000439781; homo_sapiens.
DR   Ensembl-Tr; ENST00000439865; homo_sapiens.
DR   Ensembl-Tr; ENST00000439874; homo_sapiens.
DR   Ensembl-Tr; ENST00000439879; homo_sapiens.
DR   Ensembl-Tr; ENST00000439884; homo_sapiens.
DR   Ensembl-Tr; ENST00000439902; homo_sapiens.
DR   Ensembl-Tr; ENST00000439907; homo_sapiens.
DR   Ensembl-Tr; ENST00000439969; homo_sapiens.
DR   Ensembl-Tr; ENST00000439989; homo_sapiens.
DR   Ensembl-Tr; ENST00000440063; homo_sapiens.
DR   Ensembl-Tr; ENST00000440078; homo_sapiens.
DR   Ensembl-Tr; ENST00000440095; homo_sapiens.
DR   Ensembl-Tr; ENST00000440117; homo_sapiens.
DR   Ensembl-Tr; ENST00000440242; homo_sapiens.
DR   Ensembl-Tr; ENST00000440253; homo_sapiens.
DR   Ensembl-Tr; ENST00000440323; homo_sapiens.
DR   Ensembl-Tr; ENST00000440328; homo_sapiens.
DR   Ensembl-Tr; ENST00000440361; homo_sapiens.
DR   Ensembl-Tr; ENST00000440369; homo_sapiens.
DR   Ensembl-Tr; ENST00000440485; homo_sapiens.
DR   Ensembl-Tr; ENST00000440507; homo_sapiens.
DR   Ensembl-Tr; ENST00000440533; homo_sapiens.
DR   Ensembl-Tr; ENST00000440557; homo_sapiens.
DR   Ensembl-Tr; ENST00000440561; homo_sapiens.
DR   Ensembl-Tr; ENST00000440590; homo_sapiens.
DR   Ensembl-Tr; ENST00000440672; homo_sapiens.
DR   Ensembl-Tr; ENST00000440777; homo_sapiens.
DR   Ensembl-Tr; ENST00000440824; homo_sapiens.
DR   Ensembl-Tr; ENST00000440840; homo_sapiens.
DR   Ensembl-Tr; ENST00000440894; homo_sapiens.
DR   Ensembl-Tr; ENST00000440907; homo_sapiens.
DR   Ensembl-Tr; ENST00000440933; homo_sapiens.
DR   Ensembl-Tr; ENST00000441058; homo_sapiens.
DR   Ensembl-Tr; ENST00000441092; homo_sapiens.
DR   Ensembl-Tr; ENST00000441129; homo_sapiens.
DR   Ensembl-Tr; ENST00000441138; homo_sapiens.
DR   Ensembl-Tr; ENST00000441180; homo_sapiens.
DR   Ensembl-Tr; ENST00000441251; homo_sapiens.
DR   Ensembl-Tr; ENST00000441372; homo_sapiens.
DR   Ensembl-Tr; ENST00000441375; homo_sapiens.
DR   Ensembl-Tr; ENST00000441395; homo_sapiens.
DR   Ensembl-Tr; ENST00000441401; homo_sapiens.
DR   Ensembl-Tr; ENST00000441405; homo_sapiens.
DR   Ensembl-Tr; ENST00000441425; homo_sapiens.
DR   Ensembl-Tr; ENST00000441436; homo_sapiens.
DR   Ensembl-Tr; ENST00000441440; homo_sapiens.
DR   Ensembl-Tr; ENST00000441449; homo_sapiens.
DR   Ensembl-Tr; ENST00000441555; homo_sapiens.
DR   Ensembl-Tr; ENST00000441604; homo_sapiens.
DR   Ensembl-Tr; ENST00000441618; homo_sapiens.
DR   Ensembl-Tr; ENST00000441705; homo_sapiens.
DR   Ensembl-Tr; ENST00000441804; homo_sapiens.
DR   Ensembl-Tr; ENST00000441854; homo_sapiens.
DR   Ensembl-Tr; ENST00000441953; homo_sapiens.
DR   Ensembl-Tr; ENST00000441959; homo_sapiens.
DR   Ensembl-Tr; ENST00000441960; homo_sapiens.
DR   Ensembl-Tr; ENST00000442045; homo_sapiens.
DR   Ensembl-Tr; ENST00000442052; homo_sapiens.
DR   Ensembl-Tr; ENST00000442063; homo_sapiens.
DR   Ensembl-Tr; ENST00000442105; homo_sapiens.
DR   Ensembl-Tr; ENST00000442114; homo_sapiens.
DR   Ensembl-Tr; ENST00000442152; homo_sapiens.
DR   Ensembl-Tr; ENST00000442190; homo_sapiens.
DR   Ensembl-Tr; ENST00000442244; homo_sapiens.
DR   Ensembl-Tr; ENST00000442285; homo_sapiens.
DR   Ensembl-Tr; ENST00000442378; homo_sapiens.
DR   Ensembl-Tr; ENST00000442444; homo_sapiens.
DR   Ensembl-Tr; ENST00000442479; homo_sapiens.
DR   Ensembl-Tr; ENST00000442585; homo_sapiens.
DR   Ensembl-Tr; ENST00000442629; homo_sapiens.
DR   Ensembl-Tr; ENST00000442844; homo_sapiens.
DR   Ensembl-Tr; ENST00000442863; homo_sapiens.
DR   Ensembl-Tr; ENST00000442947; homo_sapiens.
DR   Ensembl-Tr; ENST00000442960; homo_sapiens.
DR   Ensembl-Tr; ENST00000442966; homo_sapiens.
DR   Ensembl-Tr; ENST00000442972; homo_sapiens.
DR   Ensembl-Tr; ENST00000442998; homo_sapiens.
DR   Ensembl-Tr; ENST00000443109; homo_sapiens.
DR   Ensembl-Tr; ENST00000443114; homo_sapiens.
DR   Ensembl-Tr; ENST00000443117; homo_sapiens.
DR   Ensembl-Tr; ENST00000443142; homo_sapiens.
DR   Ensembl-Tr; ENST00000443182; homo_sapiens.
DR   Ensembl-Tr; ENST00000443250; homo_sapiens.
DR   Ensembl-Tr; ENST00000443340; homo_sapiens.
DR   Ensembl-Tr; ENST00000443350; homo_sapiens.
DR   Ensembl-Tr; ENST00000443391; homo_sapiens.
DR   Ensembl-Tr; ENST00000443407; homo_sapiens.
DR   Ensembl-Tr; ENST00000443440; homo_sapiens.
DR   Ensembl-Tr; ENST00000443494; homo_sapiens.
DR   Ensembl-Tr; ENST00000443511; homo_sapiens.
DR   Ensembl-Tr; ENST00000443517; homo_sapiens.
DR   Ensembl-Tr; ENST00000443533; homo_sapiens.
DR   Ensembl-Tr; ENST00000443544; homo_sapiens.
DR   Ensembl-Tr; ENST00000443655; homo_sapiens.
DR   Ensembl-Tr; ENST00000443657; homo_sapiens.
DR   Ensembl-Tr; ENST00000443673; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000443713; homo_sapiens.
DR   Ensembl-Tr; ENST00000443741; homo_sapiens.
DR   Ensembl-Tr; ENST00000443773; homo_sapiens.
DR   Ensembl-Tr; ENST00000443860; homo_sapiens.
DR   Ensembl-Tr; ENST00000443974; homo_sapiens.
DR   Ensembl-Tr; ENST00000443975; homo_sapiens.
DR   Ensembl-Tr; ENST00000444009; homo_sapiens.
DR   Ensembl-Tr; ENST00000444027; homo_sapiens.
DR   Ensembl-Tr; ENST00000444088; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000444147; homo_sapiens.
DR   Ensembl-Tr; ENST00000444192; homo_sapiens.
DR   Ensembl-Tr; ENST00000444206; homo_sapiens.
DR   Ensembl-Tr; ENST00000444284; homo_sapiens.
DR   Ensembl-Tr; ENST00000444331; homo_sapiens.
DR   Ensembl-Tr; ENST00000444369; homo_sapiens.
DR   Ensembl-Tr; ENST00000444404; homo_sapiens.
DR   Ensembl-Tr; ENST00000444466; homo_sapiens.
DR   Ensembl-Tr; ENST00000444479; homo_sapiens.
DR   Ensembl-Tr; ENST00000444632; homo_sapiens.
DR   Ensembl-Tr; ENST00000444674; homo_sapiens.
DR   Ensembl-Tr; ENST00000444699; homo_sapiens.
DR   Ensembl-Tr; ENST00000444780; homo_sapiens.
DR   Ensembl-Tr; ENST00000444794; homo_sapiens.
DR   Ensembl-Tr; ENST00000444811; homo_sapiens.
DR   Ensembl-Tr; ENST00000444818; homo_sapiens.
DR   Ensembl-Tr; ENST00000444830; homo_sapiens.
DR   Ensembl-Tr; ENST00000444880; homo_sapiens.
DR   Ensembl-Tr; ENST00000444884; homo_sapiens.
DR   Ensembl-Tr; ENST00000444920; homo_sapiens.
DR   Ensembl-Tr; ENST00000444952; homo_sapiens.
DR   Ensembl-Tr; ENST00000444974; homo_sapiens.
DR   Ensembl-Tr; ENST00000445009; homo_sapiens.
DR   Ensembl-Tr; ENST00000445058; homo_sapiens.
DR   Ensembl-Tr; ENST00000445122; homo_sapiens.
DR   Ensembl-Tr; ENST00000445206; homo_sapiens.
DR   Ensembl-Tr; ENST00000445218; homo_sapiens.
DR   Ensembl-Tr; ENST00000445259; homo_sapiens.
DR   Ensembl-Tr; ENST00000445320; homo_sapiens.
DR   Ensembl-Tr; ENST00000445326; homo_sapiens.
DR   Ensembl-Tr; ENST00000445379; homo_sapiens.
DR   Ensembl-Tr; ENST00000445381; homo_sapiens.
DR   Ensembl-Tr; ENST00000445462; homo_sapiens.
DR   Ensembl-Tr; ENST00000445486; homo_sapiens.
DR   Ensembl-Tr; ENST00000445559; homo_sapiens.
DR   Ensembl-Tr; ENST00000445736; homo_sapiens.
DR   Ensembl-Tr; ENST00000445885; homo_sapiens.
DR   Ensembl-Tr; ENST00000445902; homo_sapiens.
DR   Ensembl-Tr; ENST00000445973; homo_sapiens.
DR   Ensembl-Tr; ENST00000446013; homo_sapiens.
DR   Ensembl-Tr; ENST00000446038; homo_sapiens.
DR   Ensembl-Tr; ENST00000446042; homo_sapiens.
DR   Ensembl-Tr; ENST00000446062; homo_sapiens.
DR   Ensembl-Tr; ENST00000446100; homo_sapiens.
DR   Ensembl-Tr; ENST00000446161; homo_sapiens.
DR   Ensembl-Tr; ENST00000446239; homo_sapiens.
DR   Ensembl-Tr; ENST00000446323; homo_sapiens.
DR   Ensembl-Tr; ENST00000446397; homo_sapiens.
DR   Ensembl-Tr; ENST00000446436; homo_sapiens.
DR   Ensembl-Tr; ENST00000446463; homo_sapiens.
DR   Ensembl-Tr; ENST00000446474; homo_sapiens.
DR   Ensembl-Tr; ENST00000446493; homo_sapiens.
DR   Ensembl-Tr; ENST00000446599; homo_sapiens.
DR   Ensembl-Tr; ENST00000446745; homo_sapiens.
DR   Ensembl-Tr; ENST00000446756; homo_sapiens.
DR   Ensembl-Tr; ENST00000446761; homo_sapiens.
DR   Ensembl-Tr; ENST00000446776; homo_sapiens.
DR   Ensembl-Tr; ENST00000446967; homo_sapiens.
DR   Ensembl-Tr; ENST00000447101; homo_sapiens.
DR   Ensembl-Tr; ENST00000447141; homo_sapiens.
DR   Ensembl-Tr; ENST00000447174; homo_sapiens.
DR   Ensembl-Tr; ENST00000447178; homo_sapiens.
DR   Ensembl-Tr; ENST00000447248; homo_sapiens.
DR   Ensembl-Tr; ENST00000447285; homo_sapiens.
DR   Ensembl-Tr; ENST00000447331; homo_sapiens.
DR   Ensembl-Tr; ENST00000447338; homo_sapiens.
DR   Ensembl-Tr; ENST00000447369; homo_sapiens.
DR   Ensembl-Tr; ENST00000447391; homo_sapiens.
DR   Ensembl-Tr; ENST00000447465; homo_sapiens.
DR   Ensembl-Tr; ENST00000447505; homo_sapiens.
DR   Ensembl-Tr; ENST00000447587; homo_sapiens.
DR   Ensembl-Tr; ENST00000447705; homo_sapiens.
DR   Ensembl-Tr; ENST00000447711; homo_sapiens.
DR   Ensembl-Tr; ENST00000447741; homo_sapiens.
DR   Ensembl-Tr; ENST00000447811; homo_sapiens.
DR   Ensembl-Tr; ENST00000447921; homo_sapiens.
DR   Ensembl-Tr; ENST00000448042; homo_sapiens.
DR   Ensembl-Tr; ENST00000448067; homo_sapiens.
DR   Ensembl-Tr; ENST00000448077; homo_sapiens.
DR   Ensembl-Tr; ENST00000448091; homo_sapiens.
DR   Ensembl-Tr; ENST00000448196; homo_sapiens.
DR   Ensembl-Tr; ENST00000448206; homo_sapiens.
DR   Ensembl-Tr; ENST00000448236; homo_sapiens.
DR   Ensembl-Tr; ENST00000448296; homo_sapiens.
DR   Ensembl-Tr; ENST00000448314; homo_sapiens.
DR   Ensembl-Tr; ENST00000448378; homo_sapiens.
DR   Ensembl-Tr; ENST00000448381; homo_sapiens.
DR   Ensembl-Tr; ENST00000448386; homo_sapiens.
DR   Ensembl-Tr; ENST00000448441; homo_sapiens.
DR   Ensembl-Tr; ENST00000448455; homo_sapiens.
DR   Ensembl-Tr; ENST00000448478; homo_sapiens.
DR   Ensembl-Tr; ENST00000448526; homo_sapiens.
DR   Ensembl-Tr; ENST00000448594; homo_sapiens.
DR   Ensembl-Tr; ENST00000448596; homo_sapiens.
DR   Ensembl-Tr; ENST00000448617; homo_sapiens.
DR   Ensembl-Tr; ENST00000448628; homo_sapiens.
DR   Ensembl-Tr; ENST00000448645; homo_sapiens.
DR   Ensembl-Tr; ENST00000448670; homo_sapiens.
DR   Ensembl-Tr; ENST00000448684; homo_sapiens.
DR   Ensembl-Tr; ENST00000448749; homo_sapiens.
DR   Ensembl-Tr; ENST00000448754; homo_sapiens.
DR   Ensembl-Tr; ENST00000448779; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000448816; homo_sapiens.
DR   Ensembl-Tr; ENST00000448818; homo_sapiens.
DR   Ensembl-Tr; ENST00000448939; homo_sapiens.
DR   Ensembl-Tr; ENST00000449037; homo_sapiens.
DR   Ensembl-Tr; ENST00000449041; homo_sapiens.
DR   Ensembl-Tr; ENST00000449044; homo_sapiens.
DR   Ensembl-Tr; ENST00000449081; homo_sapiens.
DR   Ensembl-Tr; ENST00000449085; homo_sapiens.
DR   Ensembl-Tr; ENST00000449096; homo_sapiens.
DR   Ensembl-Tr; ENST00000449113; homo_sapiens.
DR   Ensembl-Tr; ENST00000449118; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000449145; homo_sapiens.
DR   Ensembl-Tr; ENST00000449153; homo_sapiens.
DR   Ensembl-Tr; ENST00000449163; homo_sapiens.
DR   Ensembl-Tr; ENST00000449208; homo_sapiens.
DR   Ensembl-Tr; ENST00000449236; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   Ensembl-Tr; ENST00000449273; homo_sapiens.
DR   Ensembl-Tr; ENST00000449318; homo_sapiens.
DR   Ensembl-Tr; ENST00000449450; homo_sapiens.
DR   Ensembl-Tr; ENST00000449518; homo_sapiens.
DR   Ensembl-Tr; ENST00000449538; homo_sapiens.
DR   Ensembl-Tr; ENST00000449558; homo_sapiens.
DR   Ensembl-Tr; ENST00000449633; homo_sapiens.
DR   Ensembl-Tr; ENST00000449705; homo_sapiens.
DR   Ensembl-Tr; ENST00000449742; homo_sapiens.
DR   Ensembl-Tr; ENST00000449748; homo_sapiens.
DR   Ensembl-Tr; ENST00000449754; homo_sapiens.
DR   Ensembl-Tr; ENST00000449776; homo_sapiens.
DR   Ensembl-Tr; ENST00000449794; homo_sapiens.
DR   Ensembl-Tr; ENST00000449799; homo_sapiens.
DR   Ensembl-Tr; ENST00000449826; homo_sapiens.
DR   Ensembl-Tr; ENST00000449861; homo_sapiens.
DR   Ensembl-Tr; ENST00000449868; homo_sapiens.
DR   Ensembl-Tr; ENST00000449905; homo_sapiens.
DR   Ensembl-Tr; ENST00000449934; homo_sapiens.
DR   Ensembl-Tr; ENST00000450003; homo_sapiens.
DR   Ensembl-Tr; ENST00000450015; homo_sapiens.
DR   Ensembl-Tr; ENST00000450075; homo_sapiens.
DR   Ensembl-Tr; ENST00000450138; homo_sapiens.
DR   Ensembl-Tr; ENST00000450147; homo_sapiens.
DR   Ensembl-Tr; ENST00000450220; homo_sapiens.
DR   Ensembl-Tr; ENST00000450229; homo_sapiens.
DR   Ensembl-Tr; ENST00000450236; homo_sapiens.
DR   Ensembl-Tr; ENST00000450291; homo_sapiens.
DR   Ensembl-Tr; ENST00000450392; homo_sapiens.
DR   Ensembl-Tr; ENST00000450425; homo_sapiens.
DR   Ensembl-Tr; ENST00000450526; homo_sapiens.
DR   Ensembl-Tr; ENST00000450601; homo_sapiens.
DR   Ensembl-Tr; ENST00000450610; homo_sapiens.
DR   Ensembl-Tr; ENST00000450744; homo_sapiens.
DR   Ensembl-Tr; ENST00000450778; homo_sapiens.
DR   Ensembl-Tr; ENST00000450817; homo_sapiens.
DR   Ensembl-Tr; ENST00000450897; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000451019; homo_sapiens.
DR   Ensembl-Tr; ENST00000451032; homo_sapiens.
DR   Ensembl-Tr; ENST00000451077; homo_sapiens.
DR   Ensembl-Tr; ENST00000451115; homo_sapiens.
DR   Ensembl-Tr; ENST00000451132; homo_sapiens.
DR   Ensembl-Tr; ENST00000451237; homo_sapiens.
DR   Ensembl-Tr; ENST00000451316; homo_sapiens.
DR   Ensembl-Tr; ENST00000451329; homo_sapiens.
DR   Ensembl-Tr; ENST00000451411; homo_sapiens.
DR   Ensembl-Tr; ENST00000451425; homo_sapiens.
DR   Ensembl-Tr; ENST00000451456; homo_sapiens.
DR   Ensembl-Tr; ENST00000451544; homo_sapiens.
DR   Ensembl-Tr; ENST00000451546; homo_sapiens.
DR   Ensembl-Tr; ENST00000451549; homo_sapiens.
DR   Ensembl-Tr; ENST00000451641; homo_sapiens.
DR   Ensembl-Tr; ENST00000451715; homo_sapiens.
DR   Ensembl-Tr; ENST00000451727; homo_sapiens.
DR   Ensembl-Tr; ENST00000451748; homo_sapiens.
DR   Ensembl-Tr; ENST00000451833; homo_sapiens.
DR   Ensembl-Tr; ENST00000451862; homo_sapiens.
DR   Ensembl-Tr; ENST00000451875; homo_sapiens.
DR   Ensembl-Tr; ENST00000451907; homo_sapiens.
DR   Ensembl-Tr; ENST00000451911; homo_sapiens.
DR   Ensembl-Tr; ENST00000451917; homo_sapiens.
DR   Ensembl-Tr; ENST00000451922; homo_sapiens.
DR   Ensembl-Tr; ENST00000451932; homo_sapiens.
DR   Ensembl-Tr; ENST00000451970; homo_sapiens.
DR   Ensembl-Tr; ENST00000452030; homo_sapiens.
DR   Ensembl-Tr; ENST00000452084; homo_sapiens.
DR   Ensembl-Tr; ENST00000452169; homo_sapiens.
DR   Ensembl-Tr; ENST00000452189; homo_sapiens.
DR   Ensembl-Tr; ENST00000452233; homo_sapiens.
DR   Ensembl-Tr; ENST00000452236; homo_sapiens.
DR   Ensembl-Tr; ENST00000452265; homo_sapiens.
DR   Ensembl-Tr; ENST00000452290; homo_sapiens.
DR   Ensembl-Tr; ENST00000452296; homo_sapiens.
DR   Ensembl-Tr; ENST00000452300; homo_sapiens.
DR   Ensembl-Tr; ENST00000452304; homo_sapiens.
DR   Ensembl-Tr; ENST00000452386; homo_sapiens.
DR   Ensembl-Tr; ENST00000452393; homo_sapiens.
DR   Ensembl-Tr; ENST00000452427; homo_sapiens.
DR   Ensembl-Tr; ENST00000452441; homo_sapiens.
DR   Ensembl-Tr; ENST00000452449; homo_sapiens.
DR   Ensembl-Tr; ENST00000452453; homo_sapiens.
DR   Ensembl-Tr; ENST00000452530; homo_sapiens.
DR   Ensembl-Tr; ENST00000452562; homo_sapiens.
DR   Ensembl-Tr; ENST00000452573; homo_sapiens.
DR   Ensembl-Tr; ENST00000452598; homo_sapiens.
DR   Ensembl-Tr; ENST00000452615; homo_sapiens.
DR   Ensembl-Tr; ENST00000452658; homo_sapiens.
DR   Ensembl-Tr; ENST00000452679; homo_sapiens.
DR   Ensembl-Tr; ENST00000452688; homo_sapiens.
DR   Ensembl-Tr; ENST00000452705; homo_sapiens.
DR   Ensembl-Tr; ENST00000452744; homo_sapiens.
DR   Ensembl-Tr; ENST00000452899; homo_sapiens.
DR   Ensembl-Tr; ENST00000452937; homo_sapiens.
DR   Ensembl-Tr; ENST00000452985; homo_sapiens.
DR   Ensembl-Tr; ENST00000453044; homo_sapiens.
DR   Ensembl-Tr; ENST00000453059; homo_sapiens.
DR   Ensembl-Tr; ENST00000453138; homo_sapiens.
DR   Ensembl-Tr; ENST00000453195; homo_sapiens.
DR   Ensembl-Tr; ENST00000453232; homo_sapiens.
DR   Ensembl-Tr; ENST00000453234; homo_sapiens.
DR   Ensembl-Tr; ENST00000453377; homo_sapiens.
DR   Ensembl-Tr; ENST00000453467; homo_sapiens.
DR   Ensembl-Tr; ENST00000453473; homo_sapiens.
DR   Ensembl-Tr; ENST00000453487; homo_sapiens.
DR   Ensembl-Tr; ENST00000453490; homo_sapiens.
DR   Ensembl-Tr; ENST00000453510; homo_sapiens.
DR   Ensembl-Tr; ENST00000453513; homo_sapiens.
DR   Ensembl-Tr; ENST00000453588; homo_sapiens.
DR   Ensembl-Tr; ENST00000453657; homo_sapiens.
DR   Ensembl-Tr; ENST00000453667; homo_sapiens.
DR   Ensembl-Tr; ENST00000453694; homo_sapiens.
DR   Ensembl-Tr; ENST00000453742; homo_sapiens.
DR   Ensembl-Tr; ENST00000453746; homo_sapiens.
DR   Ensembl-Tr; ENST00000453831; homo_sapiens.
DR   Ensembl-Tr; ENST00000453879; homo_sapiens.
DR   Ensembl-Tr; ENST00000453899; homo_sapiens.
DR   Ensembl-Tr; ENST00000453940; homo_sapiens.
DR   Ensembl-Tr; ENST00000453961; homo_sapiens.
DR   Ensembl-Tr; ENST00000453995; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
DR   Ensembl-Tr; ENST00000454021; homo_sapiens.
DR   Ensembl-Tr; ENST00000454071; homo_sapiens.
DR   Ensembl-Tr; ENST00000454112; homo_sapiens.
DR   Ensembl-Tr; ENST00000454138; homo_sapiens.
DR   Ensembl-Tr; ENST00000454168; homo_sapiens.
DR   Ensembl-Tr; ENST00000454191; homo_sapiens.
DR   Ensembl-Tr; ENST00000454306; homo_sapiens.
DR   Ensembl-Tr; ENST00000454370; homo_sapiens.
DR   Ensembl-Tr; ENST00000454382; homo_sapiens.
DR   Ensembl-Tr; ENST00000454399; homo_sapiens.
DR   Ensembl-Tr; ENST00000454427; homo_sapiens.
DR   Ensembl-Tr; ENST00000454430; homo_sapiens.
DR   Ensembl-Tr; ENST00000454511; homo_sapiens.
DR   Ensembl-Tr; ENST00000454550; homo_sapiens.
DR   Ensembl-Tr; ENST00000454612; homo_sapiens.
DR   Ensembl-Tr; ENST00000454628; homo_sapiens.
DR   Ensembl-Tr; ENST00000454649; homo_sapiens.
DR   Ensembl-Tr; ENST00000454678; homo_sapiens.
DR   Ensembl-Tr; ENST00000454714; homo_sapiens.
DR   Ensembl-Tr; ENST00000454774; homo_sapiens.
DR   Ensembl-Tr; ENST00000454782; homo_sapiens.
DR   Ensembl-Tr; ENST00000454783; homo_sapiens.
DR   Ensembl-Tr; ENST00000454794; homo_sapiens.
DR   Ensembl-Tr; ENST00000454805; homo_sapiens.
DR   Ensembl-Tr; ENST00000454829; homo_sapiens.
DR   Ensembl-Tr; ENST00000454889; homo_sapiens.
DR   Ensembl-Tr; ENST00000454914; homo_sapiens.
DR   Ensembl-Tr; ENST00000454929; homo_sapiens.
DR   Ensembl-Tr; ENST00000454969; homo_sapiens.
DR   Ensembl-Tr; ENST00000454987; homo_sapiens.
DR   Ensembl-Tr; ENST00000455000; homo_sapiens.
DR   Ensembl-Tr; ENST00000455003; homo_sapiens.
DR   Ensembl-Tr; ENST00000455025; homo_sapiens.
DR   Ensembl-Tr; ENST00000455052; homo_sapiens.
DR   Ensembl-Tr; ENST00000455161; homo_sapiens.
DR   Ensembl-Tr; ENST00000455185; homo_sapiens.
DR   Ensembl-Tr; ENST00000455376; homo_sapiens.
DR   Ensembl-Tr; ENST00000455426; homo_sapiens.
DR   Ensembl-Tr; ENST00000455448; homo_sapiens.
DR   Ensembl-Tr; ENST00000455493; homo_sapiens.
DR   Ensembl-Tr; ENST00000455591; homo_sapiens.
DR   Ensembl-Tr; ENST00000455632; homo_sapiens.
DR   Ensembl-Tr; ENST00000455655; homo_sapiens.
DR   Ensembl-Tr; ENST00000455660; homo_sapiens.
DR   Ensembl-Tr; ENST00000455687; homo_sapiens.
DR   Ensembl-Tr; ENST00000455705; homo_sapiens.
DR   Ensembl-Tr; ENST00000455753; homo_sapiens.
DR   Ensembl-Tr; ENST00000455825; homo_sapiens.
DR   Ensembl-Tr; ENST00000455860; homo_sapiens.
DR   Ensembl-Tr; ENST00000455889; homo_sapiens.
DR   Ensembl-Tr; ENST00000455898; homo_sapiens.
DR   Ensembl-Tr; ENST00000455901; homo_sapiens.
DR   Ensembl-Tr; ENST00000455935; homo_sapiens.
DR   Ensembl-Tr; ENST00000455948; homo_sapiens.
DR   Ensembl-Tr; ENST00000456093; homo_sapiens.
DR   Ensembl-Tr; ENST00000456113; homo_sapiens.
DR   Ensembl-Tr; ENST00000456140; homo_sapiens.
DR   Ensembl-Tr; ENST00000456152; homo_sapiens.
DR   Ensembl-Tr; ENST00000456156; homo_sapiens.
DR   Ensembl-Tr; ENST00000456167; homo_sapiens.
DR   Ensembl-Tr; ENST00000456191; homo_sapiens.
DR   Ensembl-Tr; ENST00000456215; homo_sapiens.
DR   Ensembl-Tr; ENST00000456261; homo_sapiens.
DR   Ensembl-Tr; ENST00000456268; homo_sapiens.
DR   Ensembl-Tr; ENST00000456406; homo_sapiens.
DR   Ensembl-Tr; ENST00000456421; homo_sapiens.
DR   Ensembl-Tr; ENST00000456476; homo_sapiens.
DR   Ensembl-Tr; ENST00000456497; homo_sapiens.
DR   Ensembl-Tr; ENST00000456607; homo_sapiens.
DR   Ensembl-Tr; ENST00000456657; homo_sapiens.
DR   Ensembl-Tr; ENST00000456666; homo_sapiens.
DR   Ensembl-Tr; ENST00000456679; homo_sapiens.
DR   Ensembl-Tr; ENST00000456690; homo_sapiens.
DR   Ensembl-Tr; ENST00000456704; homo_sapiens.
DR   Ensembl-Tr; ENST00000456720; homo_sapiens.
DR   Ensembl-Tr; ENST00000456770; homo_sapiens.
DR   Ensembl-Tr; ENST00000456807; homo_sapiens.
DR   Ensembl-Tr; ENST00000456814; homo_sapiens.
DR   Ensembl-Tr; ENST00000456839; homo_sapiens.
DR   Ensembl-Tr; ENST00000456854; homo_sapiens.
DR   Ensembl-Tr; ENST00000456863; homo_sapiens.
DR   Ensembl-Tr; ENST00000456918; homo_sapiens.
DR   Ensembl-Tr; ENST00000456968; homo_sapiens.
DR   Ensembl-Tr; ENST00000456988; homo_sapiens.
DR   Ensembl-Tr; ENST00000457070; homo_sapiens.
DR   Ensembl-Tr; ENST00000457090; homo_sapiens.
DR   Ensembl-Tr; ENST00000457092; homo_sapiens.
DR   Ensembl-Tr; ENST00000457104; homo_sapiens.
DR   Ensembl-Tr; ENST00000457161; homo_sapiens.
DR   Ensembl-Tr; ENST00000457261; homo_sapiens.
DR   Ensembl-Tr; ENST00000457334; homo_sapiens.
DR   Ensembl-Tr; ENST00000457341; homo_sapiens.
DR   Ensembl-Tr; ENST00000457366; homo_sapiens.
DR   Ensembl-Tr; ENST00000457382; homo_sapiens.
DR   Ensembl-Tr; ENST00000457389; homo_sapiens.
DR   Ensembl-Tr; ENST00000457397; homo_sapiens.
DR   Ensembl-Tr; ENST00000457450; homo_sapiens.
DR   Ensembl-Tr; ENST00000457485; homo_sapiens.
DR   Ensembl-Tr; ENST00000457505; homo_sapiens.
DR   Ensembl-Tr; ENST00000457509; homo_sapiens.
DR   Ensembl-Tr; ENST00000457547; homo_sapiens.
DR   Ensembl-Tr; ENST00000457549; homo_sapiens.
DR   Ensembl-Tr; ENST00000457552; homo_sapiens.
DR   Ensembl-Tr; ENST00000457626; homo_sapiens.
DR   Ensembl-Tr; ENST00000457742; homo_sapiens.
DR   Ensembl-Tr; ENST00000457796; homo_sapiens.
DR   Ensembl-Tr; ENST00000457884; homo_sapiens.
DR   Ensembl-Tr; ENST00000457919; homo_sapiens.
DR   Ensembl-Tr; ENST00000457923; homo_sapiens.
DR   Ensembl-Tr; ENST00000458051; homo_sapiens.
DR   Ensembl-Tr; ENST00000458081; homo_sapiens.
DR   Ensembl-Tr; ENST00000458094; homo_sapiens.
DR   Ensembl-Tr; ENST00000458179; homo_sapiens.
DR   Ensembl-Tr; ENST00000458242; homo_sapiens.
DR   Ensembl-Tr; ENST00000458308; homo_sapiens.
DR   Ensembl-Tr; ENST00000458330; homo_sapiens.
DR   Ensembl-Tr; ENST00000458372; homo_sapiens.
DR   Ensembl-Tr; ENST00000458456; homo_sapiens.
DR   Ensembl-Tr; ENST00000458460; homo_sapiens.
DR   Ensembl-Tr; ENST00000458514; homo_sapiens.
DR   Ensembl-Tr; ENST00000458561; homo_sapiens.
DR   Ensembl-Tr; ENST00000458589; homo_sapiens.
DR   Ensembl-Tr; ENST00000458607; homo_sapiens.
DR   Ensembl-Tr; ENST00000458612; homo_sapiens.
DR   Ensembl-Tr; ENST00000458640; homo_sapiens.
DR   Ensembl-Tr; ENST00000458694; homo_sapiens.
DR   Ensembl-Tr; ENST00000458719; homo_sapiens.
DR   Ensembl-Tr; ENST00000461010; homo_sapiens.
DR   Ensembl-Tr; ENST00000462244; homo_sapiens.
DR   Ensembl-Tr; ENST00000463088; homo_sapiens.
DR   Ensembl-Tr; ENST00000467714; homo_sapiens.
DR   Ensembl-Tr; ENST00000467906; homo_sapiens.
DR   Ensembl-Tr; ENST00000468148; homo_sapiens.
DR   Ensembl-Tr; ENST00000468811; homo_sapiens.
DR   Ensembl-Tr; ENST00000469384; homo_sapiens.
DR   Ensembl-Tr; ENST00000469644; homo_sapiens.
DR   Ensembl-Tr; ENST00000469731; homo_sapiens.
DR   Ensembl-Tr; ENST00000470881; homo_sapiens.
DR   Ensembl-Tr; ENST00000471674; homo_sapiens.
DR   Ensembl-Tr; ENST00000474973; homo_sapiens.
DR   Ensembl-Tr; ENST00000475057; homo_sapiens.
DR   Ensembl-Tr; ENST00000476214; homo_sapiens.
DR   Ensembl-Tr; ENST00000476288; homo_sapiens.
DR   Ensembl-Tr; ENST00000477055; homo_sapiens.
DR   Ensembl-Tr; ENST00000477442; homo_sapiens.
DR   Ensembl-Tr; ENST00000479388; homo_sapiens.
DR   Ensembl-Tr; ENST00000479950; homo_sapiens.
DR   Ensembl-Tr; ENST00000480025; homo_sapiens.
DR   Ensembl-Tr; ENST00000480383; homo_sapiens.
DR   Ensembl-Tr; ENST00000480515; homo_sapiens.
DR   Ensembl-Tr; ENST00000480530; homo_sapiens.
DR   Ensembl-Tr; ENST00000480585; homo_sapiens.
DR   Ensembl-Tr; ENST00000480824; homo_sapiens.
DR   Ensembl-Tr; ENST00000480850; homo_sapiens.
DR   Ensembl-Tr; ENST00000481247; homo_sapiens.
DR   Ensembl-Tr; ENST00000481273; homo_sapiens.
DR   Ensembl-Tr; ENST00000481983; homo_sapiens.
DR   Ensembl-Tr; ENST00000482873; homo_sapiens.
DR   Ensembl-Tr; ENST00000483251; homo_sapiens.
DR   Ensembl-Tr; ENST00000483565; homo_sapiens.
DR   Ensembl-Tr; ENST00000484321; homo_sapiens.
DR   Ensembl-Tr; ENST00000484964; homo_sapiens.
DR   Ensembl-Tr; ENST00000485511; homo_sapiens.
DR   Ensembl-Tr; ENST00000486781; homo_sapiens.
DR   Ensembl-Tr; ENST00000487251; homo_sapiens.
DR   Ensembl-Tr; ENST00000488579; homo_sapiens.
DR   Ensembl-Tr; ENST00000490011; homo_sapiens.
DR   Ensembl-Tr; ENST00000490427; homo_sapiens.
DR   Ensembl-Tr; ENST00000490624; homo_sapiens.
DR   Ensembl-Tr; ENST00000490799; homo_sapiens.
DR   Ensembl-Tr; ENST00000493422; homo_sapiens.
DR   Ensembl-Tr; ENST00000493662; homo_sapiens.
DR   Ensembl-Tr; ENST00000493763; homo_sapiens.
DR   Ensembl-Tr; ENST00000493809; homo_sapiens.
DR   Ensembl-Tr; ENST00000494232; homo_sapiens.
DR   Ensembl-Tr; ENST00000494692; homo_sapiens.
DR   Ensembl-Tr; ENST00000494877; homo_sapiens.
DR   Ensembl-Tr; ENST00000495859; homo_sapiens.
DR   Ensembl-Tr; ENST00000496937; homo_sapiens.
DR   Ensembl-Tr; ENST00000497123; homo_sapiens.
DR   Ensembl-Tr; ENST00000497454; homo_sapiens.
DR   Ensembl-Tr; ENST00000498232; homo_sapiens.
DR   Ensembl-Tr; ENST00000503212; homo_sapiens.
DR   Ensembl-Tr; ENST00000505118; homo_sapiens.
DR   Ensembl-Tr; ENST00000505384; homo_sapiens.
DR   Ensembl-Tr; ENST00000505425; homo_sapiens.
DR   Ensembl-Tr; ENST00000507738; homo_sapiens.
DR   Ensembl-Tr; ENST00000508312; homo_sapiens.
DR   Ensembl-Tr; ENST00000511642; homo_sapiens.
DR   Ensembl-Tr; ENST00000512012; homo_sapiens.
DR   Ensembl-Tr; ENST00000513240; homo_sapiens.
DR   Ensembl-Tr; ENST00000515317; homo_sapiens.
DR   Ensembl-Tr; ENST00000518689; homo_sapiens.
DR   Ensembl-Tr; ENST00000518824; homo_sapiens.
DR   Ensembl-Tr; ENST00000520948; homo_sapiens.
DR   Ensembl-Tr; ENST00000523125; homo_sapiens.
DR   Ensembl-Tr; ENST00000523873; homo_sapiens.
DR   Ensembl-Tr; ENST00000523950; homo_sapiens.
DR   Ensembl-Tr; ENST00000525601; homo_sapiens.
DR   Ensembl-Tr; ENST00000527704; homo_sapiens.
DR   Ensembl-Tr; ENST00000529246; homo_sapiens.
DR   Ensembl-Tr; ENST00000531979; homo_sapiens.
DR   Ensembl-Tr; ENST00000534694; homo_sapiens.
DR   Ensembl-Tr; ENST00000536028; homo_sapiens.
DR   Ensembl-Tr; ENST00000536244; homo_sapiens.
DR   Ensembl-Tr; ENST00000536438; homo_sapiens.
DR   Ensembl-Tr; ENST00000537365; homo_sapiens.
DR   Ensembl-Tr; ENST00000538487; homo_sapiens.
DR   Ensembl-Tr; ENST00000538621; homo_sapiens.
DR   Ensembl-Tr; ENST00000538976; homo_sapiens.
DR   Ensembl-Tr; ENST00000538992; homo_sapiens.
DR   Ensembl-Tr; ENST00000539068; homo_sapiens.
DR   Ensembl-Tr; ENST00000539745; homo_sapiens.
DR   Ensembl-Tr; ENST00000542638; homo_sapiens.
DR   Ensembl-Tr; ENST00000542713; homo_sapiens.
DR   Ensembl-Tr; ENST00000543825; homo_sapiens.
DR   Ensembl-Tr; ENST00000544153; homo_sapiens.
DR   Ensembl-Tr; ENST00000544672; homo_sapiens.
DR   Ensembl-Tr; ENST00000546461; homo_sapiens.
DR   Ensembl-Tr; ENST00000546529; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000546665; homo_sapiens.
DR   Ensembl-Tr; ENST00000546871; homo_sapiens.
DR   Ensembl-Tr; ENST00000546913; homo_sapiens.
DR   Ensembl-Tr; ENST00000547030; homo_sapiens.
DR   Ensembl-Tr; ENST00000547083; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547289; homo_sapiens.
DR   Ensembl-Tr; ENST00000547309; homo_sapiens.
DR   Ensembl-Tr; ENST00000547328; homo_sapiens.
DR   Ensembl-Tr; ENST00000547410; homo_sapiens.
DR   Ensembl-Tr; ENST00000547493; homo_sapiens.
DR   Ensembl-Tr; ENST00000547506; homo_sapiens.
DR   Ensembl-Tr; ENST00000547641; homo_sapiens.
DR   Ensembl-Tr; ENST00000547645; homo_sapiens.
DR   Ensembl-Tr; ENST00000547651; homo_sapiens.
DR   Ensembl-Tr; ENST00000547684; homo_sapiens.
DR   Ensembl-Tr; ENST00000547767; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000547952; homo_sapiens.
DR   Ensembl-Tr; ENST00000548002; homo_sapiens.
DR   Ensembl-Tr; ENST00000548017; homo_sapiens.
DR   Ensembl-Tr; ENST00000548040; homo_sapiens.
DR   Ensembl-Tr; ENST00000548133; homo_sapiens.
DR   Ensembl-Tr; ENST00000548188; homo_sapiens.
DR   Ensembl-Tr; ENST00000548464; homo_sapiens.
DR   Ensembl-Tr; ENST00000548546; homo_sapiens.
DR   Ensembl-Tr; ENST00000548767; homo_sapiens.
DR   Ensembl-Tr; ENST00000548813; homo_sapiens.
DR   Ensembl-Tr; ENST00000548962; homo_sapiens.
DR   Ensembl-Tr; ENST00000549026; homo_sapiens.
DR   Ensembl-Tr; ENST00000549059; homo_sapiens.
DR   Ensembl-Tr; ENST00000549126; homo_sapiens.
DR   Ensembl-Tr; ENST00000549299; homo_sapiens.
DR   Ensembl-Tr; ENST00000549426; homo_sapiens.
DR   Ensembl-Tr; ENST00000549491; homo_sapiens.
DR   Ensembl-Tr; ENST00000549663; homo_sapiens.
DR   Ensembl-Tr; ENST00000549677; homo_sapiens.
DR   Ensembl-Tr; ENST00000549728; homo_sapiens.
DR   Ensembl-Tr; ENST00000549749; homo_sapiens.
DR   Ensembl-Tr; ENST00000549758; homo_sapiens.
DR   Ensembl-Tr; ENST00000549811; homo_sapiens.
DR   Ensembl-Tr; ENST00000549841; homo_sapiens.
DR   Ensembl-Tr; ENST00000550240; homo_sapiens.
DR   Ensembl-Tr; ENST00000550282; homo_sapiens.
DR   Ensembl-Tr; ENST00000550384; homo_sapiens.
DR   Ensembl-Tr; ENST00000550395; homo_sapiens.
DR   Ensembl-Tr; ENST00000550401; homo_sapiens.
DR   Ensembl-Tr; ENST00000550492; homo_sapiens.
DR   Ensembl-Tr; ENST00000550562; homo_sapiens.
DR   Ensembl-Tr; ENST00000550681; homo_sapiens.
DR   Ensembl-Tr; ENST00000550685; homo_sapiens.
DR   Ensembl-Tr; ENST00000550775; homo_sapiens.
DR   Ensembl-Tr; ENST00000550796; homo_sapiens.
DR   Ensembl-Tr; ENST00000550849; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000550913; homo_sapiens.
DR   Ensembl-Tr; ENST00000550998; homo_sapiens.
DR   Ensembl-Tr; ENST00000551140; homo_sapiens.
DR   Ensembl-Tr; ENST00000551168; homo_sapiens.
DR   Ensembl-Tr; ENST00000551175; homo_sapiens.
DR   Ensembl-Tr; ENST00000551222; homo_sapiens.
DR   Ensembl-Tr; ENST00000551254; homo_sapiens.
DR   Ensembl-Tr; ENST00000551350; homo_sapiens.
DR   Ensembl-Tr; ENST00000551381; homo_sapiens.
DR   Ensembl-Tr; ENST00000551423; homo_sapiens.
DR   Ensembl-Tr; ENST00000551542; homo_sapiens.
DR   Ensembl-Tr; ENST00000551639; homo_sapiens.
DR   Ensembl-Tr; ENST00000551758; homo_sapiens.
DR   Ensembl-Tr; ENST00000551827; homo_sapiens.
DR   Ensembl-Tr; ENST00000551986; homo_sapiens.
DR   Ensembl-Tr; ENST00000551993; homo_sapiens.
DR   Ensembl-Tr; ENST00000552068; homo_sapiens.
DR   Ensembl-Tr; ENST00000552116; homo_sapiens.
DR   Ensembl-Tr; ENST00000552119; homo_sapiens.
DR   Ensembl-Tr; ENST00000552225; homo_sapiens.
DR   Ensembl-Tr; ENST00000552337; homo_sapiens.
DR   Ensembl-Tr; ENST00000552399; homo_sapiens.
DR   Ensembl-Tr; ENST00000552446; homo_sapiens.
DR   Ensembl-Tr; ENST00000552473; homo_sapiens.
DR   Ensembl-Tr; ENST00000552514; homo_sapiens.
DR   Ensembl-Tr; ENST00000552520; homo_sapiens.
DR   Ensembl-Tr; ENST00000552587; homo_sapiens.
DR   Ensembl-Tr; ENST00000552605; homo_sapiens.
DR   Ensembl-Tr; ENST00000552711; homo_sapiens.
DR   Ensembl-Tr; ENST00000552721; homo_sapiens.
DR   Ensembl-Tr; ENST00000552922; homo_sapiens.
DR   Ensembl-Tr; ENST00000553015; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   Ensembl-Tr; ENST00000553111; homo_sapiens.
DR   Ensembl-Tr; ENST00000553121; homo_sapiens.
DR   Ensembl-Tr; ENST00000578186; homo_sapiens.
DR   Ensembl-Tr; ENST00000579512; homo_sapiens.
DR   Ensembl-Tr; ENST00000583103; homo_sapiens.
DR   Ensembl-Tr; ENST00000589614; homo_sapiens.
DR   Ensembl-Tr; ENST00000596288; homo_sapiens.
DR   Ensembl-Tr; ENST00000605930; homo_sapiens.
DR   Ensembl-Tr; ENST00000606198; homo_sapiens.
DR   Ensembl-Tr; ENST00000606613; homo_sapiens.
DR   Ensembl-Tr; ENST00000607016; homo_sapiens.
DR   Ensembl-Tr; ENST00000607124; homo_sapiens.
DR   Ensembl-Tr; ENST00000607484; homo_sapiens.
DR   Ensembl-Tr; ENST00000610775; homo_sapiens.
DR   Ensembl-Tr; ENST00000611141; homo_sapiens.
DR   Ensembl-Tr; ENST00000611469; homo_sapiens.
DR   Ensembl-Tr; ENST00000611736; homo_sapiens.
DR   Ensembl-Tr; ENST00000611927; homo_sapiens.
DR   Ensembl-Tr; ENST00000612061; homo_sapiens.
DR   Ensembl-Tr; ENST00000612190; homo_sapiens.
DR   Ensembl-Tr; ENST00000612868; homo_sapiens.
DR   Ensembl-Tr; ENST00000612888; homo_sapiens.
DR   Ensembl-Tr; ENST00000612898; homo_sapiens.
DR   Ensembl-Tr; ENST00000613174; homo_sapiens.
DR   Ensembl-Tr; ENST00000613412; homo_sapiens.
DR   Ensembl-Tr; ENST00000613474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613827; homo_sapiens.
DR   Ensembl-Tr; ENST00000613912; homo_sapiens.
DR   Ensembl-Tr; ENST00000614088; homo_sapiens.
DR   Ensembl-Tr; ENST00000614103; homo_sapiens.
DR   Ensembl-Tr; ENST00000614247; homo_sapiens.
DR   Ensembl-Tr; ENST00000614272; homo_sapiens.
DR   Ensembl-Tr; ENST00000614363; homo_sapiens.
DR   Ensembl-Tr; ENST00000614467; homo_sapiens.
DR   Ensembl-Tr; ENST00000614475; homo_sapiens.
DR   Ensembl-Tr; ENST00000614673; homo_sapiens.
DR   Ensembl-Tr; ENST00000614982; homo_sapiens.
DR   Ensembl-Tr; ENST00000615143; homo_sapiens.
DR   Ensembl-Tr; ENST00000615164; homo_sapiens.
DR   Ensembl-Tr; ENST00000615224; homo_sapiens.
DR   Ensembl-Tr; ENST00000615353; homo_sapiens.
DR   Ensembl-Tr; ENST00000615358; homo_sapiens.
DR   Ensembl-Tr; ENST00000615393; homo_sapiens.
DR   Ensembl-Tr; ENST00000615513; homo_sapiens.
DR   Ensembl-Tr; ENST00000615527; homo_sapiens.
DR   Ensembl-Tr; ENST00000615725; homo_sapiens.
DR   Ensembl-Tr; ENST00000615781; homo_sapiens.
DR   Ensembl-Tr; ENST00000615892; homo_sapiens.
DR   Ensembl-Tr; ENST00000616010; homo_sapiens.
DR   Ensembl-Tr; ENST00000616014; homo_sapiens.
DR   Ensembl-Tr; ENST00000616296; homo_sapiens.
DR   Ensembl-Tr; ENST00000616312; homo_sapiens.
DR   Ensembl-Tr; ENST00000616351; homo_sapiens.
DR   Ensembl-Tr; ENST00000616552; homo_sapiens.
DR   Ensembl-Tr; ENST00000616725; homo_sapiens.
DR   Ensembl-Tr; ENST00000616760; homo_sapiens.
DR   Ensembl-Tr; ENST00000616968; homo_sapiens.
DR   Ensembl-Tr; ENST00000617159; homo_sapiens.
DR   Ensembl-Tr; ENST00000617220; homo_sapiens.
DR   Ensembl-Tr; ENST00000617569; homo_sapiens.
DR   Ensembl-Tr; ENST00000617572; homo_sapiens.
DR   Ensembl-Tr; ENST00000617635; homo_sapiens.
DR   Ensembl-Tr; ENST00000617660; homo_sapiens.
DR   Ensembl-Tr; ENST00000617771; homo_sapiens.
DR   Ensembl-Tr; ENST00000618059; homo_sapiens.
DR   Ensembl-Tr; ENST00000618193; homo_sapiens.
DR   Ensembl-Tr; ENST00000618288; homo_sapiens.
DR   Ensembl-Tr; ENST00000618305; homo_sapiens.
DR   Ensembl-Tr; ENST00000618917; homo_sapiens.
DR   Ensembl-Tr; ENST00000618958; homo_sapiens.
DR   Ensembl-Tr; ENST00000619421; homo_sapiens.
DR   Ensembl-Tr; ENST00000619727; homo_sapiens.
DR   Ensembl-Tr; ENST00000619937; homo_sapiens.
DR   Ensembl-Tr; ENST00000620073; homo_sapiens.
DR   Ensembl-Tr; ENST00000620164; homo_sapiens.
DR   Ensembl-Tr; ENST00000620249; homo_sapiens.
DR   Ensembl-Tr; ENST00000620318; homo_sapiens.
DR   Ensembl-Tr; ENST00000620358; homo_sapiens.
DR   Ensembl-Tr; ENST00000620693; homo_sapiens.
DR   Ensembl-Tr; ENST00000620941; homo_sapiens.
DR   Ensembl-Tr; ENST00000621055; homo_sapiens.
DR   Ensembl-Tr; ENST00000621056; homo_sapiens.
DR   Ensembl-Tr; ENST00000621356; homo_sapiens.
DR   Ensembl-Tr; ENST00000621520; homo_sapiens.
DR   Ensembl-Tr; ENST00000621544; homo_sapiens.
DR   Ensembl-Tr; ENST00000621747; homo_sapiens.
DR   Ensembl-Tr; ENST00000622613; homo_sapiens.
DR   Ensembl-Tr; ENST00000622655; homo_sapiens.
DR   Ensembl-Tr; ENST00000623183; homo_sapiens.
DR   Ensembl-Tr; ENST00000627426; homo_sapiens.
DR   Ensembl-Tr; ENST00000627846; homo_sapiens.
DR   Ensembl-Tr; ENST00000628419; homo_sapiens.
DR   Ensembl-Tr; ENST00000629380; homo_sapiens.
DR   Ensembl-Tr; ENST00000633794; homo_sapiens.
DR   Ensembl-Tr; ENST00000633795; homo_sapiens.
DR   Ensembl-Tr; ENST00000634560; homo_sapiens.
DR   Ensembl-Tr; ENST00000634956; homo_sapiens.
DR   Ensembl-Tr; ENST00000635491; homo_sapiens.
DR   Ensembl-Tr; ENST00000636500; homo_sapiens.
DR   Ensembl-Tr; ENST00000640482; homo_sapiens.
DR   Ensembl-Tr; ENST00000640499; homo_sapiens.
DR   Ensembl-Tr; ENST00000640653; homo_sapiens.
DR   Ensembl-Tr; ENST00000641152; homo_sapiens.
DR   PubMed; 11181995.
DR   PubMed; 14769938.
XX
CC   This is the November 2001 combined whole genome shotgun assembly
CC   applied to the 27 million reads of Celera's whole genome shotgun
CC   data and 16 million  reads of shredded GenBank data from other
CC   human genome projects (Nature 2001. 409:860-921). It relied on
CC   Celera's paired reads and BAC end reads from TIGR for long range
CC   order and orientation. Its scaffolds were mapped to chromosomes
CC   using STS maps. For more detailed information about whole genome
CC   sequencing and Celera's assembly process, please refer to Venter,
CC   J.C. et al. Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was created in
CC   April 2002 from the whole-genome mapping of transcript and protein
CC   sequences on the Celera human genome assembly
CC   (http://www.ncbi.nlm.nih.gov/genome/guide/human/release_notes.html)
CC   by Celera Chromosome Team, Content Systems and Informatics
CC   Research. The data sets used by this annotation process were
CC   collected in 2001 and include RefSeq (NM_) sequences, manually
CC   annotated transcripts from previous Celera assemblies, GenBank mRNA
CC   and dbEST sequences, Celera internal EST and full-insert sequences
CC   of cDNA clones (unpublished), mammalian SwissProt sequences, NRAA
CC   sequences, and International Protein Index (IPI) sequences (all
CC   human unless noted otherwise).  The CDS of each transcript was
CC   computationally defined by either the longest ATG-to-Stop or the
CC   longest open reading frame. All CDSs corresponding to the longest
CC   open reading frames with no starting ATG were flagged as partial.
CC   In addition, some of the genes were manually curated between 2002
CC   and 2005. Coverage analysis of splice junction donor/acceptor pairs
CC   and single-exon transcripts was done by Applied Biosystems in
CC   August 2006, based on Dec 2005 versions of human cDNA (RefSeq,
CC   Genbank mRNA and dbEST, Celera internal EST and full insert
CC   sequences) and human SwissProt sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..30372612
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <58037..>61595
FT                   /locus_tag="hCG_2040858"
FT                   /note="gene_id=hCG2040858.0"
FT   mRNA            join(<58037..58417,61016..61159,61527..>61595)
FT                   /locus_tag="hCG_2040858"
FT                   /product="hCG2040858"
FT                   /note="gene_id=hCG2040858.0 transcript_id=hCT2346089.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-JUN-2003"
FT   CDS             join(<61038..61159,61527..>61595)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040858"
FT                   /product="hCG2040858"
FT                   /note="gene_id=hCG2040858.0 transcript_id=hCT2346089.0
FT                   protein_id=hCP1912591.0"
FT                   /protein_id="EAX03079.1"
FT                   /translation="EVQIPRDCDGLQRLKLTTWKDMERYSLPTLNYSNYSKTSNLSPTG
FT                   LKRRMRDKEKSCLAASAV"
FT   gene            complement(161961..170895)
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /note="gene_id=hCG1641457.3"
FT   mRNA            complement(join(161961..162062,163033..164560,
FT                   165362..165499,170624..170895))
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, transcript variant hCT2350131"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT2350131.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 03-DEC-2003"
FT   mRNA            complement(join(161961..162062,163033..164560,
FT                   165362..165499,170466..170895))
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, transcript variant hCT1641584"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT1641584.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 03-DEC-2003"
FT   CDS             complement(join(165489..165499,170624..170849))
FT                   /codon_start=1
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, isoform CRA_b"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT2350131.0
FT                   protein_id=hCP1915381.0 isoform=CRA_b"
FT                   /protein_id="EAX03082.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGLP"
FT   mRNA            complement(170088..170895)
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, transcript variant hCT2291734"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT2291734.0;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(170469..170849)
FT                   /codon_start=1
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, isoform CRA_a"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT1641584.3
FT                   protein_id=hCP1626301.0 isoform=CRA_a"
FT                   /db_xref="GOA:P06899"
FT                   /db_xref="HGNC:HGNC:4761"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="PDB:2RVQ"
FT                   /db_xref="PDB:3A6N"
FT                   /db_xref="PDB:3AFA"
FT                   /db_xref="PDB:3AN2"
FT                   /db_xref="PDB:3AV1"
FT                   /db_xref="PDB:3AV2"
FT                   /db_xref="PDB:3AYW"
FT                   /db_xref="PDB:3AZE"
FT                   /db_xref="PDB:3AZF"
FT                   /db_xref="PDB:3AZG"
FT                   /db_xref="PDB:3AZH"
FT                   /db_xref="PDB:3AZI"
FT                   /db_xref="PDB:3AZJ"
FT                   /db_xref="PDB:3AZK"
FT                   /db_xref="PDB:3AZL"
FT                   /db_xref="PDB:3AZM"
FT                   /db_xref="PDB:3AZN"
FT                   /db_xref="PDB:3W96"
FT                   /db_xref="PDB:3W97"
FT                   /db_xref="PDB:3W98"
FT                   /db_xref="PDB:3W99"
FT                   /db_xref="PDB:3WA9"
FT                   /db_xref="PDB:3WAA"
FT                   /db_xref="PDB:3WTP"
FT                   /db_xref="PDB:4CAY"
FT                   /db_xref="PDB:4YM5"
FT                   /db_xref="PDB:4YM6"
FT                   /db_xref="PDB:4Z5T"
FT                   /db_xref="PDB:5AV5"
FT                   /db_xref="PDB:5AV6"
FT                   /db_xref="PDB:5AV8"
FT                   /db_xref="PDB:5AV9"
FT                   /db_xref="PDB:5AVB"
FT                   /db_xref="PDB:5AVC"
FT                   /db_xref="PDB:5AY8"
FT                   /db_xref="PDB:5B0Y"
FT                   /db_xref="PDB:5B0Z"
FT                   /db_xref="PDB:5B24"
FT                   /db_xref="PDB:5B2I"
FT                   /db_xref="PDB:5B2J"
FT                   /db_xref="PDB:5B31"
FT                   /db_xref="PDB:5B32"
FT                   /db_xref="PDB:5B33"
FT                   /db_xref="PDB:5B40"
FT                   /db_xref="PDB:5CPI"
FT                   /db_xref="PDB:5CPJ"
FT                   /db_xref="PDB:5CPK"
FT                   /db_xref="PDB:5FUG"
FT                   /db_xref="PDB:5GSE"
FT                   /db_xref="PDB:5GTC"
FT                   /db_xref="PDB:5GXQ"
FT                   /db_xref="PDB:5JRG"
FT                   /db_xref="PDB:5VEY"
FT                   /db_xref="PDB:5X7X"
FT                   /db_xref="PDB:5XF3"
FT                   /db_xref="PDB:5XF4"
FT                   /db_xref="PDB:5XF5"
FT                   /db_xref="PDB:6BUZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06899"
FT                   /protein_id="EAX03080.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSAK"
FT   CDS             complement(170469..170849)
FT                   /codon_start=1
FT                   /gene="HIST1H2BJ"
FT                   /locus_tag="hCG_1641457"
FT                   /product="histone 1, H2bj, isoform CRA_a"
FT                   /note="gene_id=hCG1641457.3 transcript_id=hCT2291734.0
FT                   protein_id=hCP1853047.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCJ2"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCJ2"
FT                   /protein_id="EAX03081.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSAK"
FT   gene            171137..173386
FT                   /gene="HIST1H2AG"
FT                   /locus_tag="hCG_1641458"
FT                   /note="gene_id=hCG1641458.3"
FT   mRNA            171137..173386
FT                   /gene="HIST1H2AG"
FT                   /locus_tag="hCG_1641458"
FT                   /product="histone 1, H2ag"
FT                   /note="gene_id=hCG1641458.3 transcript_id=hCT1641585.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             171171..171563
FT                   /codon_start=1
FT                   /gene="HIST1H2AG"
FT                   /locus_tag="hCG_1641458"
FT                   /product="histone 1, H2ag"
FT                   /note="gene_id=hCG1641458.3 transcript_id=hCT1641585.3
FT                   protein_id=hCP1626304.2"
FT                   /db_xref="GOA:A4FTV9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4FTV9"
FT                   /protein_id="EAX03083.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAKGK"
FT   gene            complement(175708..184997)
FT                   /gene="HIST1H2BK"
FT                   /locus_tag="hCG_2005139"
FT                   /note="gene_id=hCG2005139.1"
FT   mRNA            complement(join(175708..176780,184510..184997))
FT                   /gene="HIST1H2BK"
FT                   /locus_tag="hCG_2005139"
FT                   /product="histone 1, H2bk, transcript variant hCT2291732"
FT                   /note="gene_id=hCG2005139.1 transcript_id=hCT2291732.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 03-DEC-2003"
FT   gene            177401..178737
FT                   /gene="HIST1H4I"
FT                   /locus_tag="hCG_1642084"
FT                   /note="gene_id=hCG1642084.3"
FT   mRNA            177401..178737
FT                   /gene="HIST1H4I"
FT                   /locus_tag="hCG_1642084"
FT                   /product="histone 1, H4i"
FT                   /note="gene_id=hCG1642084.3 transcript_id=hCT1642211.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             177408..177719
FT                   /codon_start=1
FT                   /gene="HIST1H4I"
FT                   /locus_tag="hCG_1642084"
FT                   /product="histone 1, H4i"
FT                   /note="gene_id=hCG1642084.3 transcript_id=hCT1642211.3
FT                   protein_id=hCP1626258.1"
FT                   /db_xref="GOA:P62805"
FT                   /db_xref="HGNC:HGNC:20510"
FT                   /db_xref="HGNC:HGNC:29607"
FT                   /db_xref="HGNC:HGNC:4781"
FT                   /db_xref="HGNC:HGNC:4782"
FT                   /db_xref="HGNC:HGNC:4783"
FT                   /db_xref="HGNC:HGNC:4784"
FT                   /db_xref="HGNC:HGNC:4785"
FT                   /db_xref="HGNC:HGNC:4787"
FT                   /db_xref="HGNC:HGNC:4788"
FT                   /db_xref="HGNC:HGNC:4789"
FT                   /db_xref="HGNC:HGNC:4790"
FT                   /db_xref="HGNC:HGNC:4791"
FT                   /db_xref="HGNC:HGNC:4793"
FT                   /db_xref="HGNC:HGNC:4794"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="PDB:1ZKK"
FT                   /db_xref="PDB:2BQZ"
FT                   /db_xref="PDB:2CV5"
FT                   /db_xref="PDB:2IG0"
FT                   /db_xref="PDB:2KWN"
FT                   /db_xref="PDB:2KWO"
FT                   /db_xref="PDB:2LVM"
FT                   /db_xref="PDB:2QQS"
FT                   /db_xref="PDB:2RJE"
FT                   /db_xref="PDB:2RNY"
FT                   /db_xref="PDB:2RS9"
FT                   /db_xref="PDB:3A6N"
FT                   /db_xref="PDB:3AFA"
FT                   /db_xref="PDB:3AN2"
FT                   /db_xref="PDB:3AV1"
FT                   /db_xref="PDB:3AV2"
FT                   /db_xref="PDB:3AYW"
FT                   /db_xref="PDB:3AZE"
FT                   /db_xref="PDB:3AZF"
FT                   /db_xref="PDB:3AZG"
FT                   /db_xref="PDB:3AZH"
FT                   /db_xref="PDB:3AZI"
FT                   /db_xref="PDB:3AZJ"
FT                   /db_xref="PDB:3AZK"
FT                   /db_xref="PDB:3AZL"
FT                   /db_xref="PDB:3AZM"
FT                   /db_xref="PDB:3AZN"
FT                   /db_xref="PDB:3CFS"
FT                   /db_xref="PDB:3CFV"
FT                   /db_xref="PDB:3F9W"
FT                   /db_xref="PDB:3F9X"
FT                   /db_xref="PDB:3F9Y"
FT                   /db_xref="PDB:3F9Z"
FT                   /db_xref="PDB:3IJ1"
FT                   /db_xref="PDB:3JPX"
FT                   /db_xref="PDB:3NQJ"
FT                   /db_xref="PDB:3NQU"
FT                   /db_xref="PDB:3O36"
FT                   /db_xref="PDB:3QBY"
FT                   /db_xref="PDB:3QZS"
FT                   /db_xref="PDB:3QZT"
FT                   /db_xref="PDB:3QZV"
FT                   /db_xref="PDB:3R45"
FT                   /db_xref="PDB:3UVW"
FT                   /db_xref="PDB:3UVX"
FT                   /db_xref="PDB:3UVY"
FT                   /db_xref="PDB:3UW9"
FT                   /db_xref="PDB:3W96"
FT                   /db_xref="PDB:3W97"
FT                   /db_xref="PDB:3W98"
FT                   /db_xref="PDB:3W99"
FT                   /db_xref="PDB:3WA9"
FT                   /db_xref="PDB:3WAA"
FT                   /db_xref="PDB:3WKJ"
FT                   /db_xref="PDB:3WTP"
FT                   /db_xref="PDB:3X1S"
FT                   /db_xref="PDB:3X1T"
FT                   /db_xref="PDB:3X1U"
FT                   /db_xref="PDB:3X1V"
FT                   /db_xref="PDB:4GQB"
FT                   /db_xref="PDB:4H9N"
FT                   /db_xref="PDB:4H9O"
FT                   /db_xref="PDB:4H9P"
FT                   /db_xref="PDB:4H9Q"
FT                   /db_xref="PDB:4H9R"
FT                   /db_xref="PDB:4H9S"
FT                   /db_xref="PDB:4HGA"
FT                   /db_xref="PDB:4M38"
FT                   /db_xref="PDB:4N3W"
FT                   /db_xref="PDB:4N4F"
FT                   /db_xref="PDB:4QUT"
FT                   /db_xref="PDB:4QUU"
FT                   /db_xref="PDB:4QYD"
FT                   /db_xref="PDB:4U9W"
FT                   /db_xref="PDB:4YM5"
FT                   /db_xref="PDB:4YM6"
FT                   /db_xref="PDB:4YY6"
FT                   /db_xref="PDB:4YYD"
FT                   /db_xref="PDB:4YYG"
FT                   /db_xref="PDB:4YYH"
FT                   /db_xref="PDB:4YYI"
FT                   /db_xref="PDB:4YYJ"
FT                   /db_xref="PDB:4YYK"
FT                   /db_xref="PDB:4YYM"
FT                   /db_xref="PDB:4YYN"
FT                   /db_xref="PDB:4Z2M"
FT                   /db_xref="PDB:4Z5T"
FT                   /db_xref="PDB:5AV5"
FT                   /db_xref="PDB:5AV6"
FT                   /db_xref="PDB:5AV8"
FT                   /db_xref="PDB:5AV9"
FT                   /db_xref="PDB:5AVB"
FT                   /db_xref="PDB:5AVC"
FT                   /db_xref="PDB:5AY8"
FT                   /db_xref="PDB:5B0Y"
FT                   /db_xref="PDB:5B0Z"
FT                   /db_xref="PDB:5B24"
FT                   /db_xref="PDB:5B2I"
FT                   /db_xref="PDB:5B2J"
FT                   /db_xref="PDB:5B31"
FT                   /db_xref="PDB:5B32"
FT                   /db_xref="PDB:5B33"
FT                   /db_xref="PDB:5B40"
FT                   /db_xref="PDB:5BNV"
FT                   /db_xref="PDB:5BNX"
FT                   /db_xref="PDB:5BO0"
FT                   /db_xref="PDB:5C3I"
FT                   /db_xref="PDB:5CPI"
FT                   /db_xref="PDB:5CPJ"
FT                   /db_xref="PDB:5CPK"
FT                   /db_xref="PDB:5FA5"
FT                   /db_xref="PDB:5FFW"
FT                   /db_xref="PDB:5FWE"
FT                   /db_xref="PDB:5GSE"
FT                   /db_xref="PDB:5GSU"
FT                   /db_xref="PDB:5GT0"
FT                   /db_xref="PDB:5GT3"
FT                   /db_xref="PDB:5GTC"
FT                   /db_xref="PDB:5GXQ"
FT                   /db_xref="PDB:5JA4"
FT                   /db_xref="PDB:5JRG"
FT                   /db_xref="PDB:5KDM"
FT                   /db_xref="PDB:5TEG"
FT                   /db_xref="PDB:5X7X"
FT                   /db_xref="PDB:5XF3"
FT                   /db_xref="PDB:5XF4"
FT                   /db_xref="PDB:5XF5"
FT                   /db_xref="PDB:6BUZ"
FT                   /db_xref="PDB:6C0W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62805"
FT                   /protein_id="EAX03086.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG"
FT   mRNA            complement(184457..184997)
FT                   /gene="HIST1H2BK"
FT                   /locus_tag="hCG_2005139"
FT                   /product="histone 1, H2bk, transcript variant hCT2291731"
FT                   /note="gene_id=hCG2005139.1 transcript_id=hCT2291731.1;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(184519..184899)
FT                   /codon_start=1
FT                   /gene="HIST1H2BK"
FT                   /locus_tag="hCG_2005139"
FT                   /product="histone 1, H2bk, isoform CRA_a"
FT                   /note="gene_id=hCG2005139.1 transcript_id=hCT2291732.1
FT                   protein_id=hCP1853045.0 isoform=CRA_a"
FT                   /db_xref="GOA:O60814"
FT                   /db_xref="HGNC:HGNC:13954"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="PDB:2CV5"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60814"
FT                   /protein_id="EAX03084.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSAK"
FT   CDS             complement(184519..184899)
FT                   /codon_start=1
FT                   /gene="HIST1H2BK"
FT                   /locus_tag="hCG_2005139"
FT                   /product="histone 1, H2bk, isoform CRA_a"
FT                   /note="gene_id=hCG2005139.1 transcript_id=hCT2291731.1
FT                   protein_id=hCP1853046.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCL8"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCL8"
FT                   /protein_id="EAX03085.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSAK"
FT   gene            185219..185668
FT                   /gene="HIST1H2AH"
FT                   /locus_tag="hCG_1640359"
FT                   /note="gene_id=hCG1640359.3"
FT   mRNA            185219..185668
FT                   /gene="HIST1H2AH"
FT                   /locus_tag="hCG_1640359"
FT                   /product="histone 1, H2ah"
FT                   /note="gene_id=hCG1640359.3 transcript_id=hCT1640486.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             185230..185616
FT                   /codon_start=1
FT                   /gene="HIST1H2AH"
FT                   /locus_tag="hCG_1640359"
FT                   /product="histone 1, H2ah"
FT                   /note="gene_id=hCG1640359.3 transcript_id=hCT1640486.2
FT                   protein_id=hCP1626298.0"
FT                   /db_xref="GOA:A3KPC7"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A3KPC7"
FT                   /protein_id="EAX03087.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAK"
FT   gene            249329..250021
FT                   /pseudo
FT                   /locus_tag="hCG_25307"
FT                   /note="gene_id=hCG25307.4"
FT   mRNA            249329..250021
FT                   /pseudo
FT                   /locus_tag="hCG_25307"
FT                   /note="gene_id=hCG25307.4 transcript_id=hCT16432.5; overlap
FT                   evidence=no; created on 27-JAN-2004"
FT   gene            285836..294732
FT                   /gene="PRSS16"
FT                   /locus_tag="hCG_22449"
FT                   /note="gene_id=hCG22449.3"
FT   mRNA            join(285836..285920,285995..286161,286960..287059,
FT                   287213..287342,288733..288937,289155..289232,
FT                   289330..289377,289863..290153,290921..291062,
FT                   292806..292985,293099..293244,293360..294732)
FT                   /gene="PRSS16"
FT                   /locus_tag="hCG_22449"
FT                   /product="protease, serine, 16 (thymus), transcript variant
FT                   hCT1966708"
FT                   /note="gene_id=hCG22449.3 transcript_id=hCT1966708.0;
FT                   splice donor-acceptor pairs covered / total pairs = 9/11;
FT                   created on 26-AUG-2002"
FT   mRNA            join(285836..285920,285995..286161,286960..287059,
FT                   287213..287342,288796..288919,289155..289232,
FT                   289330..289377,289863..290153,290921..291062,
FT                   292806..292985,293099..293244,293360..294732)
FT                   /gene="PRSS16"
FT                   /locus_tag="hCG_22449"
FT                   /product="protease, serine, 16 (thymus), transcript variant
FT                   hCT13546"
FT                   /note="gene_id=hCG22449.3 transcript_id=hCT13546.1; splice
FT                   donor-acceptor pairs covered / total pairs = 11/11; created
FT                   on 26-AUG-2002"
FT   CDS             join(285851..285920,285995..286161,286960..287059,
FT                   287213..287342,288733..288937,289155..289232,
FT                   289330..289377,289863..290153,290921..291062,
FT                   292806..292985,293099..293244,293360..293428)
FT                   /codon_start=1
FT                   /gene="PRSS16"
FT                   /locus_tag="hCG_22449"
FT                   /product="protease, serine, 16 (thymus), isoform CRA_b"
FT                   /note="gene_id=hCG22449.3 transcript_id=hCT1966708.0
FT                   protein_id=hCP1780693.0 isoform=CRA_b"
FT                   /protein_id="EAX03089.1"
FT                   /translation="MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGL
FT                   GLSLGPGAAALPKVGWLEQLLDPFNVSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGS
FT                   LGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPAGGLEMAQLRFLSSRLAMGKSSGI
FT                   PSDEDRPSPPFDPRLADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKVLRL
FT                   LRFPHLIFASVASSAPVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAEVERR
FT                   LRSGGAAQAALRTELSACGPLGRAENQAELLGALQALVGGVVQYDGQTGAPLSVRQLCG
FT                   LLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
FT                   WLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG
FT                   QTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLG
FT                   RQNIFQQLQTWLKLAKESQIKGEV"
FT   CDS             join(285851..285920,285995..286161,286960..287059,
FT                   287213..287342,288796..288919,289155..289232,
FT                   289330..289377,289863..290153,290921..291062,
FT                   292806..292985,293099..293244,293360..293428)
FT                   /codon_start=1
FT                   /gene="PRSS16"
FT                   /locus_tag="hCG_22449"
FT                   /product="protease, serine, 16 (thymus), isoform CRA_a"
FT                   /note="gene_id=hCG22449.3 transcript_id=hCT13546.1
FT                   protein_id=hCP42275.1 isoform=CRA_a"
FT                   /protein_id="EAX03088.1"
FT                   /translation="MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGL
FT                   GLSLGPGAAALPKVGWLEQLLDPFNVSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGS
FT                   LGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPAGGLEMAQLRFLSSRLALADVVSA
FT                   RLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPHLIFASVASSAPVRAVLDFSEYN
FT                   DVVSRSLMSTAIGGSLECRAAVSVAFAEVERRLRSGGAAQAALRTELSACGPLGRAENQ
FT                   AELLGALQALVGGVVQYDGQTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLH
FT                   SLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPA
FT                   LPSQLDLCEQVFGLSALSVAQAVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQAL
FT                   GSSESTLLIRTGSHCLDMAPERPSDSPSLRLGRQNIFQQLQTWLKLAKESQIKGEV"
FT   gene            complement(294843..295087)
FT                   /pseudo
FT                   /locus_tag="hCG_1820929"
FT                   /note="gene_id=hCG1820929.2"
FT   mRNA            complement(294843..295087)
FT                   /pseudo
FT                   /locus_tag="hCG_1820929"
FT                   /note="gene_id=hCG1820929.2 transcript_id=hCT1971399.1;
FT                   overlap evidence=no; created on 29-JAN-2004"
FT   gene            complement(346763..350554)
FT                   /locus_tag="hCG_1647683"
FT                   /note="gene_id=hCG1647683.3"
FT   mRNA            complement(join(346763..349005,349198..350554))
FT                   /locus_tag="hCG_1647683"
FT                   /product="hCG1647683"
FT                   /note="gene_id=hCG1647683.3 transcript_id=hCT1647810.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(347164..349005,349198..350271))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1647683"
FT                   /product="hCG1647683"
FT                   /note="gene_id=hCG1647683.3 transcript_id=hCT1647810.2
FT                   protein_id=hCP1626307.2"
FT                   /protein_id="EAX03090.1"
FT                   /translation="MGSFLSKLELSPSSPAQVRTDLPERPTKRRPPQPLHQVHRVQFVH
FT                   RAHPAPRYRPVRRRPNLDPANPTTWLANEAWRRFPMKKSQNSPLGPLPSDWWESYLKRT
FT                   IWSLRHPRPIWSPVTIRITPPDQRVPPSTSPEDVIALAGLPPSEELADPCSKETVLRAL
FT                   RECRKGKGRLEEPLFPESLDSKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSLHSW
FT                   GSDHSLTKRPNCSSMSSLASIYRGGTLSSKRNAIGSSYSSCRNFSDPWKRSVPSVSFET
FT                   PEWPIKKEKSCHRPSSPVPLVSDFESLGGSESSGQQNQKIPQLPSSPENLVSEIPPPQL
FT                   GYAVSDENLTLGKKAELQSTGEATSVAHSPLKTPSLPTPPGCSQSELLPGTSPDSKPTA
FT                   TFILLTPTSPTLPVTDTTWPPSTSQADRSPMPPDPPAPPTIQSTLLGMVSSPTSHLSAS
FT                   APPDATSAHLMLKPILGPLHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIF
FT                   GSIDPLKTTPMIAPFSSKQTPPPFTHASTHHFHGLVKATSVVMSTTLASTSKDSVFKPP
FT                   LDFGVVNVTSAVGNTYSVPSTCDTFLLGTAQAFRADFTPATGFIFPPHHHPTIPTVHTV
FT                   TMFTQVLSSVVQISPRSSTANFRGMGSPLPASALVSTNWLASTPSISNLTPAITSPLGS
FT                   SSRPPFPLSQGANPQPAFGATNGQKQGPSQPALMPSVSSSFLFGSSAVALPTPMPTPAQ
FT                   PAFISTTQSALGCLTPSASTSQTPASTWSGIGSIPAGFPISQASTTGFRIVIQTHQSGA
FT                   FGSVFGSRAPQPFTFGGFVTPMDCDESGIIMTGPDMSPTSGAFSIGALPSGTTNTMIPF
FT                   GKGWSQNTEGLPSHRTAFSLGRGSISARKTMAPIAQNTPVPGQAKAGSSVGFGMPFPPA
FT                   QGSVGRGPFRSSASSFSIGAKSKTPKNREKGHSRRHHAYKK"
FT   gene            362895..364076
FT                   /gene="FKSG83"
FT                   /locus_tag="hCG_1820928"
FT                   /note="gene_id=hCG1820928.1"
FT   mRNA            join(362895..362926,362947..>363962)
FT                   /gene="FKSG83"
FT                   /locus_tag="hCG_1820928"
FT                   /product="FKSG83, transcript variant hCT2281544"
FT                   /note="gene_id=hCG1820928.1 transcript_id=hCT2281544.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   mRNA            362912..364076
FT                   /gene="FKSG83"
FT                   /locus_tag="hCG_1820928"
FT                   /product="FKSG83, transcript variant hCT1971398"
FT                   /note="gene_id=hCG1820928.1 transcript_id=hCT1971398.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             363396..363965
FT                   /codon_start=1
FT                   /gene="FKSG83"
FT                   /locus_tag="hCG_1820928"
FT                   /product="FKSG83, isoform CRA_a"
FT                   /note="gene_id=hCG1820928.1 transcript_id=hCT1971398.0
FT                   protein_id=hCP1783987.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3KNW7"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KNW7"
FT                   /protein_id="EAX03091.1"
FT                   /translation="MWVIISTVATSKSTNVGLVYSLIYCKTRLFIYYHAMIFQSAMFTQ
FT                   GFLFLFLMIWTSFYMVTIFLRHQKTVFHIHSISLSPQSFPETEASHVFFLLVSRFVFFY
FT                   GTNVCLSTYISSMYENSLILENITSFVSSSYPIICTLILINYDNKVSRLTCAILNMIIS
FT                   PCLPHSFLLHQRNPDKNYFNHKRMCF"
FT   CDS             363396..>363962
FT                   /codon_start=1
FT                   /gene="FKSG83"
FT                   /locus_tag="hCG_1820928"
FT                   /product="FKSG83, isoform CRA_b"
FT                   /note="gene_id=hCG1820928.1 transcript_id=hCT2281544.0
FT                   protein_id=hCP1853082.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3KNW7"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KNW7"
FT                   /protein_id="EAX03092.1"
FT                   /translation="MWVIISTVATSKSTNVGLVYSLIYCKTRLFIYYHAMIFQSAMFTQ
FT                   GFLFLFLMIWTSFYMVTIFLRHQKTVFHIHSISLSPQSFPETEASHVFFLLVSRFVFFY
FT                   GTNVCLSTYISSMYENSLILENITSFVSSSYPIICTLILINYDNKVSRLTCAILNMIIS
FT                   PCLPHSFLLHQRNPDKNYFNHKRMCF"
FT   gene            complement(395936..>413364)
FT                   /locus_tag="hCG_2040278"
FT                   /note="gene_id=hCG2040278.1"
FT   mRNA            complement(join(395936..398333,401291..401414,
FT                   405629..405724,408248..409637))
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, transcript variant hCT2358737"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2358737.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   mRNA            complement(join(<396851..398333,401291..401414,
FT                   405629..405724,408248..408336,413317..>413364))
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, transcript variant hCT2345488"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2345488.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 18-JUN-2003"
FT   CDS             complement(396851..>397726)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, isoform CRA_c"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2345488.0
FT                   protein_id=hCP1912580.0 isoform=CRA_c"
FT                   /protein_id="EAX03095.1"
FT                   /translation="FLINTREFTVERNLMRVLNVARHSVVVHTLLSIKEFTLVRSPIHV
FT                   LNVERLLVRTHILLYIRESILERNLMNAMNVVGPLVRVHILLNIKECIQEKNSMNVMNV
FT                   RKPSMITQLLFNIILSILQRNPMNIMTGKTFSYCSDLIQHQRMHTGEKPYKCNECGNAF
FT                   SDCSSLIQHQRTHTGEEPYECKQCGKAFSRSTYLTQHQRSHAGEKQYKCNECEKTFSLS
FT                   SFLTQHMRVQTGEKPYKYNEYGKAFSDCSGHFQRTHTGEKPCECNDCGKPFSFCSALIQ
FT                   HKRIHTRKKP"
FT   CDS             complement(396851..397684)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, isoform CRA_a"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2358737.0
FT                   protein_id=hCP1924021.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5DTE4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DTE4"
FT                   /protein_id="EAX03093.1"
FT                   /translation="MRVLNVARHSVVVHTLLSIKEFTLVRSPIHVLNVERLLVRTHILL
FT                   YIRESILERNLMNAMNVVGPLVRVHILLNIKECIQEKNSMNVMNVRKPSMITQLLFNII
FT                   LSILQRNPMNIMTGKTFSYCSDLIQHQRMHTGEKPYKCNECGNAFSDCSSLIQHQRTHT
FT                   GEEPYECKQCGKAFSRSTYLTQHQRSHAGEKQYKCNECEKTFSLSSFLTQHMRVQTGEK
FT                   PYKYNEYGKAFSDCSGHFQRTHTGEKPCECNDCGKPFSFCSALIQHKRIHTRKKP"
FT   mRNA            complement(join(398061..398333,401291..401414,
FT                   408248..408336,413317..413340))
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, transcript variant hCT2358738"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2358738.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(398266..398333,401291..401414,
FT                   408248..408280))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040278"
FT                   /product="hCG2040278, isoform CRA_b"
FT                   /note="gene_id=hCG2040278.1 transcript_id=hCT2358738.0
FT                   protein_id=hCP1924022.0 isoform=CRA_b"
FT                   /protein_id="EAX03094.1"
FT                   /translation="MTARPFMAGFRLPKTLEEVAMDITWEKWKQMDTVQKSIYRNMLEK
FT                   YRNLVLLDGKLERGAKTSRVEQQDISKED"
FT   gene            412755..439661
FT                   /locus_tag="hCG_1642085"
FT                   /note="gene_id=hCG1642085.3"
FT   mRNA            join(412755..413260,433111..433189,437535..437643,
FT                   438386..439661)
FT                   /locus_tag="hCG_1642085"
FT                   /product="hCG1642085, transcript variant hCT1642212"
FT                   /note="gene_id=hCG1642085.3 transcript_id=hCT1642212.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   gene            426485..>427303
FT                   /gene="LOC441136"
FT                   /locus_tag="hCG_1814774"
FT                   /note="gene_id=hCG1814774.1"
FT   mRNA            426485..>427303
FT                   /gene="LOC441136"
FT                   /locus_tag="hCG_1814774"
FT                   /product="hypothetical gene supported by AK092633"
FT                   /note="gene_id=hCG1814774.1 transcript_id=hCT1814775.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             426930..>427303
FT                   /codon_start=1
FT                   /gene="LOC441136"
FT                   /locus_tag="hCG_1814774"
FT                   /product="hypothetical gene supported by AK092633"
FT                   /note="gene_id=hCG1814774.1 transcript_id=hCT1814775.1
FT                   protein_id=hCP1768844.1"
FT                   /protein_id="EAX03098.1"
FT                   /translation="MISSSLSGRVPVILGNLMGVGAAVRRMGFSLILPTSPSPAHSGSA
FT                   PSAGPARGVSGVLGRRRPVSEAYRAPGPRWVLLEVLESGNTGSSRETGERVAGGLAAGR
FT                   VRRHLHGWDAAWRGVMKPPAL"
FT   mRNA            join(<436430..436498,438386..439661)
FT                   /locus_tag="hCG_1642085"
FT                   /product="hCG1642085, transcript variant hCT2281548"
FT                   /note="gene_id=hCG1642085.3 transcript_id=hCT2281548.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(436430..436498,438386..439540)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642085"
FT                   /product="hCG1642085, isoform CRA_b"
FT                   /note="gene_id=hCG1642085.3 transcript_id=hCT2281548.0
FT                   protein_id=hCP1853092.0 isoform=CRA_b"
FT                   /protein_id="EAX03097.1"
FT                   /translation="MGKKKRHRFPDLPIFLTKAAGARIGGFELNQSINTNQTVSEELEF
FT                   SGSAMESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFT
FT                   GEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNEC
FT                   EKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKA
FT                   FSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYKCNECGKAFGD
FT                   RSTIIQHQRIHTGENPYECSKCGKAFSWISSLTEHQRTHTGENPYECSECGKVFSRSSS
FT                   LTEHQRIHSGEKPHECRVCGKGFSRSSSLIIHQRTHTGEKPYKCNDCGKAFCQSSTLIR
FT                   HQHLHTKE"
FT   CDS             438464..439540
FT                   /codon_start=1
FT                   /locus_tag="hCG_1642085"
FT                   /product="hCG1642085, isoform CRA_a"
FT                   /note="gene_id=hCG1642085.3 transcript_id=hCT1642212.3
FT                   protein_id=hCP1626261.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9UJN7"
FT                   /db_xref="HGNC:HGNC:18779"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UJN7"
FT                   /protein_id="EAX03096.1"
FT                   /translation="MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRK
FT                   VSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFS
FT                   QRKPCKCNECEKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEK
FT                   PYECNECGKAFSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQRTHTQERPYK
FT                   CNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFSWISSLTEHQRTHTGENPYECSE
FT                   CGKVFSRSSSLTEHQRIHSGEKPHECRVCGKGFSRSSSLIIHQRTHTGEKPYKCNDCGK
FT                   AFCQSSTLIRHQHLHTKE"
FT   gene            445818..446605
FT                   /pseudo
FT                   /locus_tag="hCG_1641460"
FT                   /note="gene_id=hCG1641460.2"
FT   mRNA            445818..446605
FT                   /pseudo
FT                   /locus_tag="hCG_1641460"
FT                   /note="gene_id=hCG1641460.2 transcript_id=hCT1641587.3;
FT                   overlap evidence=yes; created on 28-JAN-2004"
FT   gene            complement(488879..511247)
FT                   /gene="ZNF184"
FT                   /locus_tag="hCG_25305"
FT                   /note="gene_id=hCG25305.4"
FT   mRNA            complement(join(488879..491396,494963..495058,
FT                   495420..495546,505987..506054,510430..510575,
FT                   511115..511242))
FT                   /gene="ZNF184"
FT                   /locus_tag="hCG_25305"
FT                   /product="zinc finger protein 184 (Kruppel-like),
FT                   transcript variant hCT1954724"
FT                   /note="gene_id=hCG25305.4 transcript_id=hCT1954724.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(488957..491396,494963..495058,
FT                   495420..495546,505987..506054,510430..511247))
FT                   /gene="ZNF184"
FT                   /locus_tag="hCG_25305"
FT                   /product="zinc finger protein 184 (Kruppel-like),
FT                   transcript variant hCT2358773"
FT                   /note="gene_id=hCG25305.4 transcript_id=hCT2358773.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   CDS             complement(join(489439..491396,494963..495058,
FT                   495420..495546,505987..506054,510430..510436))
FT                   /codon_start=1
FT                   /gene="ZNF184"
FT                   /locus_tag="hCG_25305"
FT                   /product="zinc finger protein 184 (Kruppel-like), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25305.4 transcript_id=hCT1954724.1
FT                   protein_id=hCP1765555.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCM2"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCM2"
FT                   /protein_id="EAX03099.1"
FT                   /translation="MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQL
FT                   DPGQRDLFRDVTLENYTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETR
FT                   LENSVSAPEPDISEEELSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKE
FT                   IKVTEKTIPSWEKGPVNNEFGKSVNVSSNLVTQEPSPEETSTKRSIKQNSNPVKKEKSC
FT                   KCNECGKAFSYCSALIRHQRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCD
FT                   QCGKGFIEGPSLTQHQRIHTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECG
FT                   KAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAF
FT                   NGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYW
FT                   SSLAQHLKIHTGEKPYKCNECGKAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNL
FT                   NQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQH
FT                   RKIHTGERPYKCNECGRAFNQNIHLTQHKRIHTGAKPYECAECGKAFRHCSSLAQHQKT
FT                   HTEEKPYQCNKCEKTFSQSSHLTQHQRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTG
FT                   EKPYNCNECRKTFSQSTYLIQHQRIHSGEKPFGCNDCGKSFRYRSALNKHQRLHPGI"
FT   CDS             complement(join(489439..491396,494963..495058,
FT                   495420..495546,505987..506054,510430..510436))
FT                   /codon_start=1
FT                   /gene="ZNF184"
FT                   /locus_tag="hCG_25305"
FT                   /product="zinc finger protein 184 (Kruppel-like), isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25305.4 transcript_id=hCT2358773.0
FT                   protein_id=hCP1924032.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCM2"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCM2"
FT                   /protein_id="EAX03100.1"
FT                   /translation="MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQL
FT                   DPGQRDLFRDVTLENYTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETR
FT                   LENSVSAPEPDISEEELSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKE
FT                   IKVTEKTIPSWEKGPVNNEFGKSVNVSSNLVTQEPSPEETSTKRSIKQNSNPVKKEKSC
FT                   KCNECGKAFSYCSALIRHQRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCD
FT                   QCGKGFIEGPSLTQHQRIHTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECG
FT                   KAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAF
FT                   NGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYW
FT                   SSLAQHLKIHTGEKPYKCNECGKAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNL
FT                   NQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQH
FT                   RKIHTGERPYKCNECGRAFNQNIHLTQHKRIHTGAKPYECAECGKAFRHCSSLAQHQKT
FT                   HTEEKPYQCNKCEKTFSQSSHLTQHQRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTG
FT                   EKPYNCNECRKTFSQSTYLIQHQRIHSGEKPFGCNDCGKSFRYRSALNKHQRLHPGI"
FT   gene            complement(529542..557510)
FT                   /locus_tag="hCG_1651199"
FT                   /note="gene_id=hCG1651199.3"
FT   mRNA            complement(join(529542..529754,531344..531454,
FT                   534128..534239,557462..557510))
FT                   /locus_tag="hCG_1651199"
FT                   /product="hCG1651199"
FT                   /note="gene_id=hCG1651199.3 transcript_id=hCT1651326.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(529748..529754,531344..531454,
FT                   534128..534225))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1651199"
FT                   /product="hCG1651199"
FT                   /note="gene_id=hCG1651199.3 transcript_id=hCT1651326.3
FT                   protein_id=hCP1626257.2"
FT                   /protein_id="EAX03101.1"
FT                   /translation="MLGSLARWEPSGSRGLNERGIWTSQVKKFAPLWNCSQNNLEEIVS
FT                   IEAVVVPTIKKVGTQDAFTRIVHFRE"
FT   gene            561584..562421
FT                   /pseudo
FT                   /locus_tag="hCG_1794453"
FT                   /note="gene_id=hCG1794453.3"
FT   mRNA            561584..562421
FT                   /pseudo
FT                   /locus_tag="hCG_1794453"
FT                   /note="gene_id=hCG1794453.3 transcript_id=hCT1833713.3;
FT                   overlap evidence=no; created on 05-SEP-2003"
FT   gene            complement(595959..>601452)
FT                   /locus_tag="hCG_1656033"
FT                   /note="gene_id=hCG1656033.3"
FT   mRNA            complement(join(595959..596204,599535..599752,
FT                   599774..599855,601295..>601452))
FT                   /locus_tag="hCG_1656033"
FT                   /product="hCG1656033"
FT                   /note="gene_id=hCG1656033.3 transcript_id=hCT1656160.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(599621..599752,599774..599855,
FT                   601295..601452))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1656033"
FT                   /product="hCG1656033"
FT                   /note="gene_id=hCG1656033.3 transcript_id=hCT1656160.2
FT                   protein_id=hCP1626323.2"
FT                   /protein_id="EAX03102.1"
FT                   /translation="MPGTGIAGNTAGLWSTRRYLSSISHPPQTEEPFPRTVSDNGPDHL
FT                   MAGNLDLSLAPATWEVQVACSEDVDLPCTVPSEPQVKLLEGGEERVQAPQEDLRLRGQR
FT                   YHQKGQNGSSGVPVKDPIP"
FT   gene            <723434..748335
FT                   /locus_tag="hCG_1797467"
FT                   /note="gene_id=hCG1797467.2"
FT   mRNA            join(<723434..723472,724035..724189,726453..726490,
FT                   732044..732618,740426..740529,745452..745529,
FT                   748237..748335)
FT                   /locus_tag="hCG_1797467"
FT                   /product="hCG1797467"
FT                   /note="gene_id=hCG1797467.2 transcript_id=hCT1836727.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(723434..723472,724035..724189,726453..726490,
FT                   732044..732333)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1797467"
FT                   /product="hCG1797467"
FT                   /note="gene_id=hCG1797467.2 transcript_id=hCT1836727.2
FT                   protein_id=hCP1712904.2"
FT                   /protein_id="EAX03103.1"
FT                   /translation="MDTARLIIGSGGQSCSPHPLTDADFESVPNELPAHKSPSQCLFPR
FT                   ELTDDKKQVTDAYGGLLRSKLNFAPRKRICEFEGKVRRVKGTWSINSWNKRQRHGNLRG
FT                   FQSGPGNDARGCKPFCPFLLPLKLTVSGRVFLEVGFRDRGDQRPELLCPKGIARFFDAD
FT                   RKGLAPEPTT"
FT   gene            complement(775086..776421)
FT                   /pseudo
FT                   /locus_tag="hCG_1792308"
FT                   /note="gene_id=hCG1792308.3"
FT   mRNA            complement(775086..776421)
FT                   /pseudo
FT                   /locus_tag="hCG_1792308"
FT                   /note="gene_id=hCG1792308.3 transcript_id=hCT1831568.3;
FT                   overlap evidence=yes; created on 05-SEP-2003"
FT   gene            795576..801412
FT                   /locus_tag="hCG_1820927"
FT                   /note="gene_id=hCG1820927.2"
FT   mRNA            join(795576..795886,799870..801412)
FT                   /locus_tag="hCG_1820927"
FT                   /product="hCG1820927, transcript variant hCT1971397"
FT                   /note="gene_id=hCG1820927.2 transcript_id=hCT1971397.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 03-DEC-2003"
FT   mRNA            join(795576..795886,799870..799986,800447..800508,
FT                   800665..801412)
FT                   /locus_tag="hCG_1820927"
FT                   /product="hCG1820927, transcript variant hCT2281556"
FT                   /note="gene_id=hCG1820927.2 transcript_id=hCT2281556.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 03-DEC-2003"
FT   CDS             join(799912..799986,800447..800508,800665..800782)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820927"
FT                   /product="hCG1820927, isoform CRA_b"
FT                   /note="gene_id=hCG1820927.2 transcript_id=hCT2281556.1
FT                   protein_id=hCP1853077.1 isoform=CRA_b"
FT                   /protein_id="EAX03105.1"
FT                   /translation="MKMSNRVSDTLQKHQRRSSFPWPSQPNLPLPLSPGDDNGWGLDLP
FT                   RSGNGEGTGSPNLDCLGLTLAWKVWAQDSELKSVCSPNP"
FT   CDS             799912..800256
FT                   /codon_start=1
FT                   /locus_tag="hCG_1820927"
FT                   /product="hCG1820927, isoform CRA_a"
FT                   /note="gene_id=hCG1820927.2 transcript_id=hCT1971397.1
FT                   protein_id=hCP1783985.2 isoform=CRA_a"
FT                   /protein_id="EAX03104.1"
FT                   /translation="MKMSNRVSDTLQKHQRRSSFPWPSQVLQGHSLAHSSPSHFLSFFS
FT                   FLFFSFLFFFFFFFFLRQSLALSPRLECSGAISAHCKLRLPGSRHSPASASRSWDYRHP
FT                   PPRSANFLYF"
FT   gene            complement(818783..819274)
FT                   /pseudo
FT                   /locus_tag="hCG_1640360"
FT                   /note="gene_id=hCG1640360.4"
FT   mRNA            complement(818783..819274)
FT                   /pseudo
FT                   /locus_tag="hCG_1640360"
FT                   /note="gene_id=hCG1640360.4 transcript_id=hCT1640487.4;
FT                   overlap evidence=no; created on 22-JAN-2004"
FT   gene            845181..845474
FT                   /pseudo
FT                   /locus_tag="hCG_2043354"
FT                   /note="gene_id=hCG2043354.0"
FT   mRNA            845181..845474
FT                   /pseudo
FT                   /locus_tag="hCG_2043354"
FT                   /note="gene_id=hCG2043354.0 transcript_id=hCT2350141.0;
FT                   overlap evidence=no; created on 03-DEC-2003"
FT   gene            complement(845616..846068)
FT                   /gene="HIST1H2BL"
FT                   /locus_tag="hCG_1640462"
FT                   /note="gene_id=hCG1640462.3"
FT   mRNA            complement(845616..846068)
FT                   /gene="HIST1H2BL"
FT                   /locus_tag="hCG_1640462"
FT                   /product="histone 1, H2bl"
FT                   /note="gene_id=hCG1640462.3 transcript_id=hCT1640589.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(845663..846043)
FT                   /codon_start=1
FT                   /gene="HIST1H2BL"
FT                   /locus_tag="hCG_1640462"
FT                   /product="histone 1, H2bl"
FT                   /note="gene_id=hCG1640462.3 transcript_id=hCT1640589.3
FT                   protein_id=hCP1626252.2"
FT                   /protein_id="EAX03106.1"
FT                   /translation="MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   gene            846310..847219
FT                   /gene="HIST1H2AI"
FT                   /locus_tag="hCG_1640463"
FT                   /note="gene_id=hCG1640463.3"
FT   mRNA            846310..847219
FT                   /gene="HIST1H2AI"
FT                   /locus_tag="hCG_1640463"
FT                   /product="histone 1, H2ai"
FT                   /note="gene_id=hCG1640463.3 transcript_id=hCT1640590.3;
FT                   overlap evidence=yes; created on 08-DEC-2003"
FT   CDS             846347..846739
FT                   /codon_start=1
FT                   /gene="HIST1H2AI"
FT                   /locus_tag="hCG_1640463"
FT                   /product="histone 1, H2ai"
FT                   /note="gene_id=hCG1640463.3 transcript_id=hCT1640590.3
FT                   protein_id=hCP1626268.0"
FT                   /db_xref="GOA:A4FTV9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4FTV9"
FT                   /protein_id="EAX03107.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAKGK"
FT   gene            848075..849437
FT                   /gene="HIST1H3H"
FT                   /locus_tag="hCG_1640464"
FT                   /note="gene_id=hCG1640464.3"
FT   mRNA            848075..849437
FT                   /gene="HIST1H3H"
FT                   /locus_tag="hCG_1640464"
FT                   /product="histone 1, H3h"
FT                   /note="gene_id=hCG1640464.3 transcript_id=hCT1640591.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             848211..848621
FT                   /codon_start=1
FT                   /gene="HIST1H3H"
FT                   /locus_tag="hCG_1640464"
FT                   /product="histone 1, H3h"
FT                   /note="gene_id=hCG1640464.3 transcript_id=hCT1640591.2
FT                   protein_id=hCP1626272.2"
FT                   /protein_id="EAX03108.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
FT                   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   gene            complement(852439..852889)
FT                   /gene="HIST1H2AJ"
FT                   /locus_tag="hCG_1643194"
FT                   /note="gene_id=hCG1643194.3"
FT   mRNA            complement(852439..852889)
FT                   /gene="HIST1H2AJ"
FT                   /locus_tag="hCG_1643194"
FT                   /product="histone 1, H2aj"
FT                   /note="gene_id=hCG1643194.3 transcript_id=hCT1643321.3;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(852491..852877)
FT                   /codon_start=1
FT                   /gene="HIST1H2AJ"
FT                   /locus_tag="hCG_1643194"
FT                   /product="histone 1, H2aj"
FT                   /note="gene_id=hCG1643194.3 transcript_id=hCT1643321.3
FT                   protein_id=hCP1626264.0"
FT                   /db_xref="GOA:Q99878"
FT                   /db_xref="HGNC:HGNC:4727"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99878"
FT                   /protein_id="EAX03109.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKTK"
FT   gene            853159..853626
FT                   /gene="HIST1H2BM"
FT                   /locus_tag="hCG_1640465"
FT                   /note="gene_id=hCG1640465.2"
FT   mRNA            853159..853626
FT                   /gene="HIST1H2BM"
FT                   /locus_tag="hCG_1640465"
FT                   /product="histone 1, H2bm"
FT                   /note="gene_id=hCG1640465.2 transcript_id=hCT1640592.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             853181..853561
FT                   /codon_start=1
FT                   /gene="HIST1H2BM"
FT                   /locus_tag="hCG_1640465"
FT                   /product="histone 1, H2bm"
FT                   /note="gene_id=hCG1640465.2 transcript_id=hCT1640592.2
FT                   protein_id=hCP1626290.1"
FT                   /protein_id="EAX03110.1"
FT                   /translation="MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   gene            862238..862629
FT                   /gene="HIST1H4J"
FT                   /locus_tag="hCG_1743052"
FT                   /note="gene_id=hCG1743052.1"
FT   mRNA            862238..862629
FT                   /gene="HIST1H4J"
FT                   /locus_tag="hCG_1743052"
FT                   /product="histone 1, H4j"
FT                   /note="gene_id=hCG1743052.1 transcript_id=hCT1781241.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             862260..862571
FT                   /codon_start=1
FT                   /gene="HIST1H4J"
FT                   /locus_tag="hCG_1743052"
FT                   /product="histone 1, H4j"
FT                   /note="gene_id=hCG1743052.1 transcript_id=hCT1781241.2
FT                   protein_id=hCP1712963.0"
FT                   /db_xref="GOA:P62805"
FT                   /db_xref="HGNC:HGNC:20510"
FT                   /db_xref="HGNC:HGNC:29607"
FT                   /db_xref="HGNC:HGNC:4781"
FT                   /db_xref="HGNC:HGNC:4782"
FT                   /db_xref="HGNC:HGNC:4783"
FT                   /db_xref="HGNC:HGNC:4784"
FT                   /db_xref="HGNC:HGNC:4785"
FT                   /db_xref="HGNC:HGNC:4787"
FT                   /db_xref="HGNC:HGNC:4788"
FT                   /db_xref="HGNC:HGNC:4789"
FT                   /db_xref="HGNC:HGNC:4790"
FT                   /db_xref="HGNC:HGNC:4791"
FT                   /db_xref="HGNC:HGNC:4793"
FT                   /db_xref="HGNC:HGNC:4794"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="PDB:1ZKK"
FT                   /db_xref="PDB:2BQZ"
FT                   /db_xref="PDB:2CV5"
FT                   /db_xref="PDB:2IG0"
FT                   /db_xref="PDB:2KWN"
FT                   /db_xref="PDB:2KWO"
FT                   /db_xref="PDB:2LVM"
FT                   /db_xref="PDB:2QQS"
FT                   /db_xref="PDB:2RJE"
FT                   /db_xref="PDB:2RNY"
FT                   /db_xref="PDB:2RS9"
FT                   /db_xref="PDB:3A6N"
FT                   /db_xref="PDB:3AFA"
FT                   /db_xref="PDB:3AN2"
FT                   /db_xref="PDB:3AV1"
FT                   /db_xref="PDB:3AV2"
FT                   /db_xref="PDB:3AYW"
FT                   /db_xref="PDB:3AZE"
FT                   /db_xref="PDB:3AZF"
FT                   /db_xref="PDB:3AZG"
FT                   /db_xref="PDB:3AZH"
FT                   /db_xref="PDB:3AZI"
FT                   /db_xref="PDB:3AZJ"
FT                   /db_xref="PDB:3AZK"
FT                   /db_xref="PDB:3AZL"
FT                   /db_xref="PDB:3AZM"
FT                   /db_xref="PDB:3AZN"
FT                   /db_xref="PDB:3CFS"
FT                   /db_xref="PDB:3CFV"
FT                   /db_xref="PDB:3F9W"
FT                   /db_xref="PDB:3F9X"
FT                   /db_xref="PDB:3F9Y"
FT                   /db_xref="PDB:3F9Z"
FT                   /db_xref="PDB:3IJ1"
FT                   /db_xref="PDB:3JPX"
FT                   /db_xref="PDB:3NQJ"
FT                   /db_xref="PDB:3NQU"
FT                   /db_xref="PDB:3O36"
FT                   /db_xref="PDB:3QBY"
FT                   /db_xref="PDB:3QZS"
FT                   /db_xref="PDB:3QZT"
FT                   /db_xref="PDB:3QZV"
FT                   /db_xref="PDB:3R45"
FT                   /db_xref="PDB:3UVW"
FT                   /db_xref="PDB:3UVX"
FT                   /db_xref="PDB:3UVY"
FT                   /db_xref="PDB:3UW9"
FT                   /db_xref="PDB:3W96"
FT                   /db_xref="PDB:3W97"
FT                   /db_xref="PDB:3W98"
FT                   /db_xref="PDB:3W99"
FT                   /db_xref="PDB:3WA9"
FT                   /db_xref="PDB:3WAA"
FT                   /db_xref="PDB:3WKJ"
FT                   /db_xref="PDB:3WTP"
FT                   /db_xref="PDB:3X1S"
FT                   /db_xref="PDB:3X1T"
FT                   /db_xref="PDB:3X1U"
FT                   /db_xref="PDB:3X1V"
FT                   /db_xref="PDB:4GQB"
FT                   /db_xref="PDB:4H9N"
FT                   /db_xref="PDB:4H9O"
FT                   /db_xref="PDB:4H9P"
FT                   /db_xref="PDB:4H9Q"
FT                   /db_xref="PDB:4H9R"
FT                   /db_xref="PDB:4H9S"
FT                   /db_xref="PDB:4HGA"
FT                   /db_xref="PDB:4M38"
FT                   /db_xref="PDB:4N3W"
FT                   /db_xref="PDB:4N4F"
FT                   /db_xref="PDB:4QUT"
FT                   /db_xref="PDB:4QUU"
FT                   /db_xref="PDB:4QYD"
FT                   /db_xref="PDB:4U9W"
FT                   /db_xref="PDB:4YM5"
FT                   /db_xref="PDB:4YM6"
FT                   /db_xref="PDB:4YY6"
FT                   /db_xref="PDB:4YYD"
FT                   /db_xref="PDB:4YYG"
FT                   /db_xref="PDB:4YYH"
FT                   /db_xref="PDB:4YYI"
FT                   /db_xref="PDB:4YYJ"
FT                   /db_xref="PDB:4YYK"
FT                   /db_xref="PDB:4YYM"
FT                   /db_xref="PDB:4YYN"
FT                   /db_xref="PDB:4Z2M"
FT                   /db_xref="PDB:4Z5T"
FT                   /db_xref="PDB:5AV5"
FT                   /db_xref="PDB:5AV6"
FT                   /db_xref="PDB:5AV8"
FT                   /db_xref="PDB:5AV9"
FT                   /db_xref="PDB:5AVB"
FT                   /db_xref="PDB:5AVC"
FT                   /db_xref="PDB:5AY8"
FT                   /db_xref="PDB:5B0Y"
FT                   /db_xref="PDB:5B0Z"
FT                   /db_xref="PDB:5B24"
FT                   /db_xref="PDB:5B2I"
FT                   /db_xref="PDB:5B2J"
FT                   /db_xref="PDB:5B31"
FT                   /db_xref="PDB:5B32"
FT                   /db_xref="PDB:5B33"
FT                   /db_xref="PDB:5B40"
FT                   /db_xref="PDB:5BNV"
FT                   /db_xref="PDB:5BNX"
FT                   /db_xref="PDB:5BO0"
FT                   /db_xref="PDB:5C3I"
FT                   /db_xref="PDB:5CPI"
FT                   /db_xref="PDB:5CPJ"
FT                   /db_xref="PDB:5CPK"
FT                   /db_xref="PDB:5FA5"
FT                   /db_xref="PDB:5FFW"
FT                   /db_xref="PDB:5FWE"
FT                   /db_xref="PDB:5GSE"
FT                   /db_xref="PDB:5GSU"
FT                   /db_xref="PDB:5GT0"
FT                   /db_xref="PDB:5GT3"
FT                   /db_xref="PDB:5GTC"
FT                   /db_xref="PDB:5GXQ"
FT                   /db_xref="PDB:5JA4"
FT                   /db_xref="PDB:5JRG"
FT                   /db_xref="PDB:5KDM"
FT                   /db_xref="PDB:5TEG"
FT                   /db_xref="PDB:5X7X"
FT                   /db_xref="PDB:5XF3"
FT                   /db_xref="PDB:5XF4"
FT                   /db_xref="PDB:5XF5"
FT                   /db_xref="PDB:6BUZ"
FT                   /db_xref="PDB:6C0W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62805"
FT                   /protein_id="EAX03111.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG"
FT   gene            complement(869076..870143)
FT                   /gene="HIST1H4K"
FT                   /locus_tag="hCG_1743054"
FT                   /note="gene_id=hCG1743054.2"
FT   mRNA            complement(869076..870143)
FT                   /gene="HIST1H4K"
FT                   /locus_tag="hCG_1743054"
FT                   /product="histone 1, H4k"
FT                   /note="gene_id=hCG1743054.2 transcript_id=hCT1781243.3;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(869351..869662)
FT                   /codon_start=1
FT                   /gene="HIST1H4K"
FT                   /locus_tag="hCG_1743054"
FT                   /product="histone 1, H4k"
FT                   /note="gene_id=hCG1743054.2 transcript_id=hCT1781243.3
FT                   protein_id=hCP1712882.0"
FT                   /db_xref="GOA:P62805"
FT                   /db_xref="HGNC:HGNC:20510"
FT                   /db_xref="HGNC:HGNC:29607"
FT                   /db_xref="HGNC:HGNC:4781"
FT                   /db_xref="HGNC:HGNC:4782"
FT                   /db_xref="HGNC:HGNC:4783"
FT                   /db_xref="HGNC:HGNC:4784"
FT                   /db_xref="HGNC:HGNC:4785"
FT                   /db_xref="HGNC:HGNC:4787"
FT                   /db_xref="HGNC:HGNC:4788"
FT                   /db_xref="HGNC:HGNC:4789"
FT                   /db_xref="HGNC:HGNC:4790"
FT                   /db_xref="HGNC:HGNC:4791"
FT                   /db_xref="HGNC:HGNC:4793"
FT                   /db_xref="HGNC:HGNC:4794"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="PDB:1ZKK"
FT                   /db_xref="PDB:2BQZ"
FT                   /db_xref="PDB:2CV5"
FT                   /db_xref="PDB:2IG0"
FT                   /db_xref="PDB:2KWN"
FT                   /db_xref="PDB:2KWO"
FT                   /db_xref="PDB:2LVM"
FT                   /db_xref="PDB:2QQS"
FT                   /db_xref="PDB:2RJE"
FT                   /db_xref="PDB:2RNY"
FT                   /db_xref="PDB:2RS9"
FT                   /db_xref="PDB:3A6N"
FT                   /db_xref="PDB:3AFA"
FT                   /db_xref="PDB:3AN2"
FT                   /db_xref="PDB:3AV1"
FT                   /db_xref="PDB:3AV2"
FT                   /db_xref="PDB:3AYW"
FT                   /db_xref="PDB:3AZE"
FT                   /db_xref="PDB:3AZF"
FT                   /db_xref="PDB:3AZG"
FT                   /db_xref="PDB:3AZH"
FT                   /db_xref="PDB:3AZI"
FT                   /db_xref="PDB:3AZJ"
FT                   /db_xref="PDB:3AZK"
FT                   /db_xref="PDB:3AZL"
FT                   /db_xref="PDB:3AZM"
FT                   /db_xref="PDB:3AZN"
FT                   /db_xref="PDB:3CFS"
FT                   /db_xref="PDB:3CFV"
FT                   /db_xref="PDB:3F9W"
FT                   /db_xref="PDB:3F9X"
FT                   /db_xref="PDB:3F9Y"
FT                   /db_xref="PDB:3F9Z"
FT                   /db_xref="PDB:3IJ1"
FT                   /db_xref="PDB:3JPX"
FT                   /db_xref="PDB:3NQJ"
FT                   /db_xref="PDB:3NQU"
FT                   /db_xref="PDB:3O36"
FT                   /db_xref="PDB:3QBY"
FT                   /db_xref="PDB:3QZS"
FT                   /db_xref="PDB:3QZT"
FT                   /db_xref="PDB:3QZV"
FT                   /db_xref="PDB:3R45"
FT                   /db_xref="PDB:3UVW"
FT                   /db_xref="PDB:3UVX"
FT                   /db_xref="PDB:3UVY"
FT                   /db_xref="PDB:3UW9"
FT                   /db_xref="PDB:3W96"
FT                   /db_xref="PDB:3W97"
FT                   /db_xref="PDB:3W98"
FT                   /db_xref="PDB:3W99"
FT                   /db_xref="PDB:3WA9"
FT                   /db_xref="PDB:3WAA"
FT                   /db_xref="PDB:3WKJ"
FT                   /db_xref="PDB:3WTP"
FT                   /db_xref="PDB:3X1S"
FT                   /db_xref="PDB:3X1T"
FT                   /db_xref="PDB:3X1U"
FT                   /db_xref="PDB:3X1V"
FT                   /db_xref="PDB:4GQB"
FT                   /db_xref="PDB:4H9N"
FT                   /db_xref="PDB:4H9O"
FT                   /db_xref="PDB:4H9P"
FT                   /db_xref="PDB:4H9Q"
FT                   /db_xref="PDB:4H9R"
FT                   /db_xref="PDB:4H9S"
FT                   /db_xref="PDB:4HGA"
FT                   /db_xref="PDB:4M38"
FT                   /db_xref="PDB:4N3W"
FT                   /db_xref="PDB:4N4F"
FT                   /db_xref="PDB:4QUT"
FT                   /db_xref="PDB:4QUU"
FT                   /db_xref="PDB:4QYD"
FT                   /db_xref="PDB:4U9W"
FT                   /db_xref="PDB:4YM5"
FT                   /db_xref="PDB:4YM6"
FT                   /db_xref="PDB:4YY6"
FT                   /db_xref="PDB:4YYD"
FT                   /db_xref="PDB:4YYG"
FT                   /db_xref="PDB:4YYH"
FT                   /db_xref="PDB:4YYI"
FT                   /db_xref="PDB:4YYJ"
FT                   /db_xref="PDB:4YYK"
FT                   /db_xref="PDB:4YYM"
FT                   /db_xref="PDB:4YYN"
FT                   /db_xref="PDB:4Z2M"
FT                   /db_xref="PDB:4Z5T"
FT                   /db_xref="PDB:5AV5"
FT                   /db_xref="PDB:5AV6"
FT                   /db_xref="PDB:5AV8"
FT                   /db_xref="PDB:5AV9"
FT                   /db_xref="PDB:5AVB"
FT                   /db_xref="PDB:5AVC"
FT                   /db_xref="PDB:5AY8"
FT                   /db_xref="PDB:5B0Y"
FT                   /db_xref="PDB:5B0Z"
FT                   /db_xref="PDB:5B24"
FT                   /db_xref="PDB:5B2I"
FT                   /db_xref="PDB:5B2J"
FT                   /db_xref="PDB:5B31"
FT                   /db_xref="PDB:5B32"
FT                   /db_xref="PDB:5B33"
FT                   /db_xref="PDB:5B40"
FT                   /db_xref="PDB:5BNV"
FT                   /db_xref="PDB:5BNX"
FT                   /db_xref="PDB:5BO0"
FT                   /db_xref="PDB:5C3I"
FT                   /db_xref="PDB:5CPI"
FT                   /db_xref="PDB:5CPJ"
FT                   /db_xref="PDB:5CPK"
FT                   /db_xref="PDB:5FA5"
FT                   /db_xref="PDB:5FFW"
FT                   /db_xref="PDB:5FWE"
FT                   /db_xref="PDB:5GSE"
FT                   /db_xref="PDB:5GSU"
FT                   /db_xref="PDB:5GT0"
FT                   /db_xref="PDB:5GT3"
FT                   /db_xref="PDB:5GTC"
FT                   /db_xref="PDB:5GXQ"
FT                   /db_xref="PDB:5JA4"
FT                   /db_xref="PDB:5JRG"
FT                   /db_xref="PDB:5KDM"
FT                   /db_xref="PDB:5TEG"
FT                   /db_xref="PDB:5X7X"
FT                   /db_xref="PDB:5XF3"
FT                   /db_xref="PDB:5XF4"
FT                   /db_xref="PDB:5XF5"
FT                   /db_xref="PDB:6BUZ"
FT                   /db_xref="PDB:6C0W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62805"
FT                   /protein_id="EAX03112.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG"
FT   gene            complement(873644..876515)
FT                   /gene="HIST1H2AK"
FT                   /locus_tag="hCG_1643754"
FT                   /note="gene_id=hCG1643754.3"
FT   mRNA            complement(873644..876515)
FT                   /gene="HIST1H2AK"
FT                   /locus_tag="hCG_1643754"
FT                   /product="histone 1, H2ak"
FT                   /note="gene_id=hCG1643754.3 transcript_id=hCT1643881.3;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(876082..876474)
FT                   /codon_start=1
FT                   /gene="HIST1H2AK"
FT                   /locus_tag="hCG_1643754"
FT                   /product="histone 1, H2ak"
FT                   /note="gene_id=hCG1643754.3 transcript_id=hCT1643881.3
FT                   protein_id=hCP1626286.1"
FT                   /db_xref="GOA:A4FTV9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4FTV9"
FT                   /protein_id="EAX03113.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAKGK"
FT   gene            876674..893215
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /note="gene_id=hCG1743059.3"
FT   mRNA            join(876674..877200,879693..879790,892770..893215)
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, transcript variant hCT1953815"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT1953815.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 03-DEC-2003"
FT   mRNA            join(876674..877200,879693..879790,890248..891892)
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, transcript variant hCT1781248"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT1781248.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 03-DEC-2003"
FT   mRNA            876674..877617
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, transcript variant hCT2281566"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT2281566.1;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   mRNA            join(876736..877173,879693..879790,890248..891892)
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, transcript variant hCT2281564"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT2281564.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 03-DEC-2003"
FT   CDS             join(876797..877173,879693..879790,890248..890273)
FT                   /codon_start=1
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, isoform CRA_b"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT2281564.1
FT                   protein_id=hCP1853089.1 isoform=CRA_b"
FT                   /db_xref="GOA:U3KQK0"
FT                   /db_xref="HGNC:HGNC:4749"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:U3KQK0"
FT                   /protein_id="EAX03115.1"
FT                   /translation="MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYI
FT                   ARD"
FT   CDS             876797..877177
FT                   /codon_start=1
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, isoform CRA_a"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT1953815.2
FT                   protein_id=hCP1765549.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99877"
FT                   /db_xref="HGNC:HGNC:4749"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99877"
FT                   /protein_id="EAX03114.1"
FT                   /translation="MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   CDS             876797..877177
FT                   /codon_start=1
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, isoform CRA_a"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT1781248.2
FT                   protein_id=hCP1712898.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCJ9"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCJ9"
FT                   /protein_id="EAX03116.1"
FT                   /translation="MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   CDS             876797..877177
FT                   /codon_start=1
FT                   /gene="HIST1H2BN"
FT                   /locus_tag="hCG_1743059"
FT                   /product="histone 1, H2bn, isoform CRA_a"
FT                   /note="gene_id=hCG1743059.3 transcript_id=hCT2281566.1
FT                   protein_id=hCP1853086.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCJ9"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCJ9"
FT                   /protein_id="EAX03117.1"
FT                   /translation="MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   gene            complement(902199..902538)
FT                   /pseudo
FT                   /locus_tag="hCG_2043348"
FT                   /note="gene_id=hCG2043348.0"
FT   mRNA            complement(902199..902538)
FT                   /pseudo
FT                   /locus_tag="hCG_2043348"
FT                   /note="gene_id=hCG2043348.0 transcript_id=hCT2350133.0;
FT                   overlap evidence=no; created on 03-DEC-2003"
FT   gene            903464..904012
FT                   /gene="HIST1H2AL"
FT                   /locus_tag="hCG_1743060"
FT                   /note="gene_id=hCG1743060.2"
FT   mRNA            903464..904012
FT                   /gene="HIST1H2AL"
FT                   /locus_tag="hCG_1743060"
FT                   /product="histone 1, H2al"
FT                   /note="gene_id=hCG1743060.2 transcript_id=hCT1781249.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             903490..903882
FT                   /codon_start=1
FT                   /gene="HIST1H2AL"
FT                   /locus_tag="hCG_1743060"
FT                   /product="histone 1, H2al"
FT                   /note="gene_id=hCG1743060.2 transcript_id=hCT1781249.2
FT                   protein_id=hCP1712899.0"
FT                   /db_xref="GOA:A4FTV9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4FTV9"
FT                   /protein_id="EAX03118.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAKGK"
FT   gene            complement(904927..905869)
FT                   /gene="HIST1H1B"
FT                   /locus_tag="hCG_1657212"
FT                   /note="gene_id=hCG1657212.1"
FT   mRNA            complement(904927..905869)
FT                   /gene="HIST1H1B"
FT                   /locus_tag="hCG_1657212"
FT                   /product="histone 1, H1b"
FT                   /note="gene_id=hCG1657212.1 transcript_id=hCT1657339.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(904984..905664)
FT                   /codon_start=1
FT                   /gene="HIST1H1B"
FT                   /locus_tag="hCG_1657212"
FT                   /product="histone 1, H1b"
FT                   /note="gene_id=hCG1657212.1 transcript_id=hCT1657339.1
FT                   protein_id=hCP1626327.0"
FT                   /protein_id="EAX03119.1"
FT                   /translation="MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSE
FT                   LITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGA
FT                   SGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPA
FT                   AAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAA
FT                   AKKK"
FT   gene            complement(909979..910455)
FT                   /gene="HIST1H3I"
FT                   /locus_tag="hCG_1640466"
FT                   /note="gene_id=hCG1640466.1"
FT   mRNA            complement(909979..910455)
FT                   /gene="HIST1H3I"
FT                   /locus_tag="hCG_1640466"
FT                   /product="histone 1, H3i"
FT                   /note="gene_id=hCG1640466.1 transcript_id=hCT1640593.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(910039..910449)
FT                   /codon_start=1
FT                   /gene="HIST1H3I"
FT                   /locus_tag="hCG_1640466"
FT                   /product="histone 1, H3i"
FT                   /note="gene_id=hCG1640466.1 transcript_id=hCT1640593.1
FT                   protein_id=hCP1626292.0"
FT                   /protein_id="EAX03120.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
FT                   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   gene            complement(911282..911645)
FT                   /gene="HIST1H4L"
FT                   /locus_tag="hCG_1643195"
FT                   /note="gene_id=hCG1643195.1"
FT   mRNA            complement(911282..911645)
FT                   /gene="HIST1H4L"
FT                   /locus_tag="hCG_1643195"
FT                   /product="histone 1, H4l"
FT                   /note="gene_id=hCG1643195.1 transcript_id=hCT1643322.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(911333..911644)
FT                   /codon_start=1
FT                   /gene="HIST1H4L"
FT                   /locus_tag="hCG_1643195"
FT                   /product="histone 1, H4l"
FT                   /note="gene_id=hCG1643195.1 transcript_id=hCT1643322.1
FT                   protein_id=hCP1626279.0"
FT                   /db_xref="GOA:P62805"
FT                   /db_xref="HGNC:HGNC:20510"
FT                   /db_xref="HGNC:HGNC:29607"
FT                   /db_xref="HGNC:HGNC:4781"
FT                   /db_xref="HGNC:HGNC:4782"
FT                   /db_xref="HGNC:HGNC:4783"
FT                   /db_xref="HGNC:HGNC:4784"
FT                   /db_xref="HGNC:HGNC:4785"
FT                   /db_xref="HGNC:HGNC:4787"
FT                   /db_xref="HGNC:HGNC:4788"
FT                   /db_xref="HGNC:HGNC:4789"
FT                   /db_xref="HGNC:HGNC:4790"
FT                   /db_xref="HGNC:HGNC:4791"
FT                   /db_xref="HGNC:HGNC:4793"
FT                   /db_xref="HGNC:HGNC:4794"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="PDB:1ZKK"
FT                   /db_xref="PDB:2BQZ"
FT                   /db_xref="PDB:2CV5"
FT                   /db_xref="PDB:2IG0"
FT                   /db_xref="PDB:2KWN"
FT                   /db_xref="PDB:2KWO"
FT                   /db_xref="PDB:2LVM"
FT                   /db_xref="PDB:2QQS"
FT                   /db_xref="PDB:2RJE"
FT                   /db_xref="PDB:2RNY"
FT                   /db_xref="PDB:2RS9"
FT                   /db_xref="PDB:3A6N"
FT                   /db_xref="PDB:3AFA"
FT                   /db_xref="PDB:3AN2"
FT                   /db_xref="PDB:3AV1"
FT                   /db_xref="PDB:3AV2"
FT                   /db_xref="PDB:3AYW"
FT                   /db_xref="PDB:3AZE"
FT                   /db_xref="PDB:3AZF"
FT                   /db_xref="PDB:3AZG"
FT                   /db_xref="PDB:3AZH"
FT                   /db_xref="PDB:3AZI"
FT                   /db_xref="PDB:3AZJ"
FT                   /db_xref="PDB:3AZK"
FT                   /db_xref="PDB:3AZL"
FT                   /db_xref="PDB:3AZM"
FT                   /db_xref="PDB:3AZN"
FT                   /db_xref="PDB:3CFS"
FT                   /db_xref="PDB:3CFV"
FT                   /db_xref="PDB:3F9W"
FT                   /db_xref="PDB:3F9X"
FT                   /db_xref="PDB:3F9Y"
FT                   /db_xref="PDB:3F9Z"
FT                   /db_xref="PDB:3IJ1"
FT                   /db_xref="PDB:3JPX"
FT                   /db_xref="PDB:3NQJ"
FT                   /db_xref="PDB:3NQU"
FT                   /db_xref="PDB:3O36"
FT                   /db_xref="PDB:3QBY"
FT                   /db_xref="PDB:3QZS"
FT                   /db_xref="PDB:3QZT"
FT                   /db_xref="PDB:3QZV"
FT                   /db_xref="PDB:3R45"
FT                   /db_xref="PDB:3UVW"
FT                   /db_xref="PDB:3UVX"
FT                   /db_xref="PDB:3UVY"
FT                   /db_xref="PDB:3UW9"
FT                   /db_xref="PDB:3W96"
FT                   /db_xref="PDB:3W97"
FT                   /db_xref="PDB:3W98"
FT                   /db_xref="PDB:3W99"
FT                   /db_xref="PDB:3WA9"
FT                   /db_xref="PDB:3WAA"
FT                   /db_xref="PDB:3WKJ"
FT                   /db_xref="PDB:3WTP"
FT                   /db_xref="PDB:3X1S"
FT                   /db_xref="PDB:3X1T"
FT                   /db_xref="PDB:3X1U"
FT                   /db_xref="PDB:3X1V"
FT                   /db_xref="PDB:4GQB"
FT                   /db_xref="PDB:4H9N"
FT                   /db_xref="PDB:4H9O"
FT                   /db_xref="PDB:4H9P"
FT                   /db_xref="PDB:4H9Q"
FT                   /db_xref="PDB:4H9R"
FT                   /db_xref="PDB:4H9S"
FT                   /db_xref="PDB:4HGA"
FT                   /db_xref="PDB:4M38"
FT                   /db_xref="PDB:4N3W"
FT                   /db_xref="PDB:4N4F"
FT                   /db_xref="PDB:4QUT"
FT                   /db_xref="PDB:4QUU"
FT                   /db_xref="PDB:4QYD"
FT                   /db_xref="PDB:4U9W"
FT                   /db_xref="PDB:4YM5"
FT                   /db_xref="PDB:4YM6"
FT                   /db_xref="PDB:4YY6"
FT                   /db_xref="PDB:4YYD"
FT                   /db_xref="PDB:4YYG"
FT                   /db_xref="PDB:4YYH"
FT                   /db_xref="PDB:4YYI"
FT                   /db_xref="PDB:4YYJ"
FT                   /db_xref="PDB:4YYK"
FT                   /db_xref="PDB:4YYM"
FT                   /db_xref="PDB:4YYN"
FT                   /db_xref="PDB:4Z2M"
FT                   /db_xref="PDB:4Z5T"
FT                   /db_xref="PDB:5AV5"
FT                   /db_xref="PDB:5AV6"
FT                   /db_xref="PDB:5AV8"
FT                   /db_xref="PDB:5AV9"
FT                   /db_xref="PDB:5AVB"
FT                   /db_xref="PDB:5AVC"
FT                   /db_xref="PDB:5AY8"
FT                   /db_xref="PDB:5B0Y"
FT                   /db_xref="PDB:5B0Z"
FT                   /db_xref="PDB:5B24"
FT                   /db_xref="PDB:5B2I"
FT                   /db_xref="PDB:5B2J"
FT                   /db_xref="PDB:5B31"
FT                   /db_xref="PDB:5B32"
FT                   /db_xref="PDB:5B33"
FT                   /db_xref="PDB:5B40"
FT                   /db_xref="PDB:5BNV"
FT                   /db_xref="PDB:5BNX"
FT                   /db_xref="PDB:5BO0"
FT                   /db_xref="PDB:5C3I"
FT                   /db_xref="PDB:5CPI"
FT                   /db_xref="PDB:5CPJ"
FT                   /db_xref="PDB:5CPK"
FT                   /db_xref="PDB:5FA5"
FT                   /db_xref="PDB:5FFW"
FT                   /db_xref="PDB:5FWE"
FT                   /db_xref="PDB:5GSE"
FT                   /db_xref="PDB:5GSU"
FT                   /db_xref="PDB:5GT0"
FT                   /db_xref="PDB:5GT3"
FT                   /db_xref="PDB:5GTC"
FT                   /db_xref="PDB:5GXQ"
FT                   /db_xref="PDB:5JA4"
FT                   /db_xref="PDB:5JRG"
FT                   /db_xref="PDB:5KDM"
FT                   /db_xref="PDB:5TEG"
FT                   /db_xref="PDB:5X7X"
FT                   /db_xref="PDB:5XF3"
FT                   /db_xref="PDB:5XF4"
FT                   /db_xref="PDB:5XF5"
FT                   /db_xref="PDB:6BUZ"
FT                   /db_xref="PDB:6C0W"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62805"
FT                   /protein_id="EAX03121.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG"
FT   gene            complement(915558..918210)
FT                   /pseudo
FT                   /locus_tag="hCG_2005146"
FT                   /note="gene_id=hCG2005146.0"
FT   mRNA            complement(915558..918210)
FT                   /pseudo
FT                   /locus_tag="hCG_2005146"
FT                   /note="gene_id=hCG2005146.0 transcript_id=hCT2291740.0;
FT                   overlap evidence=no; created on 08-DEC-2003"
FT   gene            complement(927930..>928922)
FT                   /gene="HIST1H3J"
FT                   /locus_tag="hCG_1643755"
FT                   /note="gene_id=hCG1643755.1"
FT   mRNA            complement(927930..>928922)
FT                   /gene="HIST1H3J"
FT                   /locus_tag="hCG_1643755"
FT                   /product="histone 1, H3j"
FT                   /note="gene_id=hCG1643755.1 transcript_id=hCT1643882.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(928512..928922)
FT                   /codon_start=1
FT                   /gene="HIST1H3J"
FT                   /locus_tag="hCG_1643755"
FT                   /product="histone 1, H3j"
FT                   /note="gene_id=hCG1643755.1 transcript_id=hCT1643882.1
FT                   protein_id=hCP1626317.0"
FT                   /protein_id="EAX03122.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
FT                   TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
FT   gene            complement(930217..931315)
FT                   /gene="HIST1H2AM"
FT                   /locus_tag="hCG_1640467"
FT                   /note="gene_id=hCG1640467.3"
FT   mRNA            complement(930217..931315)
FT                   /gene="HIST1H2AM"
FT                   /locus_tag="hCG_1640467"
FT                   /product="histone 1, H2am"
FT                   /note="gene_id=hCG1640467.3 transcript_id=hCT1640594.3;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(930887..931279)
FT                   /codon_start=1
FT                   /gene="HIST1H2AM"
FT                   /locus_tag="hCG_1640467"
FT                   /product="histone 1, H2am"
FT                   /note="gene_id=hCG1640467.3 transcript_id=hCT1640594.3
FT                   protein_id=hCP1626321.2"
FT                   /db_xref="GOA:A4FTV9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4FTV9"
FT                   /protein_id="EAX03123.1"
FT                   /translation="MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVG
FT                   AGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIA
FT                   QGGVLPNIQAVLLPKKTESHHKAKGK"
FT   gene            931555..933308
FT                   /gene="HIST1H2BO"
FT                   /locus_tag="hCG_2043355"
FT                   /note="gene_id=hCG2043355.0"
FT   mRNA            931555..933308
FT                   /gene="HIST1H2BO"
FT                   /locus_tag="hCG_2043355"
FT                   /product="histone 1, H2bo"
FT                   /note="gene_id=hCG2043355.0 transcript_id=hCT2281570.1;
FT                   overlap evidence=yes; created on 02-DEC-2003"
FT   CDS             931593..931973
FT                   /codon_start=1
FT                   /gene="HIST1H2BO"
FT                   /locus_tag="hCG_2043355"
FT                   /product="histone 1, H2bo"
FT                   /note="gene_id=hCG2043355.0 transcript_id=hCT2281570.1
FT                   protein_id=hCP1853094.0"
FT                   /protein_id="EAX03124.1"
FT                   /translation="MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKV
FT                   LKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLP
FT                   GELAKHAVSEGTKAVTKYTSSK"
FT   gene            complement(<949373..950685)
FT                   /gene="OR2B2"
FT                   /locus_tag="hCG_1645583"
FT                   /note="gene_id=hCG1645583.3"
FT   mRNA            complement(<949373..950685)
FT                   /gene="OR2B2"
FT                   /locus_tag="hCG_1645583"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   2"
FT                   /note="gene_id=hCG1645583.3 transcript_id=hCT1645710.2;
FT                   overlap evidence=yes; created on 03-DEC-2003"
FT   CDS             complement(949373..950446)
FT                   /codon_start=1
FT                   /gene="OR2B2"
FT                   /locus_tag="hCG_1645583"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   2"
FT                   /note="gene_id=hCG1645583.3 transcript_id=hCT1645710.2
FT                   protein_id=hCP1626284.1"
FT                   /db_xref="GOA:Q9GZK3"
FT                   /db_xref="HGNC:HGNC:13966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GZK3"
FT                   /protein_id="EAX03125.1"
FT                   /translation="MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTI
FT                   ILVSHVDFKLHTPMYFFLSNLSLLDLCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIF
FT                   LALGSTECLLLAVMCFDRFVAICRPLHYSIIMHQRLCFQLAAASWISGFSNSVLQSTWT
FT                   LKMPLCGHKEVDHFFCEVPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIV
FT                   QAVLRIQSAEGQRKAFGTCGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGII
FT                   APMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPI
FT                   FVITIENYCNLPQRKFP"
FT   gene            <975090..>976538
FT                   /locus_tag="hCG_2043356"
FT                   /note="gene_id=hCG2043356.1"
FT   mRNA            join(<975090..975138,975631..>976538)
FT                   /locus_tag="hCG_2043356"
FT                   /product="hCG2043356"
FT                   /note="gene_id=hCG2043356.1 transcript_id=hCT2281568.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 06-MAY-2004"
FT   CDS             join(975090..975138,975631..976538)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2043356"
FT                   /product="hCG2043356"
FT                   /note="gene_id=hCG2043356.1 transcript_id=hCT2281568.2
FT                   protein_id=hCP1853096.2"
FT                   /db_xref="GOA:Q8NHA6"
FT                   /db_xref="HGNC:HGNC:15072"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NHA6"
FT                   /protein_id="EAX03126.1"
FT                   /translation="MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTL
FT                   LGNMTIVLLSALDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCA
FT                   IQLYFVLALGGVECVLLAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSL
FT                   IMAPQTLMLPRCGHRRVDHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILI
FT                   SYGYVGGTVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLT
FT                   LFYTIVTPSVNPLIYTLRNKDVKEAMKKVLGKGSAEI"
FT   gene            <995376..996457
FT                   /gene="OR2B6"
FT                   /locus_tag="hCG_1999027"
FT                   /note="gene_id=hCG1999027.1"
FT   mRNA            <995376..996457
FT                   /gene="OR2B6"
FT                   /locus_tag="hCG_1999027"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   6"
FT                   /note="gene_id=hCG1999027.1 transcript_id=hCT2281569.1;
FT                   overlap evidence=yes; created on 02-DEC-2003"
FT   CDS             995376..996317
FT                   /codon_start=1
FT                   /gene="OR2B6"
FT                   /locus_tag="hCG_1999027"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   6"
FT                   /note="gene_id=hCG1999027.1 transcript_id=hCT2281569.1
FT                   protein_id=hCP1853095.1"
FT                   /db_xref="GOA:A0A126GW55"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A126GW55"
FT                   /protein_id="EAX03127.1"
FT                   /translation="MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTI
FT                   ILVSRLDTKLHTPMYFFLTNLSLLDLCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIF
FT                   LALGATEYLLLAVMSFDRFVAICRPLHYSVIMHQRLCLQLAAASWVTGFSNSVWLSTLT
FT                   LQLPLCDPYVIDHFLCEVPALLKLSCVETTANEAELFLVSELFHLIPLTLILISYAFIV
FT                   RAVLRIQSAEGRQKAFGTCGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGII
FT                   APMLNPLIYTLRNKEVKEGFKRLVARVFLIKK"
FT   gene            <1003312..>1003593
FT                   /locus_tag="hCG_1811681"
FT                   /note="gene_id=hCG1811681.1"
FT   mRNA            <1003312..>1003593
FT                   /locus_tag="hCG_1811681"
FT                   /product="hCG1811681"
FT                   /note="gene_id=hCG1811681.1 transcript_id=hCT1953845.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             1003312..1003593
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811681"
FT                   /product="hCG1811681"
FT                   /note="gene_id=hCG1811681.1 transcript_id=hCT1953845.0
FT                   protein_id=hCP1765528.0"
FT                   /protein_id="EAX03128.1"
FT                   /translation="MVYLTSYLLPSLMSNTSLSAKDIKKILDRVGMEATDDWLNKVISE
FT                   LNGKNIEDIIAQGIGELASVPAGGAVALSASLGSAGPAAGSTPAAEER"
FT   gene            1015286..1016201
FT                   /pseudo
FT                   /locus_tag="hCG_1811673"
FT                   /note="gene_id=hCG1811673.2"
FT   mRNA            1015286..1016201
FT                   /pseudo
FT                   /locus_tag="hCG_1811673"
FT                   /note="gene_id=hCG1811673.2 transcript_id=hCT1953811.2;
FT                   overlap evidence=no; created on 05-SEP-2003"
FT   gene            1048953..1050485
FT                   /pseudo
FT                   /locus_tag="hCG_1643198"
FT                   /note="gene_id=hCG1643198.4"
FT   mRNA            1048953..1050485
FT                   /pseudo
FT                   /locus_tag="hCG_1643198"
FT                   /note="gene_id=hCG1643198.4 transcript_id=hCT1643325.4;
FT                   overlap evidence=no; created on 29-JAN-2004"
FT   gene            1072051..1072993
FT                   /pseudo
FT                   /locus_tag="hCG_2044289"
FT                   /note="gene_id=hCG2044289.0"
FT   mRNA            1072051..1072993
FT                   /pseudo
FT                   /locus_tag="hCG_2044289"
FT                   /note="gene_id=hCG2044289.0 transcript_id=hCT2351464.0;
FT                   overlap evidence=yes; created on 12-APR-2004"
FT   gene            1084603..1085570
FT                   /pseudo
FT                   /locus_tag="hCG_1793089"
FT                   /note="gene_id=hCG1793089.3"
FT   mRNA            1084603..1085570
FT                   /pseudo
FT                   /locus_tag="hCG_1793089"
FT                   /note="gene_id=hCG1793089.3 transcript_id=hCT1832349.3;
FT                   overlap evidence=no; created on 05-SEP-2003"
FT   gene            complement(<1091387..>1092325)
FT                   /locus_tag="hCG_1805526"
FT                   /note="gene_id=hCG1805526.3"
FT   mRNA            complement(<1091387..>1092325)
FT                   /locus_tag="hCG_1805526"
FT                   /product="hCG1805526"
FT                   /note="gene_id=hCG1805526.3 transcript_id=hCT1844786.3;
FT                   overlap evidence=no; created on 12-APR-2004"
FT   CDS             complement(1091387..1092325)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1805526"
FT                   /product="hCG1805526"
FT                   /note="gene_id=hCG1805526.3 transcript_id=hCT1844786.3
FT                   protein_id=hCP1712969.3"
FT                   /protein_id="EAX03129.1"
FT                   /translation="MDQKNGSSFTGFILLGFSDRPQLELVLFVVLLIFYIFTLLGNKTI
FT                   IVLSHLDPHLHNPMYFFFSNLSFLDLCYTTGIVPQLLVNLRGADKSISYGGCVVQLYIS
FT                   LGLGSTECVLLGVMAFDRYAAVCRPLHYTVVMHPCLYVLMASTSWVIGFANSLLQTVLI
FT                   LLLTLCGRNKLEHFLCEVPPLLKLACVDTTMNESELFFVSVIILLVPVALIIFSYSQIV
FT                   RAVVRIKSATGQRKVFGTCGSHLTVVSLFYGTAIYAYLQPGNNYSQDQGKFISLFYTII
FT                   TPMINPLIYTLRNKDVKGALKKVLWKNYDSR"
FT   gene            <1111476..>1112489
FT                   /locus_tag="hCG_2044358"
FT                   /note="gene_id=hCG2044358.0"
FT   mRNA            <1111476..>1112489
FT                   /locus_tag="hCG_2044358"
FT                   /product="hCG2044358"
FT                   /note="gene_id=hCG2044358.0 transcript_id=hCT2351537.0;
FT                   overlap evidence=no; created on 12-APR-2004"
FT   CDS             1111476..1112489
FT                   /codon_start=1
FT                   /locus_tag="hCG_2044358"
FT                   /product="hCG2044358"
FT                   /note="gene_id=hCG2044358.0 transcript_id=hCT2351537.0
FT                   protein_id=hCP1916767.0"
FT                   /protein_id="EAX03130.1"
FT                   /translation="MEGKNQTNISEFLLLGFSSWQQQQVLLFALFLCLYLTGLFGNLLI
FT                   LLAIGSDHCLHTPMYFFLANLSLVDLCLPSATVPKMLLNIQTQTQTISYPGCLAQMYFC
FT                   MMFANMDNFLLTVMAYDRYVAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMM
FT                   AHLHFCSDNVIHHFFCDINSLLPLSCSDTSLNQLSVLATVGLIFVVPSVCILVSYILIV
FT                   SAVMKVPSAQGKLKAFSTCGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVV
FT                   APVLNPFIYSLRNNELKGTLKKTLSRPGAVAHACNPSTLGGRGGWIMRSGDRDHPG"
FT   gene            1116955..1127723
FT                   /gene="ZNF165"
FT                   /locus_tag="hCG_31427"
FT                   /note="gene_id=hCG31427.3"
FT   mRNA            join(1116955..1117132,1118786..1119690,1123641..1124051,
FT                   1124332..1124470,1126723..1127723)
FT                   /gene="ZNF165"
FT                   /locus_tag="hCG_31427"
FT                   /product="zinc finger protein 165"
FT                   /note="gene_id=hCG31427.3 transcript_id=hCT22607.3; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   CDS             join(1123641..1124051,1124332..1124470,1126723..1127630)
FT                   /codon_start=1
FT                   /gene="ZNF165"
FT                   /locus_tag="hCG_31427"
FT                   /product="zinc finger protein 165"
FT                   /note="gene_id=hCG31427.3 transcript_id=hCT22607.3
FT                   protein_id=hCP45182.3"
FT                   /db_xref="GOA:Q53Z40"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q53Z40"
FT                   /protein_id="EAX03131.1"
FT                   /translation="MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQ
FT                   ELCRQLFRQFCYQDSPGPREALSRLRELCCQWLKPEIHTKEQILELLVLEQFLTILPGD
FT                   LQAWVHEHYPESGEEAVTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKL
FT                   QPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGE
FT                   SQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLNL
FT                   NSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSG
FT                   DKTHQCNECGKAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERP
FT                   FGCKECGRAFNLNSHLIRHQRIHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYEC
FT                   SECGRAFSQSSNLSQHQRIHMRENLLM"
FT   gene            1128726..1135059
FT                   /locus_tag="hCG_2038473"
FT                   /note="gene_id=hCG2038473.2"
FT   mRNA            join(1128726..1129644,1130499..1135059)
FT                   /locus_tag="hCG_2038473"
FT                   /product="hCG2038473"
FT                   /note="gene_id=hCG2038473.2 transcript_id=hCT2342899.2;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 12-APR-2004"
FT   CDS             1131019..1131390
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038473"
FT                   /product="hCG2038473"
FT                   /note="gene_id=hCG2038473.2 transcript_id=hCT2342899.2
FT                   protein_id=hCP1908722.2"
FT                   /protein_id="EAX03132.1"
FT                   /translation="MNTLARERSSHTSREARLQSSISTPSRLICKSLCFVLSSFLVSSL
FT                   LLKGGRRLCQHSFSILCPEMCSLRCLLKIVTVVPSLSLSQAQPYLIVPKLQPVHMEWDC
FT                   TQNIIIKQHRSHQLFLSSQ"
FT   gene            <1145881..1153847
FT                   /locus_tag="hCG_2040297"
FT                   /note="gene_id=hCG2040297.0"
FT   mRNA            join(<1145881..1146087,1153323..1153847)
FT                   /locus_tag="hCG_2040297"
FT                   /product="hCG2040297"
FT                   /note="gene_id=hCG2040297.0 transcript_id=hCT2345507.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             join(<1145881..1146087,1153323..1153349)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040297"
FT                   /product="hCG2040297"
FT                   /note="gene_id=hCG2040297.0 transcript_id=hCT2345507.0
FT                   protein_id=hCP1912582.0"
FT                   /protein_id="EAX03133.1"
FT                   /translation="YKETPGPCEALSQLWKLCCEWLRPEIHTKEQMLDLLLLELFLAIL
FT                   PEELLAWMHEYHPKNGEEAVVLLEIMLSESIK"
FT   gene            1162719..1168241
FT                   /gene="ZNF435"
FT                   /locus_tag="hCG_1643757"
FT                   /note="gene_id=hCG1643757.2"
FT   mRNA            join(1162719..1162837,1163573..1163990,1164943..1165081,
FT                   1167590..1168241)
FT                   /gene="ZNF435"
FT                   /locus_tag="hCG_1643757"
FT                   /product="zinc finger protein 435"
FT                   /note="gene_id=hCG1643757.2 transcript_id=hCT1643884.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(1163604..1163990,1164943..1165081,1167590..1168110)
FT                   /codon_start=1
FT                   /gene="ZNF435"
FT                   /locus_tag="hCG_1643757"
FT                   /product="zinc finger protein 435"
FT                   /note="gene_id=hCG1643757.2 transcript_id=hCT1643884.2
FT                   protein_id=hCP1626250.2"
FT                   /protein_id="EAX03134.1"
FT                   /translation="MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFR
FT                   KLCYQDAPGPREALTQLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVRAH
FT                   HPETGEEAVTVLEDLERELDEPGKQVPGNSERRDILMDKLAPLGRPYESLTVQLHPKKT
FT                   QLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIEN
FT                   EGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIG
FT                   HHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQR
FT                   IHTANKLY"
FT   gene            1179998..1195298
FT                   /gene="ZNF192"
FT                   /locus_tag="hCG_31426"
FT                   /note="gene_id=hCG31426.2"
FT   mRNA            join(1179998..1180188,1186475..1186983,1187642..1187783,
FT                   1190006..1190097,1190422..1190545,1191217..1195298)
FT                   /gene="ZNF192"
FT                   /locus_tag="hCG_31426"
FT                   /product="zinc finger protein 192, transcript variant
FT                   hCT2281900"
FT                   /note="gene_id=hCG31426.2 transcript_id=hCT2281900.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1182525..1182583,1186475..1186983,1187642..1187783,
FT                   1190006..1190097,1190422..1190545,1191217..1194804)
FT                   /gene="ZNF192"
FT                   /locus_tag="hCG_31426"
FT                   /product="zinc finger protein 192, transcript variant
FT                   hCT22606"
FT                   /note="gene_id=hCG31426.2 transcript_id=hCT22606.3; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   CDS             join(1186567..1186983,1187642..1187783,1190006..1190097,
FT                   1190422..1190545,1191217..1192178)
FT                   /codon_start=1
FT                   /gene="ZNF192"
FT                   /locus_tag="hCG_31426"
FT                   /product="zinc finger protein 192, isoform CRA_a"
FT                   /note="gene_id=hCG31426.2 transcript_id=hCT22606.3
FT                   protein_id=hCP45180.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q15776"
FT                   /db_xref="HGNC:HGNC:12983"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15776"
FT                   /protein_id="EAX03135.1"
FT                   /translation="MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPL
FT                   GQEVFRLRFRQLRYQETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILP
FT                   EELQTLVKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEP
FT                   PNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKI
FT                   EDMAVSLIREEWLLDPSQKDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQP
FT                   HGETAAKCNGDVIRGLEHEEARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRH
FT                   WRIHTGEKPYQCNVCGKAFSYRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRI
FT                   HTGEKPYQCNQCGKAFSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTG
FT                   EKPYECDECGKTFRRSSHLIGHQRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERP
FT                   YKCKECGKAFNGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESI
FT                   SV"
FT   CDS             join(1186567..1186983,1187642..1187783,1190006..1190097,
FT                   1190422..1190545,1191217..1192178)
FT                   /codon_start=1
FT                   /gene="ZNF192"
FT                   /locus_tag="hCG_31426"
FT                   /product="zinc finger protein 192, isoform CRA_a"
FT                   /note="gene_id=hCG31426.2 transcript_id=hCT2281900.0
FT                   protein_id=hCP1853155.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCK7"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCK7"
FT                   /protein_id="EAX03136.1"
FT                   /translation="MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPL
FT                   GQEVFRLRFRQLRYQETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILP
FT                   EELQTLVKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEP
FT                   PNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKI
FT                   EDMAVSLIREEWLLDPSQKDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQP
FT                   HGETAAKCNGDVIRGLEHEEARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRH
FT                   WRIHTGEKPYQCNVCGKAFSYRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRI
FT                   HTGEKPYQCNQCGKAFSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTG
FT                   EKPYECDECGKTFRRSSHLIGHQRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERP
FT                   YKCKECGKAFNGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESI
FT                   SV"
FT   gene            1199942..1207756
FT                   /locus_tag="hCG_1646484"
FT                   /note="gene_id=hCG1646484.2"
FT   mRNA            join(1199942..1199982,1200741..1200927,1202911..1203063,
FT                   1204663..1205716,1207564..1207756)
FT                   /locus_tag="hCG_1646484"
FT                   /product="hCG1646484"
FT                   /note="gene_id=hCG1646484.2 transcript_id=hCT1646611.2;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             1204721..1205530
FT                   /codon_start=1
FT                   /locus_tag="hCG_1646484"
FT                   /product="hCG1646484"
FT                   /note="gene_id=hCG1646484.2 transcript_id=hCT1646611.2
FT                   protein_id=hCP1626275.0"
FT                   /protein_id="EAX03137.1"
FT                   /translation="MDPHQKVPSIYNGDTLQTPEYEKVSQYEDQLERHEGRHMEERRYK
FT                   CNECGKKFAQSSGLVRHQRIHTGEKPYECDHYGKAFSVRSTLTVHERIHTGEKPYTCNE
FT                   CKKAFSVRAHLIIHQRIHNGEKPYECNECGKAFSVSSDLIKHQRIHTGEKPYECDECGK
FT                   AFSVSSALIKHQRIHTGEKPYEYKECGKAFYVNSALINHQRIHSGEKPYECGECGKAFS
FT                   QISTLIHHQRIHTGEKPYECEECGKAFHGSSNLTKHQKTHAKGKCHQ"
FT   assembly_gap    1214757..1214776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1246463..>1258009)
FT                   /locus_tag="hCG_1643759"
FT                   /note="gene_id=hCG1643759.2"
FT   mRNA            complement(join(<1246463..1246825,1256549..1256658,
FT                   1256733..1256933,1256945..1257081,1257108..1257435,
FT                   1257853..>1258009))
FT                   /locus_tag="hCG_1643759"
FT                   /product="hCG1643759, transcript variant hCT2282053"
FT                   /note="gene_id=hCG1643759.2 transcript_id=hCT2282053.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1246463..1246825,1256549..1256658,
FT                   1256733..1256933,1256945..1257081,1257108..1257435,
FT                   1257853..1258009))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1643759"
FT                   /product="hCG1643759, isoform CRA_b"
FT                   /note="gene_id=hCG1643759.2 transcript_id=hCT2282053.0
FT                   protein_id=hCP1853132.0 isoform=CRA_b"
FT                   /protein_id="EAX03139.1"
FT                   /translation="MYRLRAGAREGAGRRRREASSSRDAGPGGQDRPAVTARSFFRSPR
FT                   PPHGPPSAHWYPDKPLKGSGFHTEEMVDPVGELAAKRSGLTVEDVRANVPEELSIWIDP
FT                   FGVSYQIGEKGAVKVLYLDDSDGCGAPELDMKIKSSFTPDDQMLFLLGSQDSSLSNSPP
FT                   TFILCLAQPITFTMDSFAATKLGSTKMKKRGGATSGRGAASGEAASTAASTARFNTNSL
FT                   LKHRSLSLSVHSLNFIPANRPLNPSSRPKATYSLKYNSGGLPSFFLDGANGQGIWRWCH
FT                   RLFLEKAPFMEDLSYNLNTMQYPSQPFQSVRRTKPSEDQKPLLGPSFPNINPKAVKRSL
FT                   LSEQLRSSLDISGGFRMTLLRAAARSEAGSWVYNQFYALPRGPSPGHNLCIHPNQLPLF
FT                   AATRESGTKSGPPSPRELHVPARTENKARNDKW"
FT   mRNA            complement(1256469..1257847)
FT                   /locus_tag="hCG_1643759"
FT                   /product="hCG1643759, transcript variant hCT1643886"
FT                   /note="gene_id=hCG1643759.2 transcript_id=hCT1643886.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(1257011..1257382)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1643759"
FT                   /product="hCG1643759, isoform CRA_a"
FT                   /note="gene_id=hCG1643759.2 transcript_id=hCT1643886.2
FT                   protein_id=hCP1626277.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8WYV3"
FT                   /db_xref="InterPro:IPR002087"
FT                   /db_xref="InterPro:IPR015676"
FT                   /db_xref="InterPro:IPR015678"
FT                   /db_xref="InterPro:IPR036054"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WYV3"
FT                   /protein_id="EAX03138.1"
FT                   /translation="MVDPVGELAAKRSGLTVEDVRANVPEELSIWIDPFGVSYQIGEKG
FT                   AVKVLYLDDSDGCGAPELDMKIKSSFTPDDQMLFLLGSQDSSLSNSPSLCFAHHPAPPS
FT                   SSASPSPSPSPWTPLLPPN"
FT   gene            1263791..1272040
FT                   /gene="ZNF193"
FT                   /locus_tag="hCG_31428"
FT                   /note="gene_id=hCG31428.1"
FT   mRNA            join(1263791..1263919,1265558..1266057,1266243..1266390,
FT                   1271115..1272040)
FT                   /gene="ZNF193"
FT                   /locus_tag="hCG_31428"
FT                   /product="zinc finger protein 193, transcript variant
FT                   hCT2281911"
FT                   /note="gene_id=hCG31428.1 transcript_id=hCT2281911.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1263791..1263919,1265565..1266057,1266243..1266390,
FT                   1271115..1272040)
FT                   /gene="ZNF193"
FT                   /locus_tag="hCG_31428"
FT                   /product="zinc finger protein 193, transcript variant
FT                   hCT22608"
FT                   /note="gene_id=hCG31428.1 transcript_id=hCT22608.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   CDS             join(1265638..1266057,1266243..1266390,1271115..1271731)
FT                   /codon_start=1
FT                   /gene="ZNF193"
FT                   /locus_tag="hCG_31428"
FT                   /product="zinc finger protein 193, isoform CRA_a"
FT                   /note="gene_id=hCG31428.1 transcript_id=hCT22608.2
FT                   protein_id=hCP45183.1 isoform=CRA_a"
FT                   /db_xref="GOA:O15535"
FT                   /db_xref="HGNC:HGNC:12984"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15535"
FT                   /protein_id="EAX03140.1"
FT                   /translation="MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNP
FT                   LAREIFRRHFRQLCYQETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSIL
FT                   PKELQGWVREHCPESGEEAVILLEDLERELDEPQHEMVAHRHRQEVLCKEMVPLAEQTP
FT                   LTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTW
FT                   EVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERP
FT                   YECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQC
FT                   SQCSKSYSRRSFLIEHQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV"
FT   CDS             join(1265638..1266057,1266243..1266390,1271115..1271731)
FT                   /codon_start=1
FT                   /gene="ZNF193"
FT                   /locus_tag="hCG_31428"
FT                   /product="zinc finger protein 193, isoform CRA_a"
FT                   /note="gene_id=hCG31428.1 transcript_id=hCT2281911.0
FT                   protein_id=hCP1853152.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCK9"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCK9"
FT                   /protein_id="EAX03141.1"
FT                   /translation="MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNP
FT                   LAREIFRRHFRQLCYQETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSIL
FT                   PKELQGWVREHCPESGEEAVILLEDLERELDEPQHEMVAHRHRQEVLCKEMVPLAEQTP
FT                   LTLQSQPKEPQLTCDSAQKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTW
FT                   EVSQQDPSHGEVGEHKDRIERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERP
FT                   YECNECGKAFSRSSGLFNHRGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQC
FT                   SQCSKSYSRRSFLIEHQRSHTGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV"
FT   gene            complement(1283173..1291438)
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /note="gene_id=hCG31434.3"
FT   mRNA            complement(join(1283173..1284528,1285515..1285638,
FT                   1286613..1286695,1288233..1288380,1291353..1291438))
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, transcript variant
FT                   hCT1966747"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT1966747.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1283173..1284528,1285515..1285638,
FT                   1286613..1286695,1288233..1288380,1290104..1290802))
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, transcript variant
FT                   hCT1966748"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT1966748.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(1283173..1284528,1285515..1285638,
FT                   1289969..1290802))
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, transcript variant
FT                   hCT22614"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT22614.3; splice
FT                   donor-acceptor pairs covered / total pairs = 1/2; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(1283669..1284528,1285515..1285638,
FT                   1286613..1286695,1288233..1288380,1291353..1291364))
FT                   /codon_start=1
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, isoform CRA_b"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT1966747.1
FT                   protein_id=hCP1780694.0 isoform=CRA_b"
FT                   /protein_id="EAX03143.1"
FT                   /translation="MCKVVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHESL
FT                   GSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSSQ
FT                   VNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEA
FT                   GEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIG
FT                   SSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCS
FT                   LLEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQ
FT                   WENTEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRS
FT                   HVGKKTLSQ"
FT   CDS             complement(join(1283669..1284528,1285515..1285638,
FT                   1286613..1286695,1288233..1288380,1290104..1290526))
FT                   /codon_start=1
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, isoform CRA_a"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT1966748.1
FT                   protein_id=hCP1780703.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q969J2"
FT                   /db_xref="HGNC:HGNC:13854"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q969J2"
FT                   /protein_id="EAX03142.1"
FT                   /translation="MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSP
FT                   ARGPERSRQRFRGFRYPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTI
FT                   LPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVPVGDQGQELLCCKMALLTQTQ
FT                   GSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLK
FT                   MEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEH
FT                   GKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRR
FT                   IHTGEKPYECEDCGKTFIGSSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHT
FT                   GEKPYECDDCGKTFSQSCSLLEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKN
FT                   VQNPEHGESWESQGRTESQWENTEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQC
FT                   DTCGKGFTRTSYLVQHQRSHVGKKTLSQ"
FT   CDS             complement(join(1283669..1284528,1285515..1285638,
FT                   1289969..1290526))
FT                   /codon_start=1
FT                   /gene="ZNF307"
FT                   /locus_tag="hCG_31434"
FT                   /product="zinc finger protein 307, isoform CRA_c"
FT                   /note="gene_id=hCG31434.3 transcript_id=hCT22614.3
FT                   protein_id=hCP45178.1 isoform=CRA_c"
FT                   /protein_id="EAX03144.1"
FT                   /translation="MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSP
FT                   ARGPERSRQRFRGFRYPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTI
FT                   LPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVERTGLVSERCGLFPPEIPDRS
FT                   EGHSFKVQEFFISFCTVNLLGSKGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQENHS
FT                   SLVSLGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKN
FT                   AIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGSSALVIHQRVHTG
FT                   EKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHKIHTGEKP
FT                   YQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWENTEAPVSYKCN
FT                   ECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ"
FT   gene            1297864..1301141
FT                   /gene="C6orf194"
FT                   /locus_tag="hCG_1645578"
FT                   /note="gene_id=hCG1645578.3"
FT   mRNA            1297864..1301141
FT                   /gene="C6orf194"
FT                   /locus_tag="hCG_1645578"
FT                   /product="chromosome 6 open reading frame 194, transcript
FT                   variant hCT1645705"
FT                   /note="gene_id=hCG1645578.3 transcript_id=hCT1645705.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   mRNA            join(1297865..1298542,1298663..1301141)
FT                   /gene="C6orf194"
FT                   /locus_tag="hCG_1645578"
FT                   /product="chromosome 6 open reading frame 194, transcript
FT                   variant hCT2281916"
FT                   /note="gene_id=hCG1645578.3 transcript_id=hCT2281916.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             1297917..1299125
FT                   /codon_start=1
FT                   /gene="C6orf194"
FT                   /locus_tag="hCG_1645578"
FT                   /product="chromosome 6 open reading frame 194, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG1645578.3 transcript_id=hCT1645705.3
FT                   protein_id=hCP1626303.2 isoform=CRA_a"
FT                   /protein_id="EAX03145.1"
FT                   /translation="MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHS
FT                   RGREGLRPPWSELDVGALYPFSRSGSRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEE
FT                   RQSAEDYEKEESHRQRRLKERERIGELGAPEVWGPSPKFPQLDSDEHTPVEDEEEVTHQ
FT                   KSSSSDSNSEEHRKKKTSRSRNKKKRKNKSSKRKHRKYSDSDSNSESDTNSDSDDDKKR
FT                   VKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGPE
FT                   APIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYV
FT                   MSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILASFREMVHKKTKEK
FT                   DDK"
FT   CDS             join(1297917..1298542,1298663..1299125)
FT                   /codon_start=1
FT                   /gene="C6orf194"
FT                   /locus_tag="hCG_1645578"
FT                   /product="chromosome 6 open reading frame 194, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG1645578.3 transcript_id=hCT2281916.0
FT                   protein_id=hCP1853142.0 isoform=CRA_b"
FT                   /protein_id="EAX03146.1"
FT                   /translation="MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHS
FT                   RGREGLRPPWSELDVGALYPFSRSGSRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEE
FT                   RQSAEDYEKEESHRQRRLKERERIGELGAPEVWGPSPKFPQLDSDEHTPVEDEEEVTHQ
FT                   KSSSSDSNSEEHRKKKTSRSRNKKKRKNKSSKRKHRKYSDSDSNSDDSSCKDSEEDLSE
FT                   ATWMEQPNVADTMDLIGPEAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRR
FT                   GEIGLTSEEIGSFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKR
FT                   ESKILASFREMVHKKTKEKDDK"
FT   gene            1305613..1316751
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /note="gene_id=hCG31430.2"
FT   mRNA            join(1305613..1305757,1310398..1310883,1311214..1311331,
FT                   1314739..1316751)
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, transcript variant
FT                   hCT22610"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT22610.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   mRNA            join(1305675..1305997,1310398..1310883,1311214..1311331,
FT                   1314739..1316751)
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, transcript variant
FT                   hCT1954736"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT1954736.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   mRNA            join(1305694..1305757,1310398..1310478,1311214..1311331,
FT                   1314739..1316745)
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, transcript variant
FT                   hCT2358760"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT2358760.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   mRNA            join(1305921..1305997,1310398..1310478,1311214..1311331,
FT                   1314739..>1315111)
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, transcript variant
FT                   hCT2358761"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT2358761.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   CDS             join(1310464..1310883,1311214..1311331,1314739..1315640)
FT                   /codon_start=1
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, isoform CRA_a"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT1954736.1
FT                   protein_id=hCP1765550.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCN4"
FT                   /db_xref="HGNC:HGNC:12978"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCN4"
FT                   /protein_id="EAX03147.1"
FT                   /translation="MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGL
FT                   GQEPLCKQFRQLRYEETTGPREALSRLRELCQQWLQPETHTKEQILELLVLEQFLIILP
FT                   KELQARVQEHHPESREDVVVVLEDLQLDLGETGQQVDPDQPKKQKILVEEMAPLKGVQE
FT                   QQVRHECEVTKPEKEKGEETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERH
FT                   QAKPKEKIEYKCSEREQRFIQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREK
FT                   GHQCHECGKAFQRSSHLVRHQKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYL
FT                   CIHCGKNFRRSSHLNRHQRIHSQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNE
FT                   CGKAFSLTSDLIRHHRIHTGEKPFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGE
FT                   AFRQRSGLFQHQRYHHKDKLA"
FT   CDS             join(1310464..1310883,1311214..1311331,1314739..1315640)
FT                   /codon_start=1
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, isoform CRA_a"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT22610.2
FT                   protein_id=hCP45187.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCN4"
FT                   /db_xref="HGNC:HGNC:12978"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCN4"
FT                   /protein_id="EAX03150.1"
FT                   /translation="MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGL
FT                   GQEPLCKQFRQLRYEETTGPREALSRLRELCQQWLQPETHTKEQILELLVLEQFLIILP
FT                   KELQARVQEHHPESREDVVVVLEDLQLDLGETGQQVDPDQPKKQKILVEEMAPLKGVQE
FT                   QQVRHECEVTKPEKEKGEETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERH
FT                   QAKPKEKIEYKCSEREQRFIQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREK
FT                   GHQCHECGKAFQRSSHLVRHQKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYL
FT                   CIHCGKNFRRSSHLNRHQRIHSQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNE
FT                   CGKAFSLTSDLIRHHRIHTGEKPFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGE
FT                   AFRQRSGLFQHQRYHHKDKLA"
FT   CDS             join(1310464..1310478,1311214..1311331,1314739..1315640)
FT                   /codon_start=1
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, isoform CRA_b"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT2358760.0
FT                   protein_id=hCP1924038.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A087X2F1"
FT                   /db_xref="HGNC:HGNC:12978"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087X2F1"
FT                   /protein_id="EAX03148.1"
FT                   /translation="MATALDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKG
FT                   EETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQ
FT                   RFIQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHL
FT                   VRHQKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRH
FT                   QRIHSQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRI
FT                   HTGEKPFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHK
FT                   DKLA"
FT   CDS             join(1310464..1310478,1311214..1311331,1314739..>1315111)
FT                   /codon_start=1
FT                   /gene="ZNF187"
FT                   /locus_tag="hCG_31430"
FT                   /product="zinc finger protein 187, isoform CRA_c"
FT                   /note="gene_id=hCG31430.2 transcript_id=hCT2358761.0
FT                   protein_id=hCP1924039.0 isoform=CRA_c"
FT                   /protein_id="EAX03149.1"
FT                   /translation="MATALDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKG
FT                   EETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQ
FT                   RFIQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHL
FT                   VRHQK"
FT   gene            1320122..1341328
FT                   /gene="PGBD1"
FT                   /locus_tag="hCG_1811794"
FT                   /note="gene_id=hCG1811794.1"
FT   mRNA            join(1320122..1320462,1322320..1322753,1324094..1324250,
FT                   1325623..1325711,1335359..1335488,1336437..1336533,
FT                   1339266..1341328)
FT                   /gene="PGBD1"
FT                   /locus_tag="hCG_1811794"
FT                   /product="piggyBac transposable element derived 1"
FT                   /note="gene_id=hCG1811794.1 transcript_id=hCT1954680.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(1322358..1322753,1324094..1324250,1325623..1325711,
FT                   1335359..1335488,1336437..1336533,1339266..1340826)
FT                   /codon_start=1
FT                   /gene="PGBD1"
FT                   /locus_tag="hCG_1811794"
FT                   /product="piggyBac transposable element derived 1"
FT                   /note="gene_id=hCG1811794.1 transcript_id=hCT1954680.1
FT                   protein_id=hCP1765540.0"
FT                   /protein_id="EAX03151.1"
FT                   /translation="MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRL
FT                   RFRHFCYQEAHGPQEALAQLRELCHQWLRPEMHTKEQIMELLVLEQFLTILPKELQPCV
FT                   KTYPLESGEEAVTVLENLETGSGDTGQQASVYIQGQDMHPMVAEYQGVSLECQSLQLLP
FT                   GITTLKCEPPQRPQGNPQEVSGPVPHGSAHLQEKNPRDKAVVPVFNPVRSQTLVKTEEE
FT                   TAQAVAAEKWSHLSLTRRNLCGNSAQETVMSLSPMTEEIVTKDRLFKAKQETSEEMEQS
FT                   GEASGKPNRECAPQIPCSTPIATERTVAHLNTLKDRHPGDLWARMHISSLEYAAGDITR
FT                   KGRKKDKARVSELLQGLSFSGDSDVEKDNEPEIQPAQKKLKVSCFPEKSWTKRDIKPNF
FT                   PSWSALDSGLLNLKSEKLNPVELFELFFDDETFNLIVNETNNYASQKNVSLEVTVQEMR
FT                   CVFGVLLLSGFMRHPRREMYWEVSDTDQNLVRDAIRRDRFELIFSNLHFADNGHLDQKD
FT                   KFTKLRPLIKQMNKNFLLYAPLEEYYCFDKSMCECFDSDQFLNGKPIRIGYKIWCGTTT
FT                   QGYLVWFEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKL
FT                   LSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGI
FT                   ISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRI
FT                   RSKKWYSILVSYMIDVAMNNAWQLHRACNPGASLDPLDFRRFVAHFYLEHNAHLSD"
FT   gene            complement(1363278..1394810)
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /note="gene_id=hCG1770259.3"
FT   mRNA            complement(join(1363278..1365395,1365924..1366074,
FT                   1367844..1368255,1375331..1375484,1376297..1376434,
FT                   1380287..1380333,1392401..1392491,1392670..1392734))
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, transcript variant
FT                   hCT1808772"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1808772.3;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 07-JAN-2004"
FT   mRNA            complement(join(1363281..1365395,1365924..1366074,
FT                   1367844..1368255,1375331..1375484,1380287..1380336,
FT                   1392401..1392491,1393862..1394213,1394585..1394810))
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, transcript variant
FT                   hCT1808764"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1808764.3;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 07-JAN-2004"
FT   mRNA            complement(join(1363281..1365395,1365924..1366074,
FT                   1367844..1368319,1374623..1374691))
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, transcript variant
FT                   hCT1954682"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1954682.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 07-JAN-2004"
FT   mRNA            complement(join(1363282..1365395,1365924..1366074,
FT                   1367844..1368319,1374371..1374676))
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, transcript variant
FT                   hCT2350559"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT2350559.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 07-JAN-2004"
FT   mRNA            complement(join(1363290..1365395,1365924..1366074,
FT                   1374371..1374435))
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, transcript variant
FT                   hCT2350558"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT2350558.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 07-JAN-2004"
FT   CDS             complement(join(1364707..1365395,1365924..1366074,
FT                   1367844..1368224))
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, isoform CRA_a"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1808764.3
FT                   protein_id=hCP1712998.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCL4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCL4"
FT                   /protein_id="EAX03152.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
FT   CDS             complement(join(1364707..1365395,1365924..1366074,
FT                   1367844..1368224))
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, isoform CRA_a"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1808772.3
FT                   protein_id=hCP1712834.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCL4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCL4"
FT                   /protein_id="EAX03153.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
FT   CDS             complement(join(1364707..1365395,1365924..1366074,
FT                   1367844..1368224))
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, isoform CRA_a"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT1954682.1
FT                   protein_id=hCP1765538.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCL4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCL4"
FT                   /protein_id="EAX03154.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
FT   CDS             complement(join(1364707..1365395,1365924..1366074,
FT                   1367844..1368224))
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, isoform CRA_a"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT2350559.0
FT                   protein_id=hCP1915809.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCL4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCL4"
FT                   /protein_id="EAX03156.1"
FT                   /translation="MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQF
FT                   CYQETPGPREALSRLRELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHP
FT                   ESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQ
FT                   LRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKR
FT                   DSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSS
FT                   LNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQ
FT                   HQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQK
FT                   IHTGERP"
FT   CDS             complement(join(1364707..1365395,1365924..1365978))
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /locus_tag="hCG_1770259"
FT                   /product="zinc finger protein 323, isoform CRA_b"
FT                   /note="gene_id=hCG1770259.3 transcript_id=hCT2350558.0
FT                   protein_id=hCP1915808.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q96LW9"
FT                   /db_xref="HGNC:HGNC:14097"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96LW9"
FT                   /protein_id="EAX03155.1"
FT                   /translation="MVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDS
FT                   KLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTG
FT                   EKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKP
FT                   YECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQC
FT                   SQCSKLFSKRTLLKKHQKIHTGERP"
FT   gene            1388489..1405282
FT                   /gene="ZNF306"
FT                   /locus_tag="hCG_31429"
FT                   /note="gene_id=hCG31429.4"
FT   mRNA            join(1388489..1388606,1399860..1400007,1401839..1401921,
FT                   1402228..1402351,1403962..1405282)
FT                   /gene="ZNF306"
FT                   /locus_tag="hCG_31429"
FT                   /product="zinc finger protein 306, transcript variant
FT                   hCT2358727"
FT                   /note="gene_id=hCG31429.4 transcript_id=hCT2358727.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   mRNA            join(1388496..1388606,1398061..1398524,1399860..1400007,
FT                   1401839..1401921,1402228..1402351,1403962..1405282)
FT                   /gene="ZNF306"
FT                   /locus_tag="hCG_31429"
FT                   /product="zinc finger protein 306, transcript variant
FT                   hCT22609"
FT                   /note="gene_id=hCG31429.4 transcript_id=hCT22609.3; splice
FT                   donor-acceptor pairs covered / total pairs = 5/5; created
FT                   on 26-AUG-2002"
FT   CDS             join(1398123..1398524,1399860..1400007,1401839..1401921,
FT                   1402228..1402351,1403962..1404821)
FT                   /codon_start=1
FT                   /gene="ZNF306"
FT                   /locus_tag="hCG_31429"
FT                   /product="zinc finger protein 306, isoform CRA_b"
FT                   /note="gene_id=hCG31429.4 transcript_id=hCT22609.3
FT                   protein_id=hCP45184.2 isoform=CRA_b"
FT                   /protein_id="EAX03158.1"
FT                   /translation="MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
FT                   RERFRGFRYPEAAGPREALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGNLQS
FT                   WVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQGQELLCCKMALLTPAPGSQSSQF
FT                   QLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVASRLTPESQGLLKVEDVALT
FT                   LTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCHL
FT                   REDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEK
FT                   PYECEECGKAFIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYE
FT                   CDDCGKTFSQSCSLLEHHRIHTGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPE
FT                   QGEAWKSRMESQLENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGF
FT                   TRISYLVQHQRSHVGKNILSQ"
FT   CDS             join(1399902..1400007,1401839..1401921,1402228..1402351,
FT                   1403962..1404821)
FT                   /codon_start=1
FT                   /gene="ZNF306"
FT                   /locus_tag="hCG_31429"
FT                   /product="zinc finger protein 306, isoform CRA_a"
FT                   /note="gene_id=hCG31429.4 transcript_id=hCT2358727.0
FT                   protein_id=hCP1924037.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9BRR0"
FT                   /db_xref="HGNC:HGNC:13853"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BRR0"
FT                   /protein_id="EAX03157.1"
FT                   /translation="MALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHG
FT                   GCCREDKVVASRLTPESQGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSL
FT                   GDEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQEGRLQRKQKNATGG
FT                   RRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIHQRVHTGEKPY
FT                   ECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIHTGEKPYQCS
FT                   MCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERS
FT                   FTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ"
FT   gene            <1406775..1407889
FT                   /locus_tag="hCG_2042287"
FT                   /note="gene_id=hCG2042287.0"
FT   mRNA            <1406775..1407889
FT                   /locus_tag="hCG_2042287"
FT                   /product="hCG2042287"
FT                   /note="gene_id=hCG2042287.0 transcript_id=hCT2347518.0;
FT                   overlap evidence=yes; created on 18-JUN-2003"
FT   CDS             <1407348..1407713
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042287"
FT                   /product="hCG2042287"
FT                   /note="gene_id=hCG2042287.0 transcript_id=hCT2347518.0
FT                   protein_id=hCP1912604.0"
FT                   /protein_id="EAX03159.1"
FT                   /translation="KYAFIIASTHISHSVSGTSNLFHIYNISQKLWNSNITRLFWSPLI
FT                   VNDLGILIYYLLLYVFCLVEIESLSTILYRTIQVPVFMLVSKAWSFKVFRDLGDTNLTN
FT                   PNVYYLYYSNKPYGYFV"
FT   gene            <1410181..1411748
FT                   /locus_tag="hCG_2040873"
FT                   /note="gene_id=hCG2040873.0"
FT   mRNA            join(<1410181..1410291,1411506..1411748)
FT                   /locus_tag="hCG_2040873"
FT                   /product="hCG2040873"
FT                   /note="gene_id=hCG2040873.0 transcript_id=hCT2346104.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-JUN-2003"
FT   CDS             <1411597..1411719
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040873"
FT                   /product="hCG2040873"
FT                   /note="gene_id=hCG2040873.0 transcript_id=hCT2346104.0
FT                   protein_id=hCP1912594.0"
FT                   /protein_id="EAX03160.1"
FT                   /translation="TFHLMNYAFDVNFKNLCLALGSDASKRSQVLGIILAHDPF"
FT   gene            complement(1417493..1438269)
FT                   /gene="ZNF96"
FT                   /locus_tag="hCG_2043480"
FT                   /note="gene_id=hCG2043480.0"
FT   mRNA            complement(join(1417493..1420810,1420914..1421147,
FT                   1429131..1430277,1431437..1431581,1436539..1437008,
FT                   1438192..1438269))
FT                   /gene="ZNF96"
FT                   /locus_tag="hCG_2043480"
FT                   /product="zinc finger protein 96, transcript variant
FT                   hCT2282041"
FT                   /note="gene_id=hCG2043480.0 transcript_id=hCT2282041.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/5;
FT                   created on 18-DEC-2003"
FT   mRNA            complement(join(1417757..1419409,1420729..1421147,
FT                   1429131..1430277,1431437..1431581,1436539..1437008,
FT                   1438192..1438266))
FT                   /gene="ZNF96"
FT                   /locus_tag="hCG_2043480"
FT                   /product="zinc finger protein 96, transcript variant
FT                   hCT2350374"
FT                   /note="gene_id=hCG2043480.0 transcript_id=hCT2350374.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 18-DEC-2003"
FT   CDS             complement(join(1421027..1421147,1429131..1430277,
FT                   1431437..1431581,1436539..1436940))
FT                   /codon_start=1
FT                   /gene="ZNF96"
FT                   /locus_tag="hCG_2043480"
FT                   /product="zinc finger protein 96, isoform CRA_a"
FT                   /note="gene_id=hCG2043480.0 transcript_id=hCT2350374.0
FT                   protein_id=hCP1915624.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCI2"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCI2"
FT                   /protein_id="EAX03161.1"
FT                   /translation="MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVF
FT                   RQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQA
FT                   WVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQ
FT                   SMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSAR
FT                   CGETREPEEITEEPSACSREDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGK
FT                   AFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFG
FT                   RWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRS
FT                   ILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQ
FT                   HQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQR
FT                   IHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLK
FT                   NHSEPQAGVNLLLSSLIPEWQSCFRRDL"
FT   CDS             complement(join(1421027..1421147,1429131..1430277,
FT                   1431437..1431581,1436539..1436940))
FT                   /codon_start=1
FT                   /gene="ZNF96"
FT                   /locus_tag="hCG_2043480"
FT                   /product="zinc finger protein 96, isoform CRA_a"
FT                   /note="gene_id=hCG2043480.0 transcript_id=hCT2282041.1
FT                   protein_id=hCP1853106.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCI2"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCI2"
FT                   /protein_id="EAX03162.1"
FT                   /translation="MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVF
FT                   RQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQA
FT                   WVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETVRLRKEGEPSMSLQ
FT                   SMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKFENDMSKSAR
FT                   CGETREPEEITEEPSACSREDKQPTCDENGVSLTENSDHTEHQRICPGEESYGCDDCGK
FT                   AFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFG
FT                   RWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRS
FT                   ILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQ
FT                   HQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQR
FT                   IHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLK
FT                   NHSEPQAGVNLLLSSLIPEWQSCFRRDL"
FT   gene            complement(1460666..1463709)
FT                   /locus_tag="hCG_2043481"
FT                   /note="gene_id=hCG2043481.0"
FT   mRNA            complement(join(1460666..1462366,1462869..1463709))
FT                   /locus_tag="hCG_2043481"
FT                   /product="hCG2043481"
FT                   /note="gene_id=hCG2043481.0 transcript_id=hCT2282043.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 18-DEC-2003"
FT   CDS             complement(join(1462352..1462366,1462869..1463030))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2043481"
FT                   /product="hCG2043481"
FT                   /note="gene_id=hCG2043481.0 transcript_id=hCT2282043.1
FT                   protein_id=hCP1853115.1"
FT                   /protein_id="EAX03163.1"
FT                   /translation="MLLNSITYHREIVHERKNQLMQQTSVLSCFKKLPQPPEPSAVITL
FT                   ISHESADIKPFTQ"
FT   gene            complement(1464036..>1482005)
FT                   /locus_tag="hCG_1999309"
FT                   /note="gene_id=hCG1999309.1"
FT   mRNA            complement(join(1464036..1464931,1465130..1465241,
FT                   1470459..1470577,1472977..1473603,1474384..1474868,
FT                   1481924..1482005))
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, transcript variant hCT2282044"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282044.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 18-DEC-2003"
FT   mRNA            complement(join(1471182..1473603,1473985..1474132,
FT                   1474384..1474868,1481924..1481992))
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, transcript variant hCT2282042"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282042.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 18-DEC-2003"
FT   CDS             complement(join(1472990..1473603,1473985..1474132,
FT                   1474384..1474791))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, isoform CRA_a"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282042.1
FT                   protein_id=hCP1853118.1 isoform=CRA_a"
FT                   /protein_id="EAX03164.1"
FT                   /translation="MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTRE
FT                   IFRRRFRQFCYQESPGPREALQRLQELCHQWLRPEMHTKEQILELLVLEQFLTILPEEL
FT                   QAWVRQHRPVSGEEAVTVLEDLERELDDPGEQVLSHAHEQEEFVKEKATPGAAQESSND
FT                   QFQTLEEQLGYNLREVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQ
FT                   IPEYGDTCDREGRLEKQRVSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDE
FT                   CGRAFSQRSGLFQHQRLHTGEKRYQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNK
FT                   SFSRRSVLIKHQRIHTGERPYECEECGKNFIYHCNLIQHRKVHPVAESS"
FT   mRNA            complement(join(<1473191..1473603,1473985..1474132,
FT                   1481924..>1482005))
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, transcript variant hCT2282040"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282040.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-DEC-2003"
FT   CDS             complement(join(<1473191..1473603,1473985..1474132,
FT                   1481924..>1481950))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, isoform CRA_c"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282040.1
FT                   protein_id=hCP1853109.1 isoform=CRA_c"
FT                   /protein_id="EAX03166.1"
FT                   /translation="VASPLTDASVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQL
FT                   GYNLREVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCD
FT                   REGRLEKQRVSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRS
FT                   GLFQHQRLHTGEKRYQCSVCGKAFSQNAGLFHH"
FT   CDS             complement(join(1473571..1473603,1474384..1474791))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999309"
FT                   /product="hCG1999309, isoform CRA_b"
FT                   /note="gene_id=hCG1999309.1 transcript_id=hCT2282044.1
FT                   protein_id=hCP1853116.1 isoform=CRA_b"
FT                   /db_xref="GOA:G3V1D5"
FT                   /db_xref="HGNC:HGNC:21193"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="UniProtKB/TrEMBL:G3V1D5"
FT                   /protein_id="EAX03165.1"
FT                   /translation="MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTRE
FT                   IFRRRFRQFCYQESPGPREALQRLQELCHQWLRPEMHTKEQILELLVLEQFLTILPEEL
FT                   QAWVRQHRPVSGEEAVTVLEDLERELDDPGEQMARLGLGMWS"
FT   gene            1485451..1487853
FT                   /pseudo
FT                   /locus_tag="hCG_1640468"
FT                   /note="gene_id=hCG1640468.2"
FT   mRNA            1485451..1487853
FT                   /pseudo
FT                   /locus_tag="hCG_1640468"
FT                   /note="gene_id=hCG1640468.2 transcript_id=hCT1640595.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(1541822..1554318)
FT                   /gene="GPX6"
FT                   /locus_tag="hCG_1643762"
FT                   /note="gene_id=hCG1643762.4"
FT   mRNA            complement(join(1541822..1543024,1544229..1544328,
FT                   1544838..1544955,1549276..1549429,1554182..1554318))
FT                   /gene="GPX6"
FT                   /locus_tag="hCG_1643762"
FT                   /product="glutathione peroxidase 6 (olfactory)"
FT                   /note="gene_id=hCG1643762.4 transcript_id=hCT1643889.4;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 06-OCT-2003"
FT   CDS             complement(join(1549298..1549429,1554182..1554268))
FT                   /codon_start=1
FT                   /gene="GPX6"
FT                   /locus_tag="hCG_1643762"
FT                   /product="glutathione peroxidase 6 (olfactory)"
FT                   /note="gene_id=hCG1643762.4 transcript_id=hCT1643889.4
FT                   protein_id=hCP1626328.4; truncated CDS from selenoprotein"
FT                   /db_xref="GOA:A3KN74"
FT                   /db_xref="HGNC:HGNC:4558"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="UniProtKB/TrEMBL:A3KN74"
FT                   /protein_id="EAX03167.1"
FT                   /translation="MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGA
FT                   LTLNGEEYIQFKQFAGKHVLFVNVAAY"
FT   gene            1564539..>1572658
FT                   /gene="GPX5"
FT                   /locus_tag="hCG_22448"
FT                   /note="gene_id=hCG22448.2"
FT   mRNA            join(1564539..1564627,1567942..1568095,1570269..1570386,
FT                   1570812..1570911,1572452..>1572658)
FT                   /gene="GPX5"
FT                   /locus_tag="hCG_22448"
FT                   /product="glutathione peroxidase 5 (epididymal
FT                   androgen-related protein), transcript variant hCT22605"
FT                   /note="gene_id=hCG22448.2 transcript_id=hCT22605.1; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 26-AUG-2002"
FT   mRNA            join(1564539..1564627,1567942..1568095,1570812..1570911,
FT                   1572452..1572658)
FT                   /gene="GPX5"
FT                   /locus_tag="hCG_22448"
FT                   /product="glutathione peroxidase 5 (epididymal
FT                   androgen-related protein), transcript variant hCT1961726"
FT                   /note="gene_id=hCG22448.2 transcript_id=hCT1961726.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 26-AUG-2002"
FT   CDS             join(1564541..1564627,1567942..1568095,1570269..1570386,
FT                   1570812..1570911,1572452..1572658)
FT                   /codon_start=1
FT                   /gene="GPX5"
FT                   /locus_tag="hCG_22448"
FT                   /product="glutathione peroxidase 5 (epididymal
FT                   androgen-related protein), isoform CRA_b"
FT                   /note="gene_id=hCG22448.2 transcript_id=hCT22605.1
FT                   protein_id=hCP45186.1 isoform=CRA_b"
FT                   /db_xref="GOA:V9HWN8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:V9HWN8"
FT                   /protein_id="EAX03169.1"
FT                   /translation="MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEA
FT                   IALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQF
FT                   GKQEPGDNKEILPGLKYVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEIL
FT                   GTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK"
FT   CDS             join(1564541..1564627,1567942..1568095,1570812..1570873)
FT                   /codon_start=1
FT                   /gene="GPX5"
FT                   /locus_tag="hCG_22448"
FT                   /product="glutathione peroxidase 5 (epididymal
FT                   androgen-related protein), isoform CRA_a"
FT                   /note="gene_id=hCG22448.2 transcript_id=hCT1961726.0
FT                   protein_id=hCP1774516.0 isoform=CRA_a"
FT                   /db_xref="GOA:O75715"
FT                   /db_xref="HGNC:HGNC:4557"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2I3Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75715"
FT                   /protein_id="EAX03168.1"
FT                   /translation="MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEA
FT                   IALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM"
FT   gene            complement(1610122..1625829)
FT                   /gene="ZNF452"
FT                   /locus_tag="hCG_1999306"
FT                   /note="gene_id=hCG1999306.1"
FT   mRNA            complement(join(1610122..1612318,1613135..1614627,
FT                   1617764..1617911,1624790..1625829))
FT                   /gene="ZNF452"
FT                   /locus_tag="hCG_1999306"
FT                   /product="zinc finger protein 452"
FT                   /note="gene_id=hCG1999306.1 transcript_id=hCT2282036.1;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(1610402..1612318,1613135..1614627,
FT                   1617764..1617911,1624790..1625209))
FT                   /codon_start=1
FT                   /gene="ZNF452"
FT                   /locus_tag="hCG_1999306"
FT                   /product="zinc finger protein 452"
FT                   /note="gene_id=hCG1999306.1 transcript_id=hCT2282036.1
FT                   protein_id=hCP1853120.0"
FT                   /db_xref="GOA:A0A1U9X8W9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U9X8W9"
FT                   /protein_id="EAX03170.1"
FT                   /translation="MEAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLS
FT                   YTRELSRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQFLTIL
FT                   PEELQSWVREHNPESGEEVVTLLEDLERELDEPRQQVSQGTYGQEVSMEEMIPLDSAKE
FT                   SLGTQLQSMEDRMECESPEPHPLQDNGSFLWFSMMSQSMGGDNLSSLDTNEAEIEPENM
FT                   REKFFRSLARLLENKSNNTKIFSKAKYCQLIKEVKEAKAKAKKESVDYRRLARFDVILV
FT                   QGNEKLIEAVNGETDKIRYYLHSEDLFDILHNTHLSIGHGGRTRMEKELQAKYKNITKE
FT                   VIMLYLTLCKPCQQKNSKLKKVLTSKSIKEVSSRCQVDLIDMQLNPDGEYRFILHYQDL
FT                   CTKLTFLRSLKSKRPTEVAHALLDIFTIIGAPSVLQSDNGREFSSQVVSELSNIWPELK
FT                   IVHGKSQTCQSQSSAEQTEDIRKRIFSWMQTNNSSHWTEFLWFIQMSQNQPYHRSMQQT
FT                   PCESAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSS
FT                   DIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGT
FT                   EGCGRQITCSLCYETSTMKRKHDEIQRSLPVKPSKMLKPSGTPFSPDKVGDWMAKQASL
FT                   DFFVKKRHAFSEHSSSNKRNVNNRSYPEEGKTKRVHASFTRKYDPSYIEFGFVAVIDGE
FT                   VLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNV
FT                   SHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSN
FT                   DTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDDDIKEE
FT                   FFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKE
FT                   LAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEA
FT                   DHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSD
FT                   IFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVG
FT                   NDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQD
FT                   KLLKLATDEGLKISFENTASLPSFWIKAKNDYPELAEIALKLLLLFPSTYLCETGFSTL
FT                   SVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH"
FT   gene            <1625870..1630239
FT                   /locus_tag="hCG_2038474"
FT                   /note="gene_id=hCG2038474.0"
FT   mRNA            join(<1625870..1626224,1627721..1630239)
FT                   /locus_tag="hCG_2038474"
FT                   /product="hCG2038474"
FT                   /note="gene_id=hCG2038474.0 transcript_id=hCT2342900.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 07-APR-2003"
FT   CDS             <1628428..1628754
FT                   /codon_start=1
FT                   /locus_tag="hCG_2038474"
FT                   /product="hCG2038474"
FT                   /note="gene_id=hCG2038474.0 transcript_id=hCT2342900.0
FT                   protein_id=hCP1908723.0"
FT                   /protein_id="EAX03171.1"
FT                   /translation="DNSPSSAFSSPLYFLVSPLTPTATSGNPSKASSPGGLGSLVSTAS
FT                   SLPAGEKNSPRTGPGPRRAGSWHSQFRTRHGGGALQLVWETREMGVKRPLPSAVRLASR
FT                   LFSS"
FT   gene            complement(1686777..1692970)
FT                   /locus_tag="hCG_1814881"
FT                   /note="gene_id=hCG1814881.1"
FT   mRNA            complement(join(1686777..1687144,1687389..1687559,
FT                   1692927..1692970))
FT                   /locus_tag="hCG_1814881"
FT                   /product="hCG1814881"
FT                   /note="gene_id=hCG1814881.1 transcript_id=hCT1814882.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1687096..1687144,1687389..1687492))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1814881"
FT                   /product="hCG1814881"
FT                   /note="gene_id=hCG1814881.1 transcript_id=hCT1814882.0
FT                   protein_id=hCP1768854.0"
FT                   /protein_id="EAX03172.1"
FT                   /translation="MRKAELGKTLSGDASPSGFHLCPLSGAAGTQASSRIQPLDDSKSP
FT                   QCHGM"
FT   gene            1770503..1771390
FT                   /pseudo
FT                   /locus_tag="hCG_1643197"
FT                   /note="gene_id=hCG1643197.4"
FT   mRNA            1770503..1771390
FT                   /pseudo
FT                   /locus_tag="hCG_1643197"
FT                   /note="gene_id=hCG1643197.4 transcript_id=hCT1643324.3;
FT                   overlap evidence=yes; created on 05-JAN-2004"
FT   gene            complement(1821931..>1824675)
FT                   /locus_tag="hCG_1811792"
FT                   /note="gene_id=hCG1811792.1"
FT   mRNA            complement(1821931..1822414)
FT                   /locus_tag="hCG_1811792"
FT                   /product="hCG1811792, transcript variant hCT1954678"
FT                   /note="gene_id=hCG1811792.1 transcript_id=hCT1954678.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(1822036..1822335)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811792"
FT                   /product="hCG1811792, isoform CRA_a"
FT                   /note="gene_id=hCG1811792.1 transcript_id=hCT1954678.0
FT                   protein_id=hCP1765560.1 isoform=CRA_a"
FT                   /protein_id="EAX03173.1"
FT                   /translation="MEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSLPKRKKSSPK
FT                   EETVNDTEESGHRSGSKKTRKFSKEELVSSGPEEAAGKSSSKKKKKFHKASQED"
FT   mRNA            complement(join(<1822039..1822299,1824544..>1824675))
FT                   /locus_tag="hCG_1811792"
FT                   /product="hCG1811792, transcript variant hCT2282033"
FT                   /note="gene_id=hCG1811792.1 transcript_id=hCT2282033.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1822039..1822299,1824544..1824675))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811792"
FT                   /product="hCG1811792, isoform CRA_b"
FT                   /note="gene_id=hCG1811792.1 transcript_id=hCT2282033.0
FT                   protein_id=hCP1853130.0 isoform=CRA_b"
FT                   /protein_id="EAX03174.1"
FT                   /translation="MSPLTYRGHRGNAAEMGTQAAQILWQPRVLVHFAPPPPLLPQPQK
FT                   KKSFSKEELMSSDLEETAGSTSLPKRKKSSPKEETVNDTEESGHRSGSKKTRKFSKEEL
FT                   VSSGPEEAAGKSSSKKKKKFHKASQED"
FT   gene            complement(<1849023..>1872351)
FT                   /locus_tag="hCG_1814877"
FT                   /note="gene_id=hCG1814877.1"
FT   mRNA            complement(join(<1849023..1849173,1852381..1852501,
FT                   1852550..1852703,1863119..1863244,1863591..1863920,
FT                   1872274..>1872351))
FT                   /locus_tag="hCG_1814877"
FT                   /product="hCG1814877"
FT                   /note="gene_id=hCG1814877.1 transcript_id=hCT1814878.1;
FT                   splice donor-acceptor pairs covered / total pairs = 0/5;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<1849023..1849173,1852381..1852501,
FT                   1852550..1852703,1863119..1863244,1863591..1863920,
FT                   1872274..1872351))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1814877"
FT                   /product="hCG1814877"
FT                   /note="gene_id=hCG1814877.1 transcript_id=hCT1814878.1
FT                   protein_id=hCP1768850.1"
FT                   /protein_id="EAX03175.1"
FT                   /translation="MVTTSVNSRVEDQLGRSSFFCFSQLSPNKIRRFHCPAQSRSCRQI
FT                   PLLTLNTDTQEIGKSLQLPQKLSVSAVPEPANKKRNITCSSKEPSLSIERWKERRGALA
FT                   AVAVWTKRTRSLSWSSLPPYLSSLISRRSDGEHRLRLRPDGERRQAAGINLEECCFLSG
FT                   EVRALQEGEKKRKKPGMSPLAYRGQRGKAAEMGFRAALRLPAHPDPLAASGARPLRFSS
FT                   AFAAAAAGGPRSPLHPSFLECQNWSHSVPKTKSMLGFATMVLAQALAGTKKTVAAHVVN
FT                   TDCTSTSPFCNSCDALQVLSQELDVRSKGARCKRQEEFL"
FT   gene            1899647..1900263
FT                   /pseudo
FT                   /locus_tag="hCG_22473"
FT                   /note="gene_id=hCG22473.2"
FT   mRNA            1899647..1900263
FT                   /pseudo
FT                   /locus_tag="hCG_22473"
FT                   /note="gene_id=hCG22473.2 transcript_id=hCT13570.3; overlap
FT                   evidence=no; created on 26-JAN-2004"
FT   gene            complement(1941221..1962204)
FT                   /gene="RFP"
FT                   /locus_tag="hCG_22183"
FT                   /note="gene_id=hCG22183.4"
FT   mRNA            complement(join(1941221..1942888,1945459..1945485,
FT                   1947027..1947059,1947192..1947307,1949917..1949939,
FT                   1958223..1958453,1960103..1960198,1961424..1962204))
FT                   /gene="RFP"
FT                   /locus_tag="hCG_22183"
FT                   /product="ret finger protein, transcript variant hCT13276"
FT                   /note="gene_id=hCG22183.4 transcript_id=hCT13276.4; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(1941225..1942496,1942777..1942888,
FT                   1945459..1945485,1947027..1947059,1947192..1947307,
FT                   1949917..1949939,1958223..1958453,1960103..1960198,
FT                   1961424..1962204))
FT                   /gene="RFP"
FT                   /locus_tag="hCG_22183"
FT                   /product="ret finger protein, transcript variant
FT                   hCT1966696"
FT                   /note="gene_id=hCG22183.4 transcript_id=hCT1966696.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(1942293..1942888,1945459..1945485,
FT                   1947027..1947059,1947192..1947307,1949917..1949939,
FT                   1958223..1958453,1960103..1960198,1961424..1961843))
FT                   /codon_start=1
FT                   /gene="RFP"
FT                   /locus_tag="hCG_22183"
FT                   /product="ret finger protein, isoform CRA_b"
FT                   /note="gene_id=hCG22183.4 transcript_id=hCT13276.4
FT                   protein_id=hCP39962.2 isoform=CRA_b"
FT                   /db_xref="GOA:P14373"
FT                   /db_xref="HGNC:HGNC:9975"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR020457"
FT                   /db_xref="InterPro:IPR035791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14373"
FT                   /protein_id="EAX03177.1"
FT                   /translation="MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWG
FT                   TAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLK
FT                   LYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQ
FT                   GEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQF
FT                   SCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFA
FT                   QKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRY
FT                   SYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVT
FT                   SAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHT
FT                   FTFSHATFCGPVRPYFSLSYSGGKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP"
FT   CDS             complement(join(1942478..1942496,1942777..1942888,
FT                   1945459..1945485,1947027..1947059,1947192..1947307,
FT                   1949917..1949939,1958223..1958453,1960103..1960198,
FT                   1961424..1961843))
FT                   /codon_start=1
FT                   /gene="RFP"
FT                   /locus_tag="hCG_22183"
FT                   /product="ret finger protein, isoform CRA_a"
FT                   /note="gene_id=hCG22183.4 transcript_id=hCT1966696.1
FT                   protein_id=hCP1780702.0 isoform=CRA_a"
FT                   /db_xref="GOA:P14373"
FT                   /db_xref="HGNC:HGNC:9975"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR020457"
FT                   /db_xref="InterPro:IPR035791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14373"
FT                   /protein_id="EAX03176.1"
FT                   /translation="MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWG
FT                   TAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLK
FT                   LYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQ
FT                   GEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQF
FT                   SCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFA
FT                   QKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRY
FT                   SYLQQDLPDNPERSPSTT"
FT   assembly_gap    1954310..1954446
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            complement(2007256..2008650)
FT                   /pseudo
FT                   /locus_tag="hCG_25627"
FT                   /note="gene_id=hCG25627.5"
FT   mRNA            complement(2007256..2008650)
FT                   /pseudo
FT                   /locus_tag="hCG_25627"
FT                   /note="gene_id=hCG25627.5 transcript_id=hCT16752.5; overlap
FT                   evidence=yes; created on 27-JAN-2004"
FT   gene            complement(2032993..2037845)
FT                   /gene="ZNF311"
FT                   /locus_tag="hCG_1644209"
FT                   /note="gene_id=hCG1644209.3"
FT   mRNA            complement(join(2032993..2034794,2036942..2037046,
FT                   2037695..2037845))
FT                   /gene="ZNF311"
FT                   /locus_tag="hCG_1644209"
FT                   /product="zinc finger protein 311"
FT                   /note="gene_id=hCG1644209.3 transcript_id=hCT1644336.3;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2033209..2034794,2036942..2037046,
FT                   2037695..2037728))
FT                   /codon_start=1
FT                   /gene="ZNF311"
FT                   /locus_tag="hCG_1644209"
FT                   /product="zinc finger protein 311"
FT                   /note="gene_id=hCG1644209.3 transcript_id=hCT1644336.3
FT                   protein_id=hCP1638316.3"
FT                   /protein_id="EAX03178.1"
FT                   /translation="MLENYGNMVSLGFPFPKPPLISHLEREVDPCVQDPQDRESLSCSY
FT                   PVSADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPKVREVCVQDVKLENQWE
FT                   TSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKVLIAQKLHECARCGKN
FT                   FSWHSDLILHEQIHSGEKPHVCNECGKAFKTRNQLSMHRIIHTGEKPFNCTQCGKAFNS
FT                   RSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQLIHTGEKPYKCNCCGKAFQFKHS
FT                   LTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKCGRAFSRSSDLSK
FT                   HKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAFRHNCKRRAHER
FT                   EHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKCLECGKAFSGKSNLTNHRRIHT
FT                   GEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIGHKRVHTGEK
FT                   PYECEECGKAFRVSSNLTGHKKRKHQVWSTHELDGSRKSLSPVTVSQTSVVSILTSA"
FT   gene            complement(<2049709..>2083383)
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /note="gene_id=hCG1999796.0"
FT   mRNA            complement(join(<2049709..2049912,2054985..2055110,
FT                   2065219..>2065815))
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, transcript variant hCT2282890"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282890.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<2049709..2049912,2054985..2055110,
FT                   2065219..2065815))
FT                   /codon_start=1
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282890.0
FT                   protein_id=hCP1853627.0 isoform=CRA_a"
FT                   /protein_id="EAX03179.1"
FT                   /translation="METSSVSSGTDFILLGFSDRPQLEHIISVVVFIIYIVTLVGNTTI
FT                   ILVSYLDTQLHTFMYFFLSNLSFLDLCYTTSIIPQMLANQWGPKKSITYGGCVLQFFFV
FT                   LDLGATECLLLAVMAYDRYAAVCQPLHYTLKCTLSFATAWLSGLASALIVCSLTLKLPR
FT                   CGHREVDNFFCEMPALIKMACVYSKVIEIVVFAFGVKTALRACTRWCLRRAWTPGPLRA
FT                   LAFVLALNGDQDVFLLCDSSSRKGASPLGLDAATQTCPAASASRLCGPSIARSPPSPFS
FT                   PGEVEGTTTPFAARKQETERFSIPQSPW"
FT   mRNA            complement(join(2064900..2065820,2082242..2082342,
FT                   2082428..>2083383))
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, transcript variant hCT2282889"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282889.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/2;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2064976..2065820,2082242..2082342,
FT                   2082428..2083383))
FT                   /codon_start=1
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, isoform CRA_b"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282889.0
FT                   protein_id=hCP1853625.0 isoform=CRA_b"
FT                   /protein_id="EAX03180.1"
FT                   /translation="MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAI
FT                   ILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVY
FT                   MWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLT
FT                   LNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIA
FT                   KAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVI
FT                   TPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKSWRSINIIIIYKHFVDANKIT
FT                   TILLSSFMSLIIGTMETSSVSSGTDFILLGFSDRPQLEHIISVVVFIIYIVTLVGNTTI
FT                   ILVSYLDTQLHTFMYFFLSNLSFLDLCYTTSIIPQMLANQWGPKKSITYGGCVLQFFFV
FT                   LDLGATECLLLAVMAYDRYAAVCQPLHYTLKCTLSFATAWLSGLASALIVCSLTLKLPR
FT                   CGHREVDNFFCEMPALIKMACVYSKVIEIVVFAFGVVFLFVPLSLILISYGVITQAVMR
FT                   IKSATRLQKILNTCGSHLTVVILFYGTIIYIYMKPQNTISQDEGKFFTLLHNHHTQP"
FT   mRNA            complement(<2082421..>2083383)
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, transcript variant hCT2282888"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282888.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2082421..2083383)
FT                   /codon_start=1
FT                   /gene="OR2W1"
FT                   /locus_tag="hCG_1999796"
FT                   /product="olfactory receptor, family 2, subfamily W, member
FT                   1, isoform CRA_c"
FT                   /note="gene_id=hCG1999796.0 transcript_id=hCT2282888.0
FT                   protein_id=hCP1853624.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9Y3N9"
FT                   /db_xref="HGNC:HGNC:8281"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y3N9"
FT                   /protein_id="EAX03181.1"
FT                   /translation="MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAI
FT                   ILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVY
FT                   MWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLT
FT                   LNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIA
FT                   KAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVI
FT                   TPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS"
FT   gene            complement(<2124509..>2125450)
FT                   /gene="OR2B3"
FT                   /locus_tag="hCG_25622"
FT                   /note="gene_id=hCG25622.2"
FT   mRNA            complement(<2124509..>2125450)
FT                   /gene="OR2B3"
FT                   /locus_tag="hCG_25622"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   3"
FT                   /note="gene_id=hCG25622.2 transcript_id=hCT16747.1; overlap
FT                   evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2124509..2125450)
FT                   /codon_start=1
FT                   /gene="OR2B3"
FT                   /locus_tag="hCG_25622"
FT                   /product="olfactory receptor, family 2, subfamily B, member
FT                   3"
FT                   /note="gene_id=hCG25622.2 transcript_id=hCT16747.1
FT                   protein_id=hCP42369.1"
FT                   /db_xref="GOA:O76000"
FT                   /db_xref="HGNC:HGNC:8238"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76000"
FT                   /protein_id="EAX03182.1"
FT                   /translation="MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSI
FT                   MMVCILDPKLHTPMYFFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIF
FT                   LALGATECLLLAVMSFDRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLT
FT                   LNMPRCGHQEVDHFFCEVPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIA
FT                   QAVLKIRSAEGRQKAFGTCGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGII
FT                   TSMLNSLIYSLRNKDMKEAFKRLMPRIFFCKK"
FT   gene            2139152..2140090
FT                   /pseudo
FT                   /locus_tag="hCG_1645048"
FT                   /note="gene_id=hCG1645048.2"
FT   mRNA            2139152..2140090
FT                   /pseudo
FT                   /locus_tag="hCG_1645048"
FT                   /note="gene_id=hCG1645048.2 transcript_id=hCT1645175.1;
FT                   overlap evidence=no; created on 03-FEB-2004"
FT   gene            complement(<2176086..>2177019)
FT                   /locus_tag="hCG_1748527"
FT                   /note="gene_id=hCG1748527.2"
FT   mRNA            complement(join(<2176086..2176546,2176581..>2177019))
FT                   /locus_tag="hCG_1748527"
FT                   /product="hCG1748527, transcript variant hCT2282880"
FT                   /note="gene_id=hCG1748527.2 transcript_id=hCT2282880.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(<2176086..2177019)
FT                   /locus_tag="hCG_1748527"
FT                   /product="hCG1748527, transcript variant hCT1786905"
FT                   /note="gene_id=hCG1748527.2 transcript_id=hCT1786905.2;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             complement(join(<2176086..2176546,2176581..2177019))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1748527"
FT                   /product="hCG1748527, isoform CRA_a"
FT                   /note="gene_id=hCG1748527.2 transcript_id=hCT2282880.0
FT                   protein_id=hCP1853622.0 isoform=CRA_a"
FT                   /protein_id="EAX03183.1"
FT                   /translation="MPLTNESHPEEFILLGFADRPWLELPLFTSLLIMYPIAVMGNITI
FT                   ILMSRLDSRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGSSKKTISYMGCAVQLYFF
FT                   HIMGGTECLLLAIMSFDRYVAICRPLHYTLIMNQRVCILSFHQATATLQLPLCGLNKLD
FT                   HLVCEIPVLIKIACGEKGSNELTLSVVCIFMLAVPLCLILASYASIGSAVFKIKSSKGR
FT                   KKAFGTCSSHLIVVFLFYGPAISMYLQPPSSISRDQPKFMALFYGVVTPSLNPFIYTLR
FT                   NKNVKGALRNLVRSIFSFK"
FT   CDS             complement(<2176086..2176406)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1748527"
FT                   /product="hCG1748527, isoform CRA_b"
FT                   /note="gene_id=hCG1748527.2 transcript_id=hCT1786905.2
FT                   protein_id=hCP1712931.2 isoform=CRA_b"
FT                   /protein_id="EAX03184.1"
FT                   /translation="MLAVPLCLILASYASIGSAVFKIKSSKGRKKAFGTCSSHLIVVFL
FT                   FYGPAISMYLQPPSSISRDQPKFMALFYGVVTPSLNPFIYTLRNKNVKGALRNLVRSIF
FT                   SFK"
FT   gene            <2211847..>2212785
FT                   /gene="OR2J2"
FT                   /locus_tag="hCG_1748528"
FT                   /note="gene_id=hCG1748528.1"
FT   mRNA            <2211847..>2212785
FT                   /gene="OR2J2"
FT                   /locus_tag="hCG_1748528"
FT                   /product="olfactory receptor, family 2, subfamily J, member
FT                   2"
FT                   /note="gene_id=hCG1748528.1 transcript_id=hCT1786906.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             2211847..2212785
FT                   /codon_start=1
FT                   /gene="OR2J2"
FT                   /locus_tag="hCG_1748528"
FT                   /product="olfactory receptor, family 2, subfamily J, member
FT                   2"
FT                   /note="gene_id=hCG1748528.1 transcript_id=hCT1786906.1
FT                   protein_id=hCP1712934.1"
FT                   /db_xref="GOA:A0A126GVZ0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A126GVZ0"
FT                   /protein_id="EAX03185.1"
FT                   /translation="MMIKKNASSEDFFILLGFSNWPQLEVVLFVVILIFYLMTLTGNLF
FT                   IIILSYVDSHLHTPMYFFLSNLSFLDLCHTTSSIPQLLVNLRGPEKTISYAGCMVQLYF
FT                   VLALGIAECVLLVVMSYDRYVAVCRPLHYTVLMHPRFCHLLAAASWVIGFTISALHSSF
FT                   TFWVPLCGHRLVDHFFCEVPALLRLSCVDTHANELTLMVMSSIFVLIPLILILTTYGAI
FT                   ARAVLSMQSTTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYTV
FT                   VTPSLNPLIYTLRNKHVKGAAKRLLGWEWGK"
FT   gene            2253479..2254422
FT                   /pseudo
FT                   /locus_tag="hCG_1999532"
FT                   /note="gene_id=hCG1999532.2"
FT   mRNA            2253479..2254422
FT                   /pseudo
FT                   /locus_tag="hCG_1999532"
FT                   /note="gene_id=hCG1999532.2 transcript_id=hCT2282393.1;
FT                   overlap evidence=no; created on 12-MAY-2004"
FT   gene            complement(2267470..2268400)
FT                   /pseudo
FT                   /locus_tag="hCG_2044644"
FT                   /note="gene_id=hCG2044644.0"
FT   mRNA            complement(2267470..2268400)
FT                   /pseudo
FT                   /locus_tag="hCG_2044644"
FT                   /note="gene_id=hCG2044644.0 transcript_id=hCT2351846.0;
FT                   overlap evidence=no; created on 12-MAY-2004"
FT   gene            complement(2300870..2302323)
FT                   /pseudo
FT                   /locus_tag="hCG_2044645"
FT                   /note="gene_id=hCG2044645.0"
FT   mRNA            complement(join(2300870..2301237,2301736..2302323))
FT                   /pseudo
FT                   /locus_tag="hCG_2044645"
FT                   /note="gene_id=hCG2044645.0 transcript_id=hCT2351847.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 12-MAY-2004"
FT   gene            complement(2306706..2307665)
FT                   /pseudo
FT                   /locus_tag="hCG_2044643"
FT                   /note="gene_id=hCG2044643.0"
FT   mRNA            complement(2306706..2307665)
FT                   /pseudo
FT                   /locus_tag="hCG_2044643"
FT                   /note="gene_id=hCG2044643.0 transcript_id=hCT2351845.0;
FT                   overlap evidence=no; created on 12-MAY-2004"
FT   gene            2329009..2329969
FT                   /pseudo
FT                   /locus_tag="hCG_1795749"
FT                   /note="gene_id=hCG1795749.3"
FT   mRNA            2329009..2329969
FT                   /pseudo
FT                   /locus_tag="hCG_1795749"
FT                   /note="gene_id=hCG1795749.3 transcript_id=hCT1835009.3;
FT                   overlap evidence=no; created on 05-SEP-2003"
FT   gene            2344887..>2345930
FT                   /gene="OR5U1"
FT                   /locus_tag="hCG_1645046"
FT                   /note="gene_id=hCG1645046.1"
FT   mRNA            2344887..>2345930
FT                   /gene="OR5U1"
FT                   /locus_tag="hCG_1645046"
FT                   /product="olfactory receptor, family 5, subfamily U, member
FT                   1"
FT                   /note="gene_id=hCG1645046.1 transcript_id=hCT1645173.1;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             2344899..2345930
FT                   /codon_start=1
FT                   /gene="OR5U1"
FT                   /locus_tag="hCG_1645046"
FT                   /product="olfactory receptor, family 5, subfamily U, member
FT                   1"
FT                   /note="gene_id=hCG1645046.1 transcript_id=hCT1645173.1
FT                   protein_id=hCP1638322.1"
FT                   /protein_id="EAX03186.1"
FT                   /translation="MHFLPTVFGFLNRVTLGIFRETMVNLTSTSGFLLMGFSDERKLQI
FT                   LHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYFLKHLSLLDLCFISVTVPQSIAN
FT                   SLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDRYAAICQPLHYETIMDPRACRH
FT                   AVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVPQMLKLACSYEFINEIALAAF
FT                   TTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCLPHLFVATFFLSAAGFEFLR
FT                   LPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALRKMLSKEELPQRKMCLKAM
FT                   FKL"
FT   gene            complement(<2367905..>2369337)
FT                   /locus_tag="hCG_1811814"
FT                   /note="gene_id=hCG1811814.1"
FT   mRNA            complement(join(<2367905..2368164,2368275..2368422,
FT                   2368634..2369023,2369161..>2369337))
FT                   /locus_tag="hCG_1811814"
FT                   /product="hCG1811814, transcript variant hCT2282937"
FT                   /note="gene_id=hCG1811814.1 transcript_id=hCT2282937.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(2367905..2369337)
FT                   /locus_tag="hCG_1811814"
FT                   /product="hCG1811814, transcript variant hCT1954728"
FT                   /note="gene_id=hCG1811814.1 transcript_id=hCT1954728.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             complement(join(<2367905..2368164,2368275..2368422,
FT                   2368634..2369023,2369161..2369337))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811814"
FT                   /product="hCG1811814, isoform CRA_b"
FT                   /note="gene_id=hCG1811814.1 transcript_id=hCT2282937.0
FT                   protein_id=hCP1853617.0 isoform=CRA_b"
FT                   /protein_id="EAX03188.1"
FT                   /translation="MSTTRTENAVIMGLSSQNGQLRGPLKPSGGPRGEATQTQQQTNQL
FT                   KNTNTIIALNHKRRLLMRIFEMGWKKPSPFQEESIPIALSGRDILARAKNGTGKSSAHD
FT                   IPLLKRLDLKKDTIQTIVIVPTGGPALQVSQICIQVSKHMGGVKVVMTTGGTNSGDDVL
FT                   RLDDTVHMVIAAPGRILNLIKKGVAKDITQYYAYVTEHQKVHGLTTLFSRLQLNQMIIF
FT                   FNCSQRVEWPAKISQLGIDIQAVNVVINFDFSKLEETYLRHIGRPGHFGHFGLAINLIT
FT                   YGDHFNLKGIEEQLGKEIKPIPSNIDKSLHVAEFHSKAVENEKP"
FT   CDS             complement(2368454..2369017)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1811814"
FT                   /product="hCG1811814, isoform CRA_a"
FT                   /note="gene_id=hCG1811814.1 transcript_id=hCT1954728.0
FT                   protein_id=hCP1765559.1 isoform=CRA_a"
FT                   /protein_id="EAX03187.1"
FT                   /translation="MRIFEMGWKKPSPFQEESIPIALSGRDILARAKNGTGKSSAHDIP
FT                   LLKRLDLKKDTIQTIVIVPTGGPALQVSQICIQVSKHMGGVKVVMTTGGTNSGDDVLRL
FT                   DDTVHMVIAAPGRILNLIKKGVAKVSHVQVIVLDEADKFLSQDFGQLMEDIILMLPEDR
FT                   QILLHSATFPLSIQKFMNSHLQKP"
FT   gene            complement(<2393507..2394554)
FT                   /gene="OR5V1"
FT                   /locus_tag="hCG_1811813"
FT                   /note="gene_id=hCG1811813.2"
FT   mRNA            complement(<2393507..2394554)
FT                   /gene="OR5V1"
FT                   /locus_tag="hCG_1811813"
FT                   /product="olfactory receptor, family 5, subfamily V, member
FT                   1"
FT                   /note="gene_id=hCG1811813.2 transcript_id=hCT2282919.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2393507..2394472)
FT                   /codon_start=1
FT                   /gene="OR5V1"
FT                   /locus_tag="hCG_1811813"
FT                   /product="olfactory receptor, family 5, subfamily V, member
FT                   1"
FT                   /note="gene_id=hCG1811813.2 transcript_id=hCT2282919.0
FT                   protein_id=hCP1853653.0"
FT                   /db_xref="GOA:Q9UGF6"
FT                   /db_xref="HGNC:HGNC:13972"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UGF6"
FT                   /protein_id="EAX03189.1"
FT                   /translation="MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILI
FT                   ILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAF
FT                   VFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLT
FT                   FCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICII
FT                   STILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVV
FT                   TPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY"
FT   gene            complement(2411717..2413585)
FT                   /gene="OR12D3"
FT                   /locus_tag="hCG_25624"
FT                   /note="gene_id=hCG25624.4"
FT   mRNA            complement(2411717..2413585)
FT                   /gene="OR12D3"
FT                   /locus_tag="hCG_25624"
FT                   /product="olfactory receptor, family 12, subfamily D,
FT                   member 3"
FT                   /note="gene_id=hCG25624.4 transcript_id=hCT16749.4; overlap
FT                   evidence=yes; created on 06-OCT-2003"
FT   CDS             complement(2412631..2413581)
FT                   /codon_start=1
FT                   /gene="OR12D3"
FT                   /locus_tag="hCG_25624"
FT                   /product="olfactory receptor, family 12, subfamily D,
FT                   member 3"
FT                   /note="gene_id=hCG25624.4 transcript_id=hCT16749.4
FT                   protein_id=hCP42372.3"
FT                   /db_xref="GOA:D2XT27"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:D2XT27"
FT                   /protein_id="EAX03190.1"
FT                   /translation="MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILV
FT                   MVVLEPQLHSPMYFFLGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHF
FT                   LGSTEAILLAIMAFDRFVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAH
FT                   LSFCGSQKLNHFFYDVKPLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGF
FT                   LLFKNRSCRILHKALSTCASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVT
FT                   PVLNPLIYTLRNKEVMMALKKIFGRKLFKDWQQHH"
FT   gene            <2434851..>2435774
FT                   /gene="OR12D2"
FT                   /locus_tag="hCG_1811815"
FT                   /note="gene_id=hCG1811815.1"
FT   mRNA            <2434851..>2435774
FT                   /gene="OR12D2"
FT                   /locus_tag="hCG_1811815"
FT                   /product="olfactory receptor, family 12, subfamily D,
FT                   member 2"
FT                   /note="gene_id=hCG1811815.1 transcript_id=hCT1954729.0;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             2434851..2435774
FT                   /codon_start=1
FT                   /gene="OR12D2"
FT                   /locus_tag="hCG_1811815"
FT                   /product="olfactory receptor, family 12, subfamily D,
FT                   member 2"
FT                   /note="gene_id=hCG1811815.1 transcript_id=hCT1954729.0
FT                   protein_id=hCP1765525.0"
FT                   /db_xref="GOA:P58182"
FT                   /db_xref="HGNC:HGNC:8178"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58182"
FT                   /protein_id="EAX03191.1"
FT                   /translation="MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLM
FT                   IVISDPRLHSLMYFFLGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHF
FT                   LGSTESMLFAVMAFDLSVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSR
FT                   LNFCGSNRIHHFLCDIKPLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITY
FT                   LFFKTRSCSMLCKALSTCASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVT
FT                   PVLNPLIYTLRNKEVKGALGRVIRRL"
FT   gene            2455423..2456369
FT                   /pseudo
FT                   /locus_tag="hCG_2044290"
FT                   /note="gene_id=hCG2044290.0"
FT   mRNA            2455423..2456369
FT                   /pseudo
FT                   /locus_tag="hCG_2044290"
FT                   /note="gene_id=hCG2044290.0 transcript_id=hCT2282398.1;
FT                   overlap evidence=no; created on 14-APR-2004"
FT   gene            complement(2463645..2495213)
FT                   /locus_tag="hCG_1748532"
FT                   /note="gene_id=hCG1748532.2"
FT   mRNA            complement(join(2463645..2465873,2467053..2467100,
FT                   2468441..2468565,2470004..2470127,2495129..2495213))
FT                   /locus_tag="hCG_1748532"
FT                   /product="hCG1748532, transcript variant hCT1786912"
FT                   /note="gene_id=hCG1748532.2 transcript_id=hCT1786912.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 06-OCT-2003"
FT   mRNA            complement(join(2463645..2465873,2466355..2466607))
FT                   /locus_tag="hCG_1748532"
FT                   /product="hCG1748532, transcript variant hCT2349252"
FT                   /note="gene_id=hCG1748532.2 transcript_id=hCT2349252.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 06-OCT-2003"
FT   CDS             complement(2464835..2465782)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1748532"
FT                   /product="hCG1748532, isoform CRA_a"
FT                   /note="gene_id=hCG1748532.2 transcript_id=hCT2349252.0
FT                   protein_id=hCP1914502.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9GZK7"
FT                   /db_xref="HGNC:HGNC:8176"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GZK7"
FT                   /protein_id="EAX03192.1"
FT                   /translation="MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNM
FT                   LIIVAVVSSQRLHKPMYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFI
FT                   FGSLATAECLLLAVMAYDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVAL
FT                   VAQLRFCGPNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARI
FT                   VVAVLRVPAGASRRRAFSTCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTV
FT                   VTPLFNPVIYTMRNKEVHQALRKILCIKQTETLD"
FT   CDS             complement(2464835..2465782)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1748532"
FT                   /product="hCG1748532, isoform CRA_a"
FT                   /note="gene_id=hCG1748532.2 transcript_id=hCT1786912.1
FT                   protein_id=hCP1712815.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCH9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCH9"
FT                   /protein_id="EAX03193.1"
FT                   /translation="MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNM
FT                   LIIVAVVSSQRLHKPMYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFI
FT                   FGSLATAECLLLAVMAYDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVAL
FT                   VAQLRFCGPNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARI
FT                   VVAVLRVPAGASRRRAFSTCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTV
FT                   VTPLFNPVIYTMRNKEVHQALRKILCIKQTETLD"
FT   gene            2477446..>2479094
FT                   /gene="OR10C1"
FT                   /locus_tag="hCG_1645045"
FT                   /note="gene_id=hCG1645045.2"
FT   mRNA            2477446..>2479094
FT                   /gene="OR10C1"
FT                   /locus_tag="hCG_1645045"
FT                   /product="olfactory receptor, family 10, subfamily C,
FT                   member 1"
FT                   /note="gene_id=hCG1645045.2 transcript_id=hCT1645172.2;
FT                   overlap evidence=yes; created on 14-APR-2004"
FT   CDS             2478156..2479094
FT                   /codon_start=1
FT                   /gene="OR10C1"
FT                   /locus_tag="hCG_1645045"
FT                   /product="olfactory receptor, family 10, subfamily C,
FT                   member 1"
FT                   /note="gene_id=hCG1645045.2 transcript_id=hCT1645172.2
FT                   protein_id=hCP1638318.2"
FT                   /db_xref="GOA:Q6IFQ5"
FT                   /db_xref="HGNC:HGNC:8165"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IFQ5"
FT                   /protein_id="EAX03194.1"
FT                   /translation="MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIV
FT                   VLVSTDAALQSPMYFFLRTLSALEIGYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFL
FT                   FFGATECCLLAAMAYDRYAAICEPLRYPLLLSHRVCLQLAGSAWACGVLVGLGHTPFIF
FT                   SLPFCGPNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGRILV
FT                   TIFRIPSVAGRRKAFSTCSSHLIVVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVVT
FT                   PILNPIIYSLRNTEVKAALKRTIQKTVPMEI"
FT   gene            2495317..2502462
FT                   /gene="OR2H1"
FT                   /locus_tag="hCG_1800160"
FT                   /note="gene_id=hCG1800160.2"
FT   mRNA            join(2495317..2495349,2496596..2496711,2498546..2498596,
FT                   2499637..2502462)
FT                   /gene="OR2H1"
FT                   /locus_tag="hCG_1800160"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   1, transcript variant hCT1839420"
FT                   /note="gene_id=hCG1800160.2 transcript_id=hCT1839420.2;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 06-OCT-2003"
FT   mRNA            join(2495323..2495349,2496596..2496711,2498546..2498596,
FT                   2499641..2502347)
FT                   /gene="OR2H1"
FT                   /locus_tag="hCG_1800160"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   1, transcript variant hCT2358876"
FT                   /note="gene_id=hCG1800160.2 transcript_id=hCT2358876.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 15-JUL-2004"
FT   CDS             2499912..2500862
FT                   /codon_start=1
FT                   /gene="OR2H1"
FT                   /locus_tag="hCG_1800160"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=hCG1800160.2 transcript_id=hCT1839420.2
FT                   protein_id=hCP1712822.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9GZK4"
FT                   /db_xref="HGNC:HGNC:8252"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GZK4"
FT                   /protein_id="EAX03195.1"
FT                   /translation="MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIIL
FT                   LSVLYPRLHSPMYFFLSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLS
FT                   LGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLH
FT                   LPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQA
FT                   VLRINSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTP
FT                   SLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA"
FT   CDS             2499912..2500862
FT                   /codon_start=1
FT                   /gene="OR2H1"
FT                   /locus_tag="hCG_1800160"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   1, isoform CRA_a"
FT                   /note="gene_id=hCG1800160.2 transcript_id=hCT2358876.0
FT                   protein_id=hCP1924106.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A024RCM6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024RCM6"
FT                   /protein_id="EAX03196.1"
FT                   /translation="MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIIL
FT                   LSVLYPRLHSPMYFFLSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLS
FT                   LGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLH
FT                   LPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQA
FT                   VLRINSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTP
FT                   SLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA"
FT   gene            complement(<2524908..>2526044)
FT                   /gene="MAS1L"
FT                   /locus_tag="hCG_1658968"
FT                   /note="gene_id=hCG1658968.3"
FT   mRNA            complement(<2524908..>2526044)
FT                   /gene="MAS1L"
FT                   /locus_tag="hCG_1658968"
FT                   /product="MAS1 oncogene-like"
FT                   /note="gene_id=hCG1658968.3 transcript_id=hCT1659095.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             complement(2524908..2526044)
FT                   /codon_start=1
FT                   /gene="MAS1L"
FT                   /locus_tag="hCG_1658968"
FT                   /product="MAS1 oncogene-like"
FT                   /note="gene_id=hCG1658968.3 transcript_id=hCT1659095.2
FT                   protein_id=hCP1638302.2"
FT                   /db_xref="GOA:P35410"
FT                   /db_xref="HGNC:HGNC:13961"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35410"
FT                   /protein_id="EAX03197.1"
FT                   /translation="MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVS
FT                   QLCGVFLQNETNETIHMQMSMAVGQQALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGA
FT                   TNPYMVYILHLVAADVIYLCCSAVGFLQVTLLTYHGVVFFIPDFLAILSPFSFEVCLCL
FT                   LVAISTERCVCVLFPIWYRCHRPKYTSNVVCTLIWGLPFCINIVKSLFLTYWKHVKACV
FT                   IFLKLSGLFHAILSLVMCVSSLTLLIRFLCCSQQQKATRVYAVVQISAPMFLLWALPLS
FT                   VAPLITDFKMFVTTSYLISLFLIINSSANPIIYFFVGSLRKKRLKESLRVILQRALADK
FT                   PEVGRNKKAAGIDPMEQPHSTQHVENLLPREHRVDVET"
FT   gene            complement(<2527416..>2527742)
FT                   /locus_tag="hCG_1644208"
FT                   /note="gene_id=hCG1644208.2"
FT   mRNA            complement(<2527416..>2527742)
FT                   /locus_tag="hCG_1644208"
FT                   /product="hCG1644208"
FT                   /note="gene_id=hCG1644208.2 transcript_id=hCT1644335.2;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             complement(<2527416..2527742)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1644208"
FT                   /product="hCG1644208"
FT                   /note="gene_id=hCG1644208.2 transcript_id=hCT1644335.2
FT                   protein_id=hCP1638314.2"
FT                   /protein_id="EAX03198.1"
FT                   /translation="MTSTQTSVCEEIPIILSKKLHNRRAGCVTHLTNQIQRGPVRGISI
FT                   KLQEEEKERRDNYVPKVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTRPTVGMNFKM
FT                   PRGAV"
FT   gene            2567573..2571720
FT                   /locus_tag="hCG_1999539"
FT                   /note="gene_id=hCG1999539.1"
FT   mRNA            join(2567573..2567737,2568102..2568196,2569205..2571720)
FT                   /locus_tag="hCG_1999539"
FT                   /product="hCG1999539"
FT                   /note="gene_id=hCG1999539.1 transcript_id=hCT2282402.1;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 06-APR-2004"
FT   CDS             2570405..2570686
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999539"
FT                   /product="hCG1999539"
FT                   /note="gene_id=hCG1999539.1 transcript_id=hCT2282402.1
FT                   protein_id=hCP1853709.1"
FT                   /protein_id="EAX03199.1"
FT                   /translation="MLYPRPKPRGIRELLQSPGQQAALWGPWGLRVWPAHPQLRIDHRV
FT                   LGDSCIGTPSLSSPWTWTSEACGFHSRAWSRDARPLSLPYVSWTPLRS"
FT   gene            2590714..2592661
FT                   /locus_tag="hCG_2040511"
FT                   /note="gene_id=hCG2040511.0"
FT   mRNA            join(2590714..2591044,2591417..2592661)
FT                   /locus_tag="hCG_2040511"
FT                   /product="hCG2040511"
FT                   /note="gene_id=hCG2040511.0 transcript_id=hCT2345740.1;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 29-APR-2004"
FT   CDS             join(2591025..2591044,2591417..2592347)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2040511"
FT                   /product="hCG2040511"
FT                   /note="gene_id=hCG2040511.0 transcript_id=hCT2345740.1
FT                   protein_id=hCP1912586.1"
FT                   /protein_id="EAX03200.1"
FT                   /translation="MLANQASAEERFLLLGFSDWPSLQPVLFALVLLCYLLTLTGNSAL
FT                   VLLAVRDPRLHTPMYYFLCHLALVDAGFTTSVVPPLLANLRGPALWLPRSHCTAQLCAS
FT                   LALGSAECVLLAVMALDRAAAVCRPLRYAGLVSPRLCRTLASASWLSGLTNSVAQTALL
FT                   AERPLCAPRLLDHFICELPALLKLACGGDGDTTENQMFAARVVILLLPFAVILASYGAV
FT                   ARAVCCMRFSGGRRRAVGTCGSHLTAVCLFYGSAIYTYLQPAQRYNQARGKFVSLFYTV
FT                   VTPALNPLIYTLRNKKVKGAARRLLRSLGRGQAGQ"
FT   gene            complement(2593710..2597910)
FT                   /gene="UBD"
FT                   /locus_tag="hCG_25621"
FT                   /note="gene_id=hCG25621.2"
FT   mRNA            complement(join(2593710..2594531,2597856..2597910))
FT                   /gene="UBD"
FT                   /locus_tag="hCG_25621"
FT                   /product="ubiquitin D"
FT                   /note="gene_id=hCG25621.2 transcript_id=hCT16746.3; splice
FT                   donor-acceptor pairs covered / total pairs = 1/1; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(2594061..2594531,2597856..2597882))
FT                   /codon_start=1
FT                   /gene="UBD"
FT                   /locus_tag="hCG_25621"
FT                   /product="ubiquitin D"
FT                   /note="gene_id=hCG25621.2 transcript_id=hCT16746.3
FT                   protein_id=hCP42368.2"
FT                   /db_xref="GOA:O15205"
FT                   /db_xref="HGNC:HGNC:18795"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:2MBE"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15205"
FT                   /protein_id="EAX03201.1"
FT                   /translation="MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPV
FT                   QDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLL
FT                   QVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCI
FT                   GG"
FT   gene            <2612096..>2621135
FT                   /locus_tag="hCG_1999540"
FT                   /note="gene_id=hCG1999540.0"
FT   mRNA            join(<2612096..2612206,2612383..2612546,2612837..2612966,
FT                   2615756..2615906,2620699..>2621135)
FT                   /locus_tag="hCG_1999540"
FT                   /product="hCG1999540, transcript variant hCT2282403"
FT                   /note="gene_id=hCG1999540.0 transcript_id=hCT2282403.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(2612096..2612206,2612383..2612546,2612837..2612966,
FT                   2615756..2615906,2620699..>2621135)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999540"
FT                   /product="hCG1999540, isoform CRA_a"
FT                   /note="gene_id=hCG1999540.0 transcript_id=hCT2282403.0
FT                   protein_id=hCP1853679.0 isoform=CRA_a"
FT                   /protein_id="EAX03202.1"
FT                   /translation="MVNQSSAPGFLLLGFSEHPALERTLFVVVFTSYLLTPFFIFLSLG
FT                   TTECILLTVMAFDRYMAIFKPLRHATIVHLCLCWQLASVAWVIGLVDSVIAVYLQPKNP
FT                   YAQERGKFFGLFYAVGTPSLNPLIYTLRNKETVADYANWDPAVARSRGVKKAITNVVQQ
FT                   EVKSLCVLEASQVPAEEAVSGASQKVVVVQCESINISGKFYRNKLKYLGFLRKRMNTFW
FT                   RPCHFSALAASSGGWCKAHCPTRLTKARPPSTTSRCLTAFHRPMTRKSFGGSCCPQACV
FT                   SEAYKKICPPGHRAYEVSWKYQAVTATLKKRKEKAKIHYQKKKQLMRLQK"
FT   mRNA            2612260..2612837
FT                   /locus_tag="hCG_1999540"
FT                   /product="hCG1999540, transcript variant hCT2282404"
FT                   /note="gene_id=hCG1999540.0 transcript_id=hCT2282404.0;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   CDS             2612323..2612766
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999540"
FT                   /product="hCG1999540, isoform CRA_b"
FT                   /note="gene_id=hCG1999540.0 transcript_id=hCT2282404.0
FT                   protein_id=hCP1853680.0 isoform=CRA_b"
FT                   /protein_id="EAX03203.1"
FT                   /translation="MLVNLWEPKKTIILLGCSVQFFIFLSLGTTECILLTVMAFDRYMA
FT                   IFKPLRHATIVHLCLCWQLASVAWVIGLVESVVQTPSTLRLPFCPHQQVDDFVCEVPAL
FT                   IRLSCEDTSYNEIQMAVASVFILAVPQPHPCLLWSHCLGSAKD"
FT   gene            2626105..2627073
FT                   /gene="OR2H2"
FT                   /locus_tag="hCG_1644207"
FT                   /note="gene_id=hCG1644207.2"
FT   mRNA            2626105..2627073
FT                   /gene="OR2H2"
FT                   /locus_tag="hCG_1644207"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   2"
FT                   /note="gene_id=hCG1644207.2 transcript_id=hCT1644334.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   CDS             2626132..2627070
FT                   /codon_start=1
FT                   /gene="OR2H2"
FT                   /locus_tag="hCG_1644207"
FT                   /product="olfactory receptor, family 2, subfamily H, member
FT                   2"
FT                   /note="gene_id=hCG1644207.2 transcript_id=hCT1644334.2
FT                   protein_id=hCP1638310.2"
FT                   /db_xref="GOA:O95918"
FT                   /db_xref="HGNC:HGNC:8253"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:O95918"
FT                   /protein_id="EAX03204.1"
FT                   /translation="MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIIL
FT                   LSALDPKLHSPMYFFLSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLS
FT                   LGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLH
FT                   LPFCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWA
FT                   VLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTP
FT                   SLNPLIYTLRNKEVTRAFRRLLGKEMGLTQS"
FT   gene            complement(2633540..2671640)
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /note="gene_id=hCG22364.3"
FT   mRNA            complement(join(2633540..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665834,2667275..2667295,
FT                   2669584..2669787,2670489..2670683,2671038..2671080))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT2282896"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282896.0;
FT                   splice donor-acceptor pairs covered / total pairs = 22/22;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2633540..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665834,2667275..2667295,
FT                   2668646..2668831,2669584..2669787,2670489..2670683,
FT                   2671038..2671080))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT2282894"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282894.0;
FT                   splice donor-acceptor pairs covered / total pairs = 23/23;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2633540..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2666232))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT2282893"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282893.0;
FT                   splice donor-acceptor pairs covered / total pairs = 18/18;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2633659..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665834,2667275..2667295,
FT                   2669584..2669787,2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282896.0
FT                   protein_id=hCP1853636.0 isoform=CRA_b"
FT                   /protein_id="EAX03206.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSE
FT                   RRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQA
FT                   TKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFF
FT                   RTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSF
FT                   FSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK
FT                   IYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEET
FT                   GGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEG
FT                   VSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTL
FT                   VIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCS
FT                   LALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEE
FT                   KKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILP
FT                   QLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVL
FT                   CLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTM
FT                   KTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPE
FT                   PSGGLPRGPPEPPDRLSCDGSRVHLLYKDGVSPCYPGWSPTPELKQCIHLGLPKF"
FT   CDS             complement(join(2633659..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665834,2667275..2667295,
FT                   2668646..2668831,2669584..2669787,2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282894.0
FT                   protein_id=hCP1853634.0 isoform=CRA_e"
FT                   /protein_id="EAX03209.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSY
FT                   LTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTP
FT                   HSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDP
FT                   GQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFP
FT                   TFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFR
FT                   QSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADN
FT                   WFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHP
FT                   EETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSS
FT                   FEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPAD
FT                   QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAV
FT                   GCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK
FT                   KEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVS
FT                   ILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNV
FT                   AVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQ
FT                   DTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPT
FT                   PPEPSGGLPRGPPEPPDRLSCDGSRVHLLYKDGVSPCYPGWSPTPELKQCIHLGLPKF"
FT   CDS             complement(join(2633659..2633743,2641734..2641903,
FT                   2642681..2642824,2643047..2643175,2643756..2643883,
FT                   2644578..2644671,2645084..2645191,2645289..2645405,
FT                   2646788..2646920,2647416..2647566,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665979))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282893.0
FT                   protein_id=hCP1853637.0 isoform=CRA_c"
FT                   /protein_id="EAX03207.1"
FT                   /translation="MGPGAPFARVGWPLPLLVVMAAGVAPVWASHSPHLPRPHSRVPPH
FT                   PSSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCD
FT                   PGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF
FT                   PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITF
FT                   RQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYAD
FT                   NWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRH
FT                   PEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSS
FT                   SFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPA
FT                   DQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTA
FT                   VGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFT
FT                   KKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDV
FT                   SILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYN
FT                   VAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEA
FT                   QDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPP
FT                   TPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYKDGVSPCYPGWSPTPELKQCIHLGLPKF
FT                   "
FT   mRNA            complement(join(2640414..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2669584..2669787,
FT                   2670489..2670573,2671038..2671640))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT1961724"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1961724.1;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2640414..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2649111..2649188,2650738..2650801,2651430..2651672,
FT                   2659289..2659480,2659940..2660005,2660292..2660393,
FT                   2661493..2661663,2662078..2662212,2665674..2665834,
FT                   2667275..2667295,2668646..2668831,2669584..2669787,
FT                   2670489..2670573,2671038..2671640))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT1961725"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1961725.1;
FT                   splice donor-acceptor pairs covered / total pairs = 21/21;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2640414..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2668646..2668831,
FT                   2669584..2669787,2670489..2670573,2671038..2671640))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT13458"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT13458.2; splice
FT                   donor-acceptor pairs covered / total pairs = 22/22; created
FT                   on 26-AUG-2002"
FT   mRNA            complement(join(2640414..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2666232))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT1786907"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1786907.2;
FT                   splice donor-acceptor pairs covered / total pairs = 17/17;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2640925..2641818,2642684..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2668646..2668831,
FT                   2669584..2669787,2670489..2670683,2671038..2671080))
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   transcript variant hCT2282891"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282891.0;
FT                   splice donor-acceptor pairs covered / total pairs = 21/22;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(2641105..2641818,2642684..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2668646..2668831,
FT                   2669584..2669787,2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_g"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT2282891.0
FT                   protein_id=hCP1853635.0 isoform=CRA_g"
FT                   /protein_id="EAX03211.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSY
FT                   LTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTP
FT                   HSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDP
FT                   GQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFP
FT                   TFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFR
FT                   QSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADN
FT                   WFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHP
FT                   EETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSS
FT                   FEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPAD
FT                   QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAV
FT                   GCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK
FT                   KEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVS
FT                   ILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNV
FT                   AVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQ
FT                   DTMKTGSSTNNNEEEKSRLLEKENRELEKIIANPLGACPGDPLSPPTGLAVMGVECICF
FT                   ISEGRVREDRPVGGGKGRGEGQGTQEAGGPHPQLGRTCYPISSLVNTCPPVSSGLIWVS
FT                   HTSGKQTFFSLTASCNFVSPLHNLVRTWLEAAHCSHAASSAASLHLSLPMQHPLLVTTA
FT                   TPAAPLPLCSVPVQQGSPNKCSFHPKGASPFLHCHNLFPSYLPFYTFSHVAPPEFCFLW
FT                   ELILFAKAHMLLASALCTHAQHTCILPSPACAH"
FT   CDS             complement(join(2641730..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2669584..2669787,
FT                   2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_f"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1961724.1
FT                   protein_id=hCP1774515.1 isoform=CRA_f"
FT                   /db_xref="GOA:Q9UBS5"
FT                   /db_xref="HGNC:HGNC:4070"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR035976"
FT                   /db_xref="PDB:4MQE"
FT                   /db_xref="PDB:4MQF"
FT                   /db_xref="PDB:4MR7"
FT                   /db_xref="PDB:4MR8"
FT                   /db_xref="PDB:4MR9"
FT                   /db_xref="PDB:4MRM"
FT                   /db_xref="PDB:4MS1"
FT                   /db_xref="PDB:4MS3"
FT                   /db_xref="PDB:4MS4"
FT                   /db_xref="PDB:4PAS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UBS5"
FT                   /protein_id="EAX03210.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSE
FT                   RRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQA
FT                   TKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFF
FT                   RTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSF
FT                   FSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK
FT                   IYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEET
FT                   GGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEG
FT                   VSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTL
FT                   VIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCS
FT                   LALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEE
FT                   KKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILP
FT                   QLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVL
FT                   CLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTM
FT                   KTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPE
FT                   PSGGLPRGPPEPPDRLSCDGSRVHLLYK"
FT   CDS             complement(join(2641730..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665834,2667275..2667295,2668646..2668831,
FT                   2669584..2669787,2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT13458.2
FT                   protein_id=hCP42370.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q9UBS5"
FT                   /db_xref="HGNC:HGNC:4070"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR035976"
FT                   /db_xref="PDB:4MQE"
FT                   /db_xref="PDB:4MQF"
FT                   /db_xref="PDB:4MR7"
FT                   /db_xref="PDB:4MR8"
FT                   /db_xref="PDB:4MR9"
FT                   /db_xref="PDB:4MRM"
FT                   /db_xref="PDB:4MS1"
FT                   /db_xref="PDB:4MS3"
FT                   /db_xref="PDB:4MS4"
FT                   /db_xref="PDB:4PAS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UBS5"
FT                   /protein_id="EAX03205.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSY
FT                   LTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTP
FT                   HSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDP
FT                   GQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFP
FT                   TFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFR
FT                   QSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADN
FT                   WFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHP
FT                   EETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSS
FT                   FEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPAD
FT                   QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAV
FT                   GCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTK
FT                   KEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVS
FT                   ILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNV
FT                   AVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQ
FT                   DTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPT
FT                   PPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK"
FT   CDS             complement(join(2641730..2641903,2642681..2642824,
FT                   2643047..2643175,2643756..2643883,2644578..2644671,
FT                   2645084..2645191,2645289..2645405,2646788..2646920,
FT                   2647416..2647566,2649111..2649188,2650738..2650801,
FT                   2651430..2651672,2659289..2659480,2659940..2660005,
FT                   2660292..2660393,2661493..2661663,2662078..2662212,
FT                   2665674..2665979))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_h"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1786907.2
FT                   protein_id=hCP1712935.1 isoform=CRA_h"
FT                   /db_xref="GOA:Q5SUJ9"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR002455"
FT                   /db_xref="InterPro:IPR002456"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUJ9"
FT                   /protein_id="EAX03212.1"
FT                   /translation="MGPGAPFARVGWPLPLLVVMAAGVAPVWASHSPHLPRPHSRVPPH
FT                   PSSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCD
FT                   PGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF
FT                   PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITF
FT                   RQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYAD
FT                   NWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRH
FT                   PEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSS
FT                   SFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPA
FT                   DQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTA
FT                   VGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFT
FT                   KKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDV
FT                   SILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYN
FT                   VAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEA
FT                   QDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPP
FT                   TPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK"
FT   CDS             complement(join(2646892..2646920,2649111..2649188,
FT                   2650738..2650801,2651430..2651672,2659289..2659480,
FT                   2659940..2660005,2660292..2660393,2661493..2661663,
FT                   2662078..2662212,2665674..2665834,2667275..2667295,
FT                   2668646..2668831,2669584..2669787,2670489..2670573))
FT                   /codon_start=1
FT                   /gene="GABBR1"
FT                   /locus_tag="hCG_22364"
FT                   /product="gamma-aminobutyric acid (GABA) B receptor, 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG22364.3 transcript_id=hCT1961725.1
FT                   protein_id=hCP1774524.1 isoform=CRA_d"
FT                   /protein_id="EAX03208.1"
FT                   /translation="MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRG
FT                   LTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSY
FT                   LTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTP
FT                   HSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDP
FT                   GQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFP
FT                   TFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFR
FT                   QSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADN
FT                   WFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHP
FT                   EETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSS
FT                   FEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIVISRTHS
FT                   PT"
FT   gene            complement(2673623..2674686)
FT                   /pseudo
FT                   /locus_tag="hCG_1748530"
FT                   /note="gene_id=hCG1748530.2"
FT   mRNA            complement(2673623..2674686)
FT                   /pseudo
FT                   /locus_tag="hCG_1748530"
FT                   /note="gene_id=hCG1748530.2 transcript_id=hCT1786910.2;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            2694985..2710546
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /note="gene_id=hCG25629.3"
FT   mRNA            join(2694985..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2708896,2709347..2710546)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT16754"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT16754.2; splice
FT                   donor-acceptor pairs covered / total pairs = 7/7; created
FT                   on 26-AUG-2002"
FT   mRNA            join(2694985..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708349..2708396,
FT                   2708876..2708896,2709597..>2709622)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2282358"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282358.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2694985..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708876..>2708898)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2282356"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282356.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2694985..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708349..2708396,
FT                   2708456..>2708574)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2282357"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282357.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/6;
FT                   created on 26-AUG-2002"
FT   mRNA            join(2695225..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2708896,2709597..2710462)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2358751"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2358751.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   mRNA            join(2695269..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2710462)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2358752"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2358752.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 15-JUL-2004"
FT   mRNA            join(<2695387..2695474,2704327..2704440,2705818..2705838,
FT                   2706079..2706099,2708456..2708572,2708876..2708896,
FT                   2709347..2710546)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT1961755"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT1961755.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 26-AUG-2002"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2708896,2709597..2709625)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_g"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2358751.0
FT                   protein_id=hCP1924034.0 isoform=CRA_g"
FT                   /db_xref="GOA:Q5SSB8"
FT                   /db_xref="HGNC:HGNC:7197"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016663"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SSB8"
FT                   /protein_id="EAX03219.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLV
FT                   ALIICYNWLHRRLAGQFLEELLFHLEALSG"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708349..2708396,
FT                   2708876..2708896,2709597..>2709622)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_e"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282358.0
FT                   protein_id=hCP1853693.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q16653"
FT                   /db_xref="HGNC:HGNC:7197"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016663"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:1Q70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16653"
FT                   /protein_id="EAX03217.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFESFGVLGPQVKEPKKTGQFLEELLF
FT                   HLEALSG"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2708896,2709347..2709360)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_a"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT16754.2
FT                   protein_id=hCP42377.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q16653"
FT                   /db_xref="HGNC:HGNC:7197"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016663"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:1Q70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16653"
FT                   /protein_id="EAX03213.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLV
FT                   ALIICYNWLHRRLAGQFLEELRNPF"
FT   CDS             join(2695387..2695474,2704327..2704440,2705818..2705838,
FT                   2706079..2706099,2708456..2708572,2708876..2708896,
FT                   2709347..2709360)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_b"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT1961755.1
FT                   protein_id=hCP1774509.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q16653"
FT                   /db_xref="HGNC:HGNC:7197"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016663"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:1Q70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16653"
FT                   /protein_id="EAX03214.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYADPFYWVSPGVLVLLAV
FT                   LPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGP
FT                   LVALIICYNWLHRRLAGQFLEELRNPF"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708456..2708572,
FT                   2708876..2709054)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_d"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2358752.0
FT                   protein_id=hCP1924035.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q16653"
FT                   /db_xref="HGNC:HGNC:7197"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016663"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:1Q70"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q16653"
FT                   /protein_id="EAX03216.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLV
FT                   ALIICYNWLHRRLAGQFLEELRKFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKE
FT                   ELESLGGGKTPPGR"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708876..>2708898)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_f"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282356.0
FT                   protein_id=hCP1853694.0 isoform=CRA_f"
FT                   /protein_id="EAX03218.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFGQFLEELR"
FT   CDS             join(2695387..2695474,2697495..2697842,2704327..2704440,
FT                   2705818..2705838,2706079..2706099,2708349..2708396,
FT                   2708456..>2708574)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_h"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282357.0
FT                   protein_id=hCP1853696.0 isoform=CRA_h"
FT                   /protein_id="EAX03220.1"
FT                   /translation="MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALV
FT                   GDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDA
FT                   IGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLP
FT                   VLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFESFGVLGPQVKEPKKTDPHFLRVPC
FT                   WKITLFVIVPVLGPLVALIICYNWLHRRLAG"
FT   mRNA            join(2697494..2697842,2702805..>2702881)
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, transcript
FT                   variant hCT2282359"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282359.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/1;
FT                   created on 26-AUG-2002"
FT   CDS             join(2697596..2697842,2702805..>2702881)
FT                   /codon_start=1
FT                   /gene="MOG"
FT                   /locus_tag="hCG_25629"
FT                   /product="myelin oligodendrocyte glycoprotein, isoform
FT                   CRA_c"
FT                   /note="gene_id=hCG25629.3 transcript_id=hCT2282359.0
FT                   protein_id=hCP1853697.0 isoform=CRA_c"
FT                   /protein_id="EAX03215.1"
FT                   /translation="MEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEG
FT                   KVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEVSHSVTQDWLQWHDHGSLQPPP
FT                   PRLK"
FT   gene            complement(2710656..>2746889)
FT                   /locus_tag="hCG_25623"
FT                   /note="gene_id=hCG25623.3"
FT   mRNA            complement(join(2710656..2711933,2714115..2714241,
FT                   2715063..2715282,2717345..2717458,2746729..>2746889))
FT                   /locus_tag="hCG_25623"
FT                   /product="hCG25623, transcript variant hCT2282885"
FT                   /note="gene_id=hCG25623.3 transcript_id=hCT2282885.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/4;
FT                   created on 26-AUG-2002"
FT   mRNA            complement(join(2710656..2711800,2713603..2713669,
FT                   2714115..2714259))
FT                   /locus_tag="hCG_25623"
FT                   /product="hCG25623, transcript variant hCT16748"
FT                   /note="gene_id=hCG25623.3 transcript_id=hCT16748.3; splice
FT                   donor-acceptor pairs covered / total pairs = 1/2; created
FT                   on 26-AUG-2002"
FT   CDS             complement(join(2710675..2711933,2714115..2714241,
FT                   2715063..2715282,2717345..2717458,2746729..2746889))
FT                   /codon_start=1
FT                   /locus_tag="hCG_25623"
FT                   /product="hCG25623, isoform CRA_a"
FT                   /note="gene_id=hCG25623.3 transcript_id=hCT2282885.0
FT                   protein_id=hCP1853650.0 isoform=CRA_a"
FT                   /protein_id="EAX03221.1"
FT                   /translation="MTKKMIPEVQDNSLPRGCGCAVTHQEGSPAGSQGAHYPHLGAWRT
FT                   SIPENATFYKGDVGEWLSAGKGESSAMFASEQEISKDEQGTPVLGSFYWEVDSPRKESS
FT                   QAWAPGQEWIKLERDTTEEKMFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARV
FT                   KKKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVEGKKKELREQHPSLR
FT                   DEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTCGKCFSRRSYLY
FT                   SHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHR
FT                   RVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIA
FT                   RSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQD
FT                   ARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRL
FT                   VRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFS
FT                   HDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK"
FT   CDS             complement(join(2710675..2711800,2713603..2713669,
FT                   2714115..2714148))
FT                   /codon_start=1
FT                   /locus_tag="hCG_25623"
FT                   /product="hCG25623, isoform CRA_b"
FT                   /note="gene_id=hCG25623.3 transcript_id=hCT16748.3
FT                   protein_id=hCP42371.3 isoform=CRA_b"
FT                   /protein_id="EAX03222.1"
FT                   /translation="MSETFKNLTSVARIFLHKPELITKLEQEEEQWRETRVLQASQAGP
FT                   PFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFC
FT                   CTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQ
FT                   ECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKN
FT                   QAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTE
FT                   PPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLC
FT                   QSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTK
FT                   EAVSILKHK"
FT   gene            2758302..2764856
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /note="gene_id=hCG25628.3"
FT   mRNA            join(2758302..2758527,2758833..2759054,2759185..2759454,
FT                   2759700..2759975,2760558..2760833,2760974..2761090,
FT                   2761538..2761570,2761706..2761753,2762410..2762531,
FT                   2763484..2764856)
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   transcript variant hCT2282365"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282365.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/9;
FT                   created on 17-NOV-2003"
FT   mRNA            join(2758302..2758527,2758833..2759054,2759185..2759454,
FT                   2759700..2759975,2760558..2760833,2760974..2761090,
FT                   2761538..2761570,2762410..2762822)
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   transcript variant hCT2282363"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282363.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 17-NOV-2003"
FT   mRNA            join(2758302..2758527,2758833..2759054,2759185..2759454,
FT                   2759700..2759975,2760558..2760833,2760974..2761090,
FT                   2761538..2761570,2761706..2761753,2761930..2762057)
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   transcript variant hCT16753"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT16753.4; splice
FT                   donor-acceptor pairs covered / total pairs = 8/8; created
FT                   on 17-NOV-2003"
FT   mRNA            join(2758302..2758527,2758833..2759054,2759185..2759454,
FT                   2759700..2759975,2760558..2760833,2760974..2761090,
FT                   2761538..2761570,2761930..2762057)
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   transcript variant hCT2282364"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282364.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 17-NOV-2003"
FT   mRNA            join(2758957..2759054,2759185..2759425,2759927..2759975,
FT                   2760558..2760833,2760974..2761090,2761538..2761570,
FT                   2762410..2762531,2763484..2764856)
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   transcript variant hCT2358748"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2358748.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 15-JUL-2004"
FT   CDS             join(2758991..2759054,2759185..2759454,2759700..2759975,
FT                   2760558..2760833,2760974..2761090,2761538..2761570,
FT                   2761706..2761753,2762410..2762531,2763484..2763633)
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282365.1
FT                   protein_id=hCP1853702.1 isoform=CRA_c"
FT                   /protein_id="EAX03225.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAVTDSAQGSGVSLTANKAYSVVSGNLMITWWSSLFLLGVLFQGYLGCLRSHSVLG
FT                   RRKAQLLSVSTSQTSILIQEQFSHQRTLAMSGKMFCCHDWSEEEVLPASCGE"
FT   CDS             join(2758991..2759054,2759185..2759454,2759700..2759975,
FT                   2760558..2760833,2760974..2761090,2761538..2761570,
FT                   2762410..2762702)
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282363.1
FT                   protein_id=hCP1853704.1 isoform=CRA_d"
FT                   /db_xref="GOA:P30511"
FT                   /db_xref="HGNC:HGNC:4963"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:5IUE"
FT                   /db_xref="PDB:5KNM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30511"
FT                   /protein_id="EAX03226.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAAYSVVSGNLMITWWSSLFLLGVLFQGYLGCLRSHSVLGRRKVGDMWILFFLWLW
FT                   TSFNTAFLALQSLRFGFGFRRGRSFLLRSWHHLMKRVQIKIFD"
FT   CDS             join(2758991..2759054,2759185..2759454,2759700..2759975,
FT                   2760558..2760833,2760974..2761090,2761538..2761570,
FT                   2761706..2761753,2761930..2761934)
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT16753.4
FT                   protein_id=hCP42376.1 isoform=CRA_b"
FT                   /protein_id="EAX03224.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAVTDSAQGSGVSLTANKV"
FT   CDS             join(2758991..2759054,2759185..2759454,2759700..2759975,
FT                   2760558..2760833,2760974..2761090,2761538..2761570,
FT                   2761930..2761934)
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2282364.1
FT                   protein_id=hCP1853703.1 isoform=CRA_a"
FT                   /db_xref="GOA:P30511"
FT                   /db_xref="HGNC:HGNC:4963"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:5IUE"
FT                   /db_xref="PDB:5KNM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30511"
FT                   /protein_id="EAX03223.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAV"
FT   CDS             join(2758991..2759054,2759185..2759425,2759927..2759975,
FT                   2760558..2760614)
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /locus_tag="hCG_25628"
FT                   /product="major histocompatibility complex, class I, F,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG25628.3 transcript_id=hCT2358748.0
FT                   protein_id=hCP1924033.0 isoform=CRA_e"
FT                   /protein_id="EAX03227.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLCS
FT                   ADTWRMGRRRYSAQILQRHTLPTTPSLTMRPP"
FT   gene            complement(2762125..2764022)
FT                   /pseudo
FT                   /locus_tag="hCG_1814827"
FT                   /note="gene_id=hCG1814827.2"
FT   mRNA            complement(join(2762125..2762766,2763892..2764022))
FT                   /pseudo
FT                   /locus_tag="hCG_1814827"
FT                   /note="gene_id=hCG1814827.2 transcript_id=hCT1814829.2;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 17-NOV-2003"
FT   gene            complement(2776851..2784580)
FT                   /gene="RP3-377H14.5"
FT                   /locus_tag="hCG_2043316"
FT                   /note="gene_id=hCG2043316.0"
FT   mRNA            complement(join(2776851..2777429,2779536..2779679,
FT                   2779794..2780124,2780513..2780761,2781000..2781254,
FT                   2784431..2784580))
FT                   /gene="RP3-377H14.5"
FT                   /locus_tag="hCG_2043316"
FT                   /product="hypothetical protein FLJ35429"
FT                   /note="gene_id=hCG2043316.0 transcript_id=hCT2350069.0;
FT                   splice donor-acceptor pairs covered / total pairs = 1/5;
FT                   created on 17-NOV-2003"
FT   CDS             complement(join(2780598..2780761,2781000..2781254,
FT                   2784431..2784500))
FT                   /codon_start=1
FT                   /gene="RP3-377H14.5"
FT                   /locus_tag="hCG_2043316"
FT                   /product="hypothetical protein FLJ35429"
FT                   /note="gene_id=hCG2043316.0 transcript_id=hCT2350069.0
FT                   protein_id=hCP1915319.0"
FT                   /protein_id="EAX03228.1"
FT                   /translation="MEMSLVLLFLIRTALFAPQGAAAEPHSLCYNLTVLSRDGSVQSGF
FT                   LAEGHLDGQLFLLCDRQKGRAGPRGQWAEAVLGAETWDTETEDLTENGQELRRTLAHIK
FT                   GQKGALHSLQEIRVCEIRKPAAPGALGISTHMGSSSSLPTWRLSNGQCPGPPELRLWL"
FT   gene            complement(2786097..2786679)
FT                   /pseudo
FT                   /locus_tag="hCG_1645043"
FT                   /note="gene_id=hCG1645043.3"
FT   mRNA            complement(2786097..2786679)
FT                   /pseudo
FT                   /locus_tag="hCG_1645043"
FT                   /note="gene_id=hCG1645043.3 transcript_id=hCT1645170.3;
FT                   overlap evidence=yes; created on 26-AUG-2002"
FT   gene            complement(2826497..2973853)
FT                   /pseudo
FT                   /locus_tag="hCG_2043272"
FT                   /note="gene_id=hCG2043272.0"
FT   mRNA            complement(join(2826497..2828029,2863394..2863454,
FT                   2918431..2918617,2957365..2957449,2973588..2973853))
FT                   /pseudo
FT                   /locus_tag="hCG_2043272"
FT                   /note="gene_id=hCG2043272.0 transcript_id=hCT1786916.2;
FT                   splice donor-acceptor pairs covered / total pairs = 1/4;
FT                   created on 06-NOV-2003"
FT   gene            2826814..2833005
FT                   /locus_tag="hCG_2043339"
FT                   /note="gene_id=hCG2043339.1"
FT   mRNA            join(2826814..2826863,2827172..2827239,2827515..2827768,
FT                   2827900..2828148,2828793..2832233)
FT                   /locus_tag="hCG_2043339"
FT                   /product="hCG2043339, transcript variant hCT2282368"
FT                   /note="gene_id=hCG2043339.1 transcript_id=hCT2282368.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 25-NOV-2003"
FT   mRNA            join(2826817..2826863,2827172..2827239,2827573..2827768,
FT                   2827900..2828328,2828793..2828983,2829155..2831134,
FT                   2832582..2833005)
FT                   /locus_tag="hCG_2043339"
FT                   /product="hCG2043339, transcript variant hCT2358798"
FT                   /note="gene_id=hCG2043339.1 transcript_id=hCT2358798.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 15-JUL-2004"
FT   CDS             join(2826822..2826863,2827172..2827239,2827515..2827768,
FT                   2827900..2828148,2828793..2828908)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2043339"
FT                   /product="hCG2043339, isoform CRA_b"
FT                   /note="gene_id=hCG2043339.1 transcript_id=hCT2282368.1
FT                   protein_id=hCP1853669.1 isoform=CRA_b"
FT                   /protein_id="EAX03230.1"
FT                   /translation="MSWTHTETQGYGMKGKLTLWQQAPWSDFSSRRVHGDRVSLLPLPT
FT                   CVGSFFLDTHQAAPVLTPIECRVPREANQCSRGPGSKVPTHPPGLRFSPVAEDGVMAPR
FT                   TLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGRADPRFLSVGDVDDTQCVRLDSDATS
FT                   PRMEPEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEAWAASHTESWTGLYRHNLV
FT                   PAWMKPSEEWVPSFRMWCMY"
FT   CDS             join(2827705..2827768,2827900..2828156)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2043339"
FT                   /product="hCG2043339, isoform CRA_a"
FT                   /note="gene_id=hCG2043339.1 transcript_id=hCT2358798.0
FT                   protein_id=hCP1924083.0 isoform=CRA_a"
FT                   /protein_id="EAX03229.1"
FT                   /translation="MAPRTLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGRADPRFLS
FT                   VGDVDDTQCVRLDSDATSPRMEPEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEA
FT                   CE"
FT   gene            complement(2838426..2839240)
FT                   /pseudo
FT                   /locus_tag="hCG_1792946"
FT                   /note="gene_id=hCG1792946.2"
FT   mRNA            complement(2838426..2839240)
FT                   /pseudo
FT                   /locus_tag="hCG_1792946"
FT                   /note="gene_id=hCG1792946.2 transcript_id=hCT1832206.2;
FT                   overlap evidence=no; created on 26-AUG-2002"
FT   gene            2862181..2866340
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /note="gene_id=hCG1999524.1"
FT   mRNA            join(2862181..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2865628,2865771..2865818,2865986..2866340)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282374"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282374.1;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 25-NOV-2003"
FT   mRNA            join(2862181..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2865628,2865986..2866340)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282371"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282371.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 25-NOV-2003"
FT   mRNA            join(2862181..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2866321)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282377"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282377.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 25-NOV-2003"
FT   CDS             join(2862256..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282374.1
FT                   protein_id=hCP1853666.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5RJ85"
FT                   /db_xref="HGNC:HGNC:4964"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RJ85"
FT                   /protein_id="EAX03232.1"
FT                   /translation="MKTPRMVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPG
FT                   RGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
FT                   MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWT
FT                   AADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHP
FT                   VFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSG
FT                   EEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKK
FT                   SSD"
FT   CDS             join(2862256..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282371.1
FT                   protein_id=hCP1853674.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5RJ85"
FT                   /db_xref="HGNC:HGNC:4964"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RJ85"
FT                   /protein_id="EAX03233.1"
FT                   /translation="MKTPRMVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPG
FT                   RGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
FT                   MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWT
FT                   AADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHP
FT                   VFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSG
FT                   EEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKK
FT                   SSD"
FT   CDS             join(2862256..2862261,2863053..2863134,2863264..2863533,
FT                   2863761..2864036,2864636..2864911,2865034..2865150,
FT                   2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282377.1
FT                   protein_id=hCP1853672.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5RJ85"
FT                   /db_xref="HGNC:HGNC:4964"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RJ85"
FT                   /protein_id="EAX03236.1"
FT                   /translation="MKTPRMVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPG
FT                   RGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
FT                   MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWT
FT                   AADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHP
FT                   VFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSG
FT                   EEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKK
FT                   SSD"
FT   mRNA            join(2862958..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2865628,
FT                   2865771..2865818,2865986..2866340)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282373"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282373.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 25-NOV-2003"
FT   mRNA            join(2862958..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2865628,
FT                   2865986..2866340)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282369"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282369.1;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 25-NOV-2003"
FT   mRNA            join(2862958..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2866321)
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   transcript variant hCT2282370"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282370.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 25-NOV-2003"
FT   CDS             join(2863062..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282373.1
FT                   protein_id=hCP1853676.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="EAX03231.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   CDS             join(2863062..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282370.0
FT                   protein_id=hCP1853662.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="EAX03234.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   CDS             join(2863062..2863134,2863264..2863533,2863761..2864036,
FT                   2864636..2864911,2865034..2865150,2865596..2865600)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /locus_tag="hCG_1999524"
FT                   /product="HLA-G histocompatibility antigen, class I, G,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1999524.1 transcript_id=hCT2282369.1
FT                   protein_id=hCP1853664.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="EAX03235.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   assembly_gap    2883322..2883341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2888087..2889958)
FT                   /pseudo
FT                   /locus_tag="hCG_2043331"
FT                   /note="gene_id=hCG2043331.0"
FT   mRNA            complement(2888087..2889958)
FT                   /pseudo
FT                   /locus_tag="hCG_2043331"
FT                   /note="gene_id=hCG2043331.0 transcript_id=hCT2350079.0;
FT                   overlap evidence=no; created on 17-NOV-2003"
FT   gene            complement(<2899625..>2901385)
FT                   /locus_tag="hCG_1999809"
FT                   /note="gene_id=hCG1999809.0"
FT   mRNA            complement(join(<2899625..2899842,2901265..>2901385))
FT                   /locus_tag="hCG_1999809"
FT                   /product="hCG1999809"
FT                   /note="gene_id=hCG1999809.0 transcript_id=hCT2282911.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 26-AUG-2002"
FT   CDS             complement(join(<2899625..2899842,2901265..2901385))
FT                   /codon_start=1
FT                   /locus_tag="hCG_1999809"
FT                   /product="hCG1999809"
FT                   /note="gene_id=hCG1999809.0 transcript_id=hCT2282911.0
FT                   protein_id=hCP1853618.0"
FT                   /protein_id="EAX03237.1"
FT                   /translation="MAISSSHNRTPLQNSLQEGTVSSQAHTCTVCAQSFCSSSGAQVSP
FT                   RSGLIEQQELGSGTRDPASLGILDSRKDPGDLPLYEAQSPLTVMASLDPTGNQIRRPHR
FT                   PWGKNKSKV"
FT   gene            2917170..2921302
FT                   /pseudo
FT                   /locus_tag="hCG_2043318"
FT                   /note="gene_id=hCG2043318.0"
FT   mRNA            join(2917170..2918060,2918185..2918454,2918697..2918972,
FT                   2919558..2919832,2919935..2920051,2920492..2920524,
FT                   2920667..2920713,2920881..2921302)
FT                   /pseudo
FT                   /locus_tag="hCG_2043318"
FT                   /note="gene_id=hCG2043318.0 transcript_id=hCT2282383.1;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 17-NOV-2003"
FT   gene            <2926781..2928322
FT                   /locus_tag="hCG_2043340"
FT                   /note="gene_id=hCG2043340.0"
FT   mRNA            join(<2926781..2927080,2927181..2927297,2927674..2927728,
FT                   2927877..2927920,2928086..2928322)
FT                   /locus_tag="hCG_2043340"
FT                   /product="hCG2043340"
FT                   /note="gene_id=hCG2043340.0 transcript_id=hCT2282375.1;
FT                   splice donor-acceptor pairs covered / total pairs = 1/4;
FT                   created on 25-NOV-2003"
FT   CDS             join(<2926999..2927080,2927181..2927297,2927674..2927728,
FT                   2927877..2927920,2928086..2928105)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2043340"
FT                   /product="hCG2043340"
FT                   /note="gene_id=hCG2043340.0 transcript_id=hCT2282375.1
FT                   protein_id=hCP1853670.1"
FT                   /protein_id="EAX03238.1"
FT                   /translation="RYTCHVQQEALPEPLTLRWAKEMNEGPWPSSQPTFLIMGIVTVLV
FT                   VLGAVVTAVMWKNKTPGRKGVICFLSSYGKGVSYAQASSKNSTQGSDVSLKSCKNCLVR
FT                   D"
FT   gene            complement(2929519..2973746)
FT                   /locus_tag="hCG_1748536"
FT                   /note="gene_id=hCG1748536.3"
FT   mRNA            complement(join(2929519..2931068,2955137..2955233,
FT                   2957645..2957860,2958413..2958516,2958700..2958807,
FT                   2973561..2973746))
FT                   /locus_tag="hCG_1748536"
FT                   /product="hCG1748536"
FT                   /note="gene_id=hCG1748536.3 transcript_id=hCT2282904.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 06-NOV-2003"
FT   CDS             complement(2930757..2930999)
FT                   /codon_start=1
FT                   /locus_tag="hCG_1748536"
FT                   /product="hCG1748536"
FT                   /note="gene_id=hCG1748536.3 transcript_id=hCT2282904.1
FT                   protein_id=hCP1853642.1"
FT                   /protein_id="EAX03239.1"
FT                   /translation="MMPATPKELPMDLDRKITDSGLGYAQPGVDVNASRAIQGPEKKRL
FT                   HQFGLPSHTSLHKKTHFTASNGQQCRGTCPPQGKI"
FT   gene            2956590..2960098
FT                   /pseudo
FT                   /locus_tag="hCG_1999526"
FT                   /note="gene_id=hCG1999526.2"
FT   mRNA            join(2956590..2956791,2956921..2957190,2957439..2957713,
FT                   2958310..2958588,2958718..2958834,2959280..2959306,
FT                   2959449..2959496,2959666..2960098)
FT                   /pseudo
FT                   /locus_tag="hCG_1999526"
FT                   /note="gene_id=hCG1999526.2 transcript_id=hCT2282382.1;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 17-NOV-2003"
FT   gene            2972556..2976199
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /note="gene_id=hCG1748539.2"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974945,2975384..2975416,
FT                   2975559..2975606,2975776..2976199)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT1786919"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT1786919.2;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974955,2975806..2976193)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349974"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349974.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973814,
FT                   2974649..2974729,2974829..2974945,2975384..2975416,
FT                   2975559..2975606,2975776..2976193)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349971"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349971.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2975384..2975416,2975559..2975606,
FT                   2975776..2976191)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349970"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349970.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2975416,2975559..2975606,
FT                   2975776..2976170)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349973"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349973.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974945,2975277..2975416,
FT                   2975559..2975606,2975776..2976114)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349972"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349972.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 06-NOV-2003"
FT   mRNA            join(2972556..2972937,2973067..2973336,2973578..2973853,
FT                   2974848..2974945,2975384..2975416,2975559..2975606,
FT                   2975776..2975904)
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   transcript variant hCT2349975"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349975.0;
FT                   splice donor-acceptor pairs covered / total pairs = 6/6;
FT                   created on 06-NOV-2003"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974955,2975806..2975908)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_g"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349974.0
FT                   protein_id=hCP1915223.0 isoform=CRA_g"
FT                   /protein_id="EAX03246.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVRWRRKSSGGE
FT                   GGKSCSCPSLCDLKNPDFVSAKAPACVCVRVGIM"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974945,2975384..2975416,
FT                   2975559..2975606,2975776..2975780)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_d"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT1786919.2
FT                   protein_id=hCP1712957.1 isoform=CRA_d"
FT                   /protein_id="EAX03243.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2975384..2975416,2975559..2975606,
FT                   2975776..2975780)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_e"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349970.0
FT                   protein_id=hCP1915224.0 isoform=CRA_e"
FT                   /protein_id="EAX03244.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWDRKGGSYSQAASSDSAQGSDVSLTACKV"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973814,
FT                   2974649..2974729,2974829..2974945,2975384..2975416,
FT                   2975559..2975606,2975776..2975780)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_b"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349971.0
FT                   protein_id=hCP1915220.0 isoform=CRA_b"
FT                   /protein_id="EAX03241.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRMVPSGQEQRYTCHVQHEGLPKPLTLRWEP
FT                   SSQPTIPIVGIIAGLVLFGAVITGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDVS
FT                   LTACKV"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2974945,2975277..2975302)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_a"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349972.0
FT                   protein_id=hCP1915221.0 isoform=CRA_a"
FT                   /protein_id="EAX03240.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVRWRRKSSVTH
FT                   FWKLL"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974454..2974729,2974829..2975103)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_f"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349973.0
FT                   protein_id=hCP1915225.0 isoform=CRA_f"
FT                   /protein_id="EAX03245.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVRWRRKSSGGE
FT                   GMKGGSEISCLTEGSKTQVEVCPASLLGSTTHNYGPTQPGPCVPALTLL"
FT   CDS             join(2972865..2972937,2973067..2973336,2973578..2973853,
FT                   2974848..2974897)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /locus_tag="hCG_1748539"
FT                   /product="major histocompatibility complex, class I, A,
FT                   isoform CRA_c"
FT                   /note="gene_id=hCG1748539.2 transcript_id=hCT2349975.0
FT                   protein_id=hCP1915222.0 isoform=CRA_c"
FT                   /protein_id="EAX03242.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTASPSWASLLAWFSLEL
FT                   "
FT   gene            2986886..2989228
FT                   /pseudo
FT                   /locus_tag="hCG_1748541"
FT                   /note="gene_id=hCG1748541.3"
FT   mRNA            join(2986886..2987146,2987729..2988002,2988130..2988243,
FT                   2988629..2988667,2988815..2988857,2989011..2989228)
FT                   /pseudo
FT                   /locus_tag="hCG_1748541"
FT                   /note="gene_id=hCG1748541.3 transcript_id=hCT1786921.3;
FT                   splice donor-acceptor pairs covered / total pairs = 0/5;
FT                   created on 18-NOV-2003"
FT   gene            complement(3000824..3002779)
FT                   /pseudo
FT                   /locus_tag="hCG_2043330"
FT                   /note="gene_id=hCG2043330.0"
FT   mRNA            complement(join(3000824..3000987,3001089..3001371,
FT                   3001970..3002256,3002497..3002779))
FT                   /pseudo
FT                   /locus_tag="hCG_2043330"
FT                   /note="gene_id=hCG2043330.0 transcript_id=hCT2350077.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/3;
FT                   created on 18-NOV-2003"
FT   gene            3005403..3008691
FT                   /gene="HCG9"
FT                   /locus_tag="hCG_1748540"
FT                   /note="gene_id=hCG1748540.1"
FT   mRNA            join(3005403..3005805,3007943..3008006,3008507..3008691)
FT                   /gene="HCG9"
FT                   /locus_tag="hCG_1748540"
FT                   /product="HLA complex group 9"
FT                   /note="gene_id=hCG1748540.1 transcript_id=hCT1786920.0;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 26-AUG-2002"
FT   CDS             3005440..3005673
FT                   /codon_start=1
FT                   /gene="HCG9"
FT                   /locus_tag="hCG_1748540"
FT                   /product="HLA complex group 9"
FT                   /note="gene_id=hCG1748540.1 transcript_id=hCT1786920.0
FT                   protein_id=hCP1712974.1"
FT                   /db_xref="UniProtKB/TrEMBL:Q96QB4"
FT                   /protein_id="EAX03247.1"
FT                   /translation="MSWGWEQSQEESSAWSRQAPTPQLESQEPHSPHSNRKHQLLVPKK
FT                   GGPQLQGLRPALELRTRGLQGEDRASGTREPL"
FT   gene            3036874..3040266
FT                   /pseudo
FT                   /locus_tag="hCG_1770406"
FT                   /note="gene_id=hCG1770406.3"
FT   mRNA            join(3036874..3036972,3037103..3037372,3037621..3037896,
FT                   3038492..3038765,3038888..3039004,3039341..3039480,
FT                   3039623..3039670,3039838..3040266)
FT                   /pseudo
FT                   /locus_tag="hCG_1770406"
FT                   /note="gene_id=hCG1770406.3 transcript_id=hCT1808924.3;
FT                   splice donor-acceptor pairs covered / total pairs = 5/7;
FT                   created on 18-NOV-2003"
FT   gene            complement(3043625..>3091535)
FT                   /locus_tag="hCG_2042924"
FT                   /note="gene_id=hCG2042924.0"
FT   mRNA            complement(join(3043625..3043879,3051988..3052082,
FT                   3065231..3065433,3066239..3066306,3088471..3088546,
FT                   3091097..>3091535))
FT                   /locus_tag="hCG_2042924"
FT                   /product="hCG2042924, transcript variant hCT2348652"
FT                   /note="gene_id=hCG2042924.0 transcript_id=hCT2348652.0;
FT                   splice donor-acceptor pairs covered / total pairs = 5/5;
FT                   created on 05-SEP-2003"
FT   mRNA            complement(join(3046272..3046410,3051988..3052082,
FT                   3088471..3088546,3091097..3091351,3091435..3091495))
FT                   /locus_tag="hCG_2042924"
FT                   /product="hCG2042924, transcript variant hCT2358754"
FT                   /note="gene_id=hCG2042924.0 transcript_id=hCT2358754.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 15-JUL-2004"
FT   CDS             complement(3046312..3046395)
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042924"
FT                   /product="hCG2042924, isoform CRA_b"
FT                   /note="gene_id=hCG2042924.0 transcript_id=hCT2358754.0
FT                   protein_id=hCP1924024.0 isoform=CRA_b"
FT                   /protein_id="EAX03249.1"
FT                   /translation="MLMCTVGCLSSHPLMDTRLLPPFGYWV"
FT   CDS             complement(join(3051990..3052082,3065231..>3065416))
FT                   /codon_start=1
FT                   /locus_tag="hCG_2042924"
FT                   /product="hCG2042924, isoform CRA_a"
FT                   /note="gene_id=hCG2042924.0 transcript_id=hCT2348652.0
FT                   protein_id=hCP1913902.0 isoform=CRA_a"
FT                   /protein_id="EAX03248.1"
FT                   /translation="ETKTMEKTKKGDTWDPGNRRASIRERQRDAQDEVKTILEISPDVH
FT                   APVHVWQDQGKCLHKDEALICWRNCYQKNRSRSRPQKSILGSCTGRN"
FT   gene            3062036..3064199
FT                   /pseudo
FT                   /locus_tag="hCG_2040606"
FT                   /note="gene_id=hCG2040606.0"
FT   mRNA            join(3062036..3062470,3062779..3064199)
FT                   /pseudo
FT                   /locus_tag="hCG_2040606"
FT                   /note="gene_id=hCG2040606.0 transcript_id=hCT2345837.0;
FT                   splice donor-acceptor pairs covered / total pairs = 0/1;
FT                   created on 18-NOV-2003"
FT   gene            3091607..3095712
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /note="gene_id=hCG23775.3"
FT   mRNA            join(3091607..3091754,3091871..3092025,3092273..3092373,
FT                   3092580..3092689,3095024..3095712)
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, transcript
FT                   variant hCT1961735"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT1961735.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   mRNA            join(3091613..3092025,3092273..3092373,3092580..3092689,
FT                   3095024..3095712)
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, transcript
FT                   variant hCT14887"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT14887.2; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 26-AUG-2002"
FT   mRNA            join(3091613..3091769,3091871..3092025,3092273..3092373,
FT                   3092580..3092689,3095024..3095712)
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, transcript
FT                   variant hCT1954715"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT1954715.0;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 26-AUG-2002"
FT   CDS             join(3091881..3092025,3092273..3092373,3092580..3092689,
FT                   3095024..3095048)
FT                   /codon_start=1
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, isoform CRA_a"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT14887.2
FT                   protein_id=hCP41167.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q2L6J2"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L6J2"
FT                   /protein_id="EAX03250.1"
FT                   /translation="MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNI
FT                   NVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRS
FT                   ADEGQTVFYTCTNCKFQEKEDS"
FT   CDS             join(3091881..3092025,3092273..3092373,3092580..3092689,
FT                   3095024..3095048)
FT                   /codon_start=1
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, isoform CRA_a"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT1954715.0
FT                   protein_id=hCP1765543.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q2L6J2"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L6J2"
FT                   /protein_id="EAX03251.1"
FT                   /translation="MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNI
FT                   NVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRS
FT                   ADEGQTVFYTCTNCKFQEKEDS"
FT   CDS             join(3091881..3092025,3092273..3092373,3092580..3092689,
FT                   3095024..3095048)
FT                   /codon_start=1
FT                   /gene="ZNRD1"
FT                   /locus_tag="hCG_23775"
FT                   /product="zinc ribbon domain containing, 1, isoform CRA_a"
FT                   /note="gene_id=hCG23775.3 transcript_id=hCT1961735.1
FT                   protein_id=hCP1774519.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q2L6J2"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L6J2"
FT                   /protein_id="EAX03252.1"
FT                   /translation="MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNI
FT                   NVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRS
FT                   ADEGQTVFYTCTNCKFQEKEDS"
FT   gene            3097439..3100680
FT                   /gene="PPP1R11"
FT                   /locus_tag="hCG_23774"
FT                   /note="gene_id=hCG23774.4"
FT   mRNA            join(3097439..3097830,3098630..3098704,3098941..3099049,
FT                   3099455..3100680)
FT                   /gene="PPP1R11"
FT                   /locus_tag="hCG_23774"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 11, transcript variant hCT14886"
FT                   /note="gene_id=hCG23774.4 transcript_id=hCT14886.5; splice
FT                   donor-acceptor pairs covered / total pairs = 3/3; created
FT                   on 18-NOV-2003"
FT   mRNA            join(3097439..3097830,3098941..3099049,3099455..3100680)
FT                   /gene="PPP1R11"
FT                   /locus_tag="hCG_23774"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 11, transcript variant hCT1961734"
FT                   /note="gene_id=hCG23774.4 transcript_id=hCT1961734.2;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-NOV-2003"
FT   CDS             join(3097762..3097830,3098941..3099049,3099455..3099657)
FT                   /codon_start=1
FT                   /gene="PPP1R11"
FT                   /locus_tag="hCG_23774"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 11, isoform CRA_a"
FT                   /note="gene_id=hCG23774.4 transcript_id=hCT1961734.2
FT                   protein_id=hCP1774517.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2BEK1"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniProtKB/TrEMBL:A2BEK1"
FT                   /protein_id="EAX03253.1"
FT                   /translation="MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTS
FT                   DTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLG
FT                   PTPTTPPQPPDPSQPPPGPMQH"
FT   CDS             join(3097762..3097830,3098630..3098704)
FT                   /codon_start=1
FT                   /gene="PPP1R11"
FT                   /locus_tag="hCG_23774"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 11, isoform CRA_b"
FT                   /note="gene_id=hCG23774.4 transcript_id=hCT14886.5
FT                   protein_id=hCP41166.3 isoform=CRA_b"
FT                   /protein_id="EAX03254.1"
FT                   /translation="MAEAGAGLSETVTETTVTVTTEPDDLGRKTEKQQGLYFPLKSCWD
FT                   LS"
FT   gene            complement(3100618..3106239)
FT                   /gene="RNF39"
FT                   /locus_tag="hCG_1640404"
FT                   /note="gene_id=hCG1640404.3"
FT   mRNA            complement(join(3100618..3101551,3101750..3102042,
FT                   3103508..3103599,3103807..3103829,3105574..3106239))
FT                   /gene="RNF39"
FT                   /locus_tag="hCG_1640404"
FT                   /product="ring finger protein 39, transcript variant
FT                   hCT2294049"
FT                   /note="gene_id=hCG1640404.3 transcript_id=hCT2294049.1;
FT                   splice donor-acceptor pairs covered / total pairs = 4/4;
FT                   created on 18-NOV-2003"
FT   mRNA            complement(join(3100621..3102042,3103508..3103599,
FT                   3103807..3103829,3105574..3106239))
FT                   /gene="RNF39"
FT                   /locus_tag="hCG_1640404"
FT                   /product="ring finger protein 39, transcript variant
FT                   hCT1640531"
FT                   /note="gene_id=hCG1640404.3 transcript_id=hCT1640531.3;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 18-NOV-2003"
FT   CDS             complement(join(3101462..3101551,3101750..3102042,
FT                   3103508..3103599,3103807..3103829,3105574..3106140))
FT                   /codon_start=1
FT                   /gene="RNF39"
FT                   /locus_tag="hCG_1640404"
FT                   /product="ring finger protein 39, isoform CRA_b"
FT                   /note="gene_id=hCG1640404.3 transcript_id=hCT2294049.1
FT                   protein_id=hCP1853960.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9H2S5"
FT                   /db_xref="HGNC:HGNC:18064"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9H2S5"
FT                   /protein_id="EAX03256.1"
FT                   /translation="MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGG
FT                   PPSARSKAVTVVAEGAASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACE
FT                   HSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKL
FT                   AEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKM
FT                   LHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGA
FT                   GRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCAPGPLGERIFPLFCT
FT                   CDPRAPLRIVPAES"
FT   CDS             complement(join(3101462..3102042,3103508..3103599,
FT                   3103807..3103829,3105574..3106140))
FT                   /codon_start=1
FT                   /gene="RNF39"
FT                   /locus_tag="hCG_1640404"
FT                   /product="ring finger protein 39, isoform CRA_a"
FT                   /note="gene_id=hCG1640404.3 transcript_id=hCT1640531.3
FT                   protein_id=hCP1638350.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q96QB5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q96QB5"
FT                   /protein_id="EAX03255.1"
FT                   /translation="MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGG
FT                   PPSARSKAVTVVAEGAASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACE
FT                   HSFCRACLARRWGTPPATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKL
FT                   AEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKM
FT                   LHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGA
FT                   GRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGR
FT                   GGRLWALTAPEPTLLGGVEPPPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGER
FT                   IFPLFCTCDPRAPLRIVPAES"
FT   gene            complement(3133249..3143461)
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /note="gene_id=hCG22721.5"
FT   mRNA            complement(join(3133249..3134139,3134452..3134517,
FT                   3135518..3135592,3138404..3138475,3140796..3141026,
FT                   3142007..3142102,3142748..3143247,3143419..3143461))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT2294038"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT2294038.0;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 18-NOV-2003"
FT   mRNA            complement(join(3133249..3134139,3134452..3134517,
FT                   3135518..3135592,3138404..3138519,3139372..3139394,
FT                   3140796..3141026,3142007..3142102,3142748..3143247,
FT                   3143419..3143461))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT1958893"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958893.2;
FT                   splice donor-acceptor pairs covered / total pairs = 8/8;
FT                   created on 18-NOV-2003"
FT   mRNA            complement(join(3133249..3134139,3134452..3134517,
FT                   3135518..3135592,3138404..3138519,3139372..3139394,
FT                   3140796..3141026,3142007..3142102,3142439..3142547))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT1967639"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1967639.2;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 18-NOV-2003"
FT   mRNA            complement(join(3133249..3134139,3134452..3134517,
FT                   3135518..3136007))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT1958892"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958892.3;
FT                   splice donor-acceptor pairs covered / total pairs = 2/2;
FT                   created on 18-NOV-2003"
FT   CDS             complement(join(3133886..3134139,3134452..3134517,
FT                   3135518..3135592,3138404..3138519,3139372..3139394,
FT                   3140796..3141026,3142007..3142102,3142748..3143164))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_c"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958893.2
FT                   protein_id=hCP1765548.1 isoform=CRA_c"
FT                   /protein_id="EAX03259.1"
FT                   /translation="MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGE
FT                   TSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHY
FT                   FCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQG
FT                   VHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTE
FT                   PQLNDLKKLIDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKS
FT                   RHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSS
FT                   AGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVA
FT                   LSEELHAALSEWLTAIRAWFCEVPSS"
FT   CDS             complement(join(3133886..3134139,3134452..3134517,
FT                   3135518..3135592,3138404..3138519,3139372..3139394,
FT                   3140796..3140819))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_f"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1967639.2
FT                   protein_id=hCP1780698.2 isoform=CRA_f"
FT                   /protein_id="EAX03262.1"
FT                   /translation="MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDS
FT                   ITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGR
FT                   TTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEE
FT                   LHAALSEWLTAIRAWFCEVPSS"
FT   CDS             complement(join(3133886..3134139,3134452..3134517,
FT                   3135518..3135542))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_g"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958892.3
FT                   protein_id=hCP1765546.2 isoform=CRA_g"
FT                   /protein_id="EAX03263.1"
FT                   /translation="MNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSA
FT                   PSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAI
FT                   RAWFCEVPSS"
FT   mRNA            complement(join(3134223..3134517,3135518..3135592,
FT                   3138404..3138519,3139372..3139394,3140796..3141026,
FT                   3142007..3142102,3142748..3143247,3143419..3143461))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT1958891"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958891.3;
FT                   splice donor-acceptor pairs covered / total pairs = 7/7;
FT                   created on 18-NOV-2003"
FT   CDS             complement(join(3134426..3134517,3135518..3135592,
FT                   3138404..3138519,3139372..3139394,3140796..3141026,
FT                   3142007..3142102,3142748..3143164))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_e"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT1958891.3
FT                   protein_id=hCP1765545.1 isoform=CRA_e"
FT                   /protein_id="EAX03261.1"
FT                   /translation="MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGE
FT                   TSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHY
FT                   FCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQG
FT                   VHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTE
FT                   PQLNDLKKLIDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKS
FT                   RHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSS
FT                   AGKSPVSEY"
FT   gene            3135590..3145077
FT                   /locus_tag="hCG_2045726"
FT                   /note="gene_id=hCG2045726.0"
FT   mRNA            join(3135590..3135737,3138014..3138138,3142077..3142198,
FT                   3144926..3145077)
FT                   /locus_tag="hCG_2045726"
FT                   /product="hCG2045726"
FT                   /note="gene_id=hCG2045726.0 transcript_id=hCT2360561.0;
FT                   splice donor-acceptor pairs covered / total pairs = 3/3;
FT                   created on 16-AUG-2004"
FT   CDS             complement(join(3138416..3138475,3140796..3141026,
FT                   3142007..3142102,3142748..3143164))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_a"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT2294038.0
FT                   protein_id=hCP1853953.0 isoform=CRA_a"
FT                   /protein_id="EAX03257.1"
FT                   /translation="MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGE
FT                   TSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHY
FT                   FCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQG
FT                   VHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTE
FT                   PQLNDLKKLIDSLKTKQNMPPRQLLENWRKNSVKQNQDMTPSQGA"
FT   mRNA            complement(join(3139092..3139394,3140796..3141026,
FT                   3142007..3142102,3142748..3143247,3143419..3143461))
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, transcript
FT                   variant hCT13819"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT13819.5; splice
FT                   donor-acceptor pairs covered / total pairs = 4/4; created
FT                   on 18-NOV-2003"
FT   CDS             complement(join(3139335..3139394,3140796..3141026,
FT                   3142007..3142102,3142748..3143164))
FT                   /codon_start=1
FT                   /gene="TRIM31"
FT                   /locus_tag="hCG_22721"
FT                   /product="tripartite motif-containing 31, isoform CRA_b"
FT                   /note="gene_id=hCG22721.5 transcript_id=hCT13819.5
FT                   protein_id=hCP41161.4 isoform=CRA_b"