spacer

EBI Dbfetch

ID   CH466671; SV 2; linear; genomic DNA; CON; MUS; 487450 BP.
XX
AC   CH466671;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009833290 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-487450
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-487450
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-487450
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; dc3a2677cba73cc417f1643f2f0c2a0a.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000217.
DR   Ensembl-Gn; ENSMUSG00000025804; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035448; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049103; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064039; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171719; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70975794.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..487450
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <204..>957
FT                   /locus_tag="mCG_1045545"
FT                   /note="gene_id=mCG1045545.1"
FT   mRNA            <204..>957
FT                   /locus_tag="mCG_1045545"
FT                   /product="mCG1045545"
FT                   /note="gene_id=mCG1045545.1 transcript_id=mCT163249.1
FT                   created on 21-MAY-2002"
FT   CDS             <205..957
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045545"
FT                   /product="mCG1045545"
FT                   /note="gene_id=mCG1045545.1 transcript_id=mCT163249.1
FT                   protein_id=mCP67073.1"
FT                   /protein_id="EDL37188.1"
FT                   /translation="TKNQKFIKEHIMQRNFTNVICVKAFSKQSHFKVHKRIHTGEKPYE
FT                   CNQCGKTFAYQSYIKLHERIHTGEKPYICNQCGKTFVRHDALQRHERIHTRVKHEECNQ
FT                   SSKFFAFPAQLRKHERIHSGEKPYTCSQCGKAFVHQYDLQRQERTHTGEKPYKCNQCGK
FT                   DFAYHRTFQVQKGTHTGEKPYECNQCGKAFAYQNYFQVHKTTHTGEKHSECKQCSKSFV
FT                   THVSCGKHERIHTGKKDYKCRQCDKAYS"
FT   gene            16481..46819
FT                   /locus_tag="mCG_148285"
FT                   /note="gene_id=mCG148285.0"
FT   mRNA            join(16481..16607,46046..46819)
FT                   /locus_tag="mCG_148285"
FT                   /product="mCG148285"
FT                   /note="gene_id=mCG148285.0 transcript_id=mCT188548.0
FT                   created on 13-JAN-2004"
FT   CDS             46227..46421
FT                   /codon_start=1
FT                   /locus_tag="mCG_148285"
FT                   /product="mCG148285"
FT                   /note="gene_id=mCG148285.0 transcript_id=mCT188548.0
FT                   protein_id=mCP109724.0"
FT                   /protein_id="EDL37187.1"
FT                   /translation="MPLVVWSSKTVSLEGFREVLRDITICWASRRTSENANFCWSCWVI
FT                   KNYFMLISQVNVKTLRYHL"
FT   gene            complement(50947..>58000)
FT                   /locus_tag="mCG_8010"
FT                   /note="gene_id=mCG8010.2"
FT   mRNA            complement(join(50947..51202,51535..51647,52060..52178,
FT                   52399..52574,52977..53066,53343..53391,53652..53808,
FT                   54261..54347,54721..54795,55468..55570,55979..56082,
FT                   56381..56578,56984..57333))
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, transcript variant mCT7286"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT7286.1 created on
FT                   21-MAY-2002"
FT   mRNA            complement(join(50948..51202,51535..51647,52060..52178,
FT                   52399..52574,52977..53066,53343..53391,53652..53808,
FT                   54261..54347,54721..54795,55468..55570,55979..56082,
FT                   56381..56578,57662..>58000))
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, transcript variant mCT193528"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT193528.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(50948..51202,51535..51647,52060..52178,
FT                   52430..52574,52977..53066,53343..53391,53652..53808,
FT                   54261..54795,55468..55570,55979..56082,56381..56578,
FT                   56984..>57345))
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, transcript variant mCT193527"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT193527.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(51139..51202,51535..51647,52060..52178,
FT                   52399..52574,52977..53066,53343..53391,53652..53808,
FT                   54261..54347,54721..54795,55468..55570,55979..56082,
FT                   56381..56578,57662..>58000))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, isoform CRA_b"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT193528.0
FT                   protein_id=mCP114500.0 isoform=CRA_b"
FT                   /protein_id="EDL37185.1"
FT                   /translation="RKFPTAALPFSAELRPSAISLCPLPAPHLLVAMAPLTPRLQLKVD
FT                   ELFRRWLGDPHTQRALSHALRRIRDPGTTSDPAAAATPDADPGNTTSDPNPASRPLPRP
FT                   ALRTTGPRTVHAHRKEEPPPQSPPPGHSVPAFYFPCGRPPPRPQDTEDAIALVECAFEG
FT                   LPRGRAGLGDMAVVAKACGCPLYWKAPLFYAAGGERTGSVSVHMFVAMWRKVLLTCHDD
FT                   AARFVRLLGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYITTVIQRIFYT
FT                   VNRSWSGMISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKFWELDLDRD
FT                   LTIDRSDLARHGDGAISSRMIDRIFSGAVTRARLPRKVGKLSYADFVWFLLSEEDKTTP
FT                   TSTEYWFRCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLDLVAPRC
FT                   PGRITLRDLKQCGLAGEFFDAFFNVDKYLAREQREQAGTPQDTDSDPAASAWDRYAAEE
FT                   YDFLVAEEAMAEDDDDHDEGSDPIDLYGLADEDCDDLEPL"
FT   CDS             complement(join(51139..51202,51535..51647,52060..52178,
FT                   52399..52574,52977..53066,53343..53391,53652..53808,
FT                   54261..54347,54721..54795,55468..55570,55979..56082,
FT                   56381..56578,56984..57124))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, isoform CRA_c"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT7286.1
FT                   protein_id=mCP7891.2 isoform=CRA_c"
FT                   /protein_id="EDL37186.1"
FT                   /translation="MPERPPIRALRRDPDDPAVRQALASLARGSDLVFPSRFQKWLRDF
FT                   RQVHAHRKEEPPPQSPPPGHSVPAFYFPCGRPPPRPQDTEDAIALVECAFEGLPRGRAG
FT                   LGDMAVVAKACGCPLYWKAPLFYAAGGERTGSVSVHMFVAMWRKVLLTCHDDAARFVRL
FT                   LGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYITTVIQRIFYTVNRSWSG
FT                   MISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKFWELDLDRDLTIDRSD
FT                   LARHGDGAISSRMIDRIFSGAVTRARLPRKVGKLSYADFVWFLLSEEDKTTPTSTEYWF
FT                   RCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLDLVAPRCPGRITLR
FT                   DLKQCGLAGEFFDAFFNVDKYLAREQREQAGTPQDTDSDPAASAWDRYAAEEYDFLVAE
FT                   EAMAEDDDDHDEGSDPIDLYGLADEDCDDLEPL"
FT   CDS             complement(join(54535..54795,55468..55570,55979..56082,
FT                   56381..56578,56984..>57247))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8010"
FT                   /product="mCG8010, isoform CRA_a"
FT                   /note="gene_id=mCG8010.2 transcript_id=mCT193527.0
FT                   protein_id=mCP114502.0 isoform=CRA_a"
FT                   /protein_id="EDL37184.1"
FT                   /translation="PRCRVADRAERGPRESPGSPGSQATPTDSQAGPYPARATPTMPER
FT                   PPIRALRRDPDDPAVRQALASLARGSDLVFPSRFQKWLRDFRQVHAHRKEEPPPQSPPP
FT                   GHSVPAFYFPCGRPPPRPQDTEDAIALVECAFEGLPRGRAGLGDMAVVAKACGCPLYWK
FT                   APLFYAAGGERTGSVSVHMFVAMWRKVLLTCHDDAARFVRLLGHPGCSGLIQEDFVPFL
FT                   QDVVNSHPGLAFLRAAKDFHSRYITTVSRYVPNKLPALGHAHLSKTPPTALCHNHRVFS
FT                   HAHCLQIPSDCPDHAPSVSHAPDSAHSC"
FT   gene            <55052..58608
FT                   /locus_tag="mCG_146098"
FT                   /note="gene_id=mCG146098.1"
FT   mRNA            join(<55052..55558,57542..57916,58036..58243)
FT                   /locus_tag="mCG_146098"
FT                   /product="mCG146098, transcript variant mCT186201"
FT                   /note="gene_id=mCG146098.1 transcript_id=mCT186201.0
FT                   created on 14-JUL-2003"
FT   mRNA            join(<55340..55558,57542..58608)
FT                   /locus_tag="mCG_146098"
FT                   /product="mCG146098, transcript variant mCT193529"
FT                   /note="gene_id=mCG146098.1 transcript_id=mCT193529.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<55396..55558,57542..57720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146098"
FT                   /product="mCG146098, isoform CRA_a"
FT                   /note="gene_id=mCG146098.1 transcript_id=mCT186201.0
FT                   protein_id=mCP107786.0 isoform=CRA_a"
FT                   /protein_id="EDL37182.1"
FT                   /translation="ATTVGVNLRARPARVGGVPPGPAHLQEGHKVLLDEATTPGVAQQP
FT                   HEPRSIIMAGSPSPSDVIDRIDFLRLRTDTRPCAPTLALPPCGLSLTHSPSWVPSFSAR
FT                   AAAAVGRRG"
FT   CDS             join(<55396..55558,57542..57720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146098"
FT                   /product="mCG146098, isoform CRA_a"
FT                   /note="gene_id=mCG146098.1 transcript_id=mCT193529.0
FT                   protein_id=mCP114501.0 isoform=CRA_a"
FT                   /protein_id="EDL37183.1"
FT                   /translation="ATTVGVNLRARPARVGGVPPGPAHLQEGHKVLLDEATTPGVAQQP
FT                   HEPRSIIMAGSPSPSDVIDRIDFLRLRTDTRPCAPTLALPPCGLSLTHSPSWVPSFSAR
FT                   AAAAVGRRG"
FT   gene            complement(<61825..>80753)
FT                   /locus_tag="mCG_8011"
FT                   /note="gene_id=mCG8011.2"
FT   mRNA            complement(join(<61825..62729,63895..64018,64807..65031,
FT                   66182..66988,67393..67675,80548..>80753))
FT                   /locus_tag="mCG_8011"
FT                   /product="mCG8011, transcript variant mCT7287"
FT                   /note="gene_id=mCG8011.2 transcript_id=mCT7287.2 created on
FT                   21-MAY-2002"
FT   mRNA            complement(join(<61825..62729,64803..65031,66182..66988,
FT                   67393..67675,80548..>80753))
FT                   /locus_tag="mCG_8011"
FT                   /product="mCG8011, transcript variant mCT169414"
FT                   /note="gene_id=mCG8011.2 transcript_id=mCT169414.0 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(61825..62729,63895..64018,64807..65031,
FT                   66182..66988,67393..67675,80548..80753))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8011"
FT                   /product="mCG8011, isoform CRA_b"
FT                   /note="gene_id=mCG8011.2 transcript_id=mCT7287.2
FT                   protein_id=mCP7892.2 isoform=CRA_b"
FT                   /protein_id="EDL37181.1"
FT                   /translation="MKKLCDFTPSFLLLKFSLILCSLTEPSCFWRIQNNEDNNGDLRGD
FT                   CGFVLLTQEGPIDEKFYNYVINFRIPARRYEYFLVMFFATDEINKNPYLLPNMSFVFSL
FT                   IAGMYEDTLGFIDKRHSPQKYASNFLNYNCGLRKRCDVVLTGPSQTISVKLAINYRRPK
FT                   VFFGPFNPNLSDHDQFPYVYQVATKDTYLSHGMVSLMLQFRWNWIGLVISDDDQGIQFL
FT                   SDLREEMQRHGICLAFVNMIPETMQIYMTRAKTYDEQIMESTAKVVVIYGEMNSTLEIS
FT                   FRRWQDLGAQRIWITTSQWDVIINKKDFSLDFFHGTVIFVHHNDRIAKFRNFMQTINTN
FT                   KYPVDISHTILKWNYFNCSISKNSISKMDHFTFNNTLEWLAKHKFDMVLSEEGYNLYNA
FT                   VYAVAHTYHELILQHVESPEMAEPRGLFFDCQKVASLLKTMVFTNPLGELVNMKHRENQ
FT                   CAEYDIYKIWNFPQGLGLKVKLGSYFPCFPHSQHIHMSEDFEWATGGISVPSSMCSVTC
FT                   TAGFRKIHQKETADCCFDCAQCPENEVSNETDMEKCVSCPDDKYANIEKTHCLPRAVSF
FT                   LAYEDPLGMALGCMALSFSAITILVLVTFVKYKDTPIVKANNRILSYILLIALVFCFLC
FT                   SLLFIGHPNQVSCILQQTTFGVFFTVAISTVLAKTITVVMAFKLTTPGRRMRGVMMTGA
FT                   PKLVIPICTLIQLILCGIWLVTSPPFIERDIKSEHGKIVILCNKGSVIAFHVVLGYLGS
FT                   LALGSFTMAFLARNLPDRFNEAKFLTFSMLVFCSVWITFLPVYHSTRGTVMVVVEVFSI
FT                   LASSAGLLGCIFVPKCCVILVRPDSNFIQKYKDKLLY"
FT   CDS             complement(join(61825..62729,64803..65031,66182..66988,
FT                   67393..67675,80548..80753))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8011"
FT                   /product="mCG8011, isoform CRA_a"
FT                   /note="gene_id=mCG8011.2 transcript_id=mCT169414.0
FT                   protein_id=mCP92410.0 isoform=CRA_a"
FT                   /protein_id="EDL37180.1"
FT                   /translation="MKKLCDFTPSFLLLKFSLILCSLTEPSCFWRIQNNEDNNGDLRGD
FT                   CGFVLLTQEGPIDEKFYNYVINFRIPARRYEYFLVMFFATDEINKNPYLLPNMSFVFSL
FT                   IAGMYEDTLGFIDKRHSPQKYASNFLNYNCGLRKRCDVVLTGPSQTISVKLAINYRRPK
FT                   VFFGPFNPNLSDHDQFPYVYQVATKDTYLSHGMVSLMLQFRWNWIGLVISDDDQGIQFL
FT                   SDLREEMQRHGICLAFVNMIPETMQIYMTRAKTYDEQIMESTAKVVVIYGEMNSTLEIS
FT                   FRRWQDLGAQRIWITTSQWDVIINKKDFSLDFFHGTVIFVHHNDRIAKFRNFMQTINTN
FT                   KYPVDISHTILKWNYFNCSISKNSISKMDHFTFNNTLEWLAKHKFDMVLSEEGYNLYNA
FT                   VYAVAHTYHELILQHVESPEMAEPRGLFFDCQKVASLLKTMVFTNPLGELVNMKHRENQ
FT                   CAEYDIYKIWNFPQGLGLKVKLGSYFPCFPHSQHIHMSEDFEWATGGISVDMEKCVSCP
FT                   DDKYANIEKTHCLPRAVSFLAYEDPLGMALGCMALSFSAITILVLVTFVKYKDTPIVKA
FT                   NNRILSYILLIALVFCFLCSLLFIGHPNQVSCILQQTTFGVFFTVAISTVLAKTITVVM
FT                   AFKLTTPGRRMRGVMMTGAPKLVIPICTLIQLILCGIWLVTSPPFIERDIKSEHGKIVI
FT                   LCNKGSVIAFHVVLGYLGSLALGSFTMAFLARNLPDRFNEAKFLTFSMLVFCSVWITFL
FT                   PVYHSTRGTVMVVVEVFSILASSAGLLGCIFVPKCCVILVRPDSNFIQKYKDKLLY"
FT   gene            complement(106279..107072)
FT                   /pseudo
FT                   /locus_tag="mCG_140436"
FT                   /note="gene_id=mCG140436.0"
FT   mRNA            complement(106279..107072)
FT                   /pseudo
FT                   /locus_tag="mCG_140436"
FT                   /note="gene_id=mCG140436.0 transcript_id=mCT169523.0
FT                   created on 21-MAY-2002"
FT   gene            <124918..159078
FT                   /locus_tag="mCG_23593"
FT                   /note="gene_id=mCG23593.2"
FT   mRNA            join(<124918..125008,132223..132480,134287..135889,
FT                   138717..138875,139306..139470,142250..142417,
FT                   150918..151088,153009..153179,154368..154541,
FT                   158534..159078)
FT                   /locus_tag="mCG_23593"
FT                   /product="mCG23593"
FT                   /note="gene_id=mCG23593.2 transcript_id=mCT23529.2 created
FT                   on 08-JUL-2002"
FT   CDS             join(124918..125008,132223..132480,134287..135889,
FT                   138717..138875,139306..139470,142250..142417,
FT                   150918..151088,153009..153179,154368..154506)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23593"
FT                   /product="mCG23593"
FT                   /note="gene_id=mCG23593.2 transcript_id=mCT23529.2
FT                   protein_id=mCP6733.2"
FT                   /protein_id="EDL37179.1"
FT                   /translation="MQRVRGKKKMLQRAEGAGRLLLTMGQNRSHDFGLMWYLKELNKKE
FT                   FIKFKEFLIQEILKLKLKQISWTEVKKASREDLANLLLKCYEENQAWDMTFNILQKINR
FT                   KDLTERATEEIADSSPLGLTDSGNPKLYRDHLKKKLTHDCSKKFNVRIQDFIKEIFIQN
FT                   DCDTFENLLISKGTEKKPHMVFLQGMAGIGKTMMLKNLMLAWSKGLVFQNKFSYTFYFC
FT                   CRDVKQLKTASLAELISREWPSPSAPIEEILSQPEKLLFIIDSLEGMECDLTKQESELC
FT                   DNCMEKQPVSILLSSLLTRKMLPESSFLLSTTPETFEKMEDRILCTDVKTATAFDERSI
FT                   KIYFHRLFQDKIRAQEAFSLVRENEQLFTICQVPLLCWMVATCLKEEIEKGGDPVSVCR
FT                   HITSLYTTHILNLFIPQSAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFGEEALRRNGIL
FT                   DSDIPTLLDIGMLGKIREFENYYIFLHPSVQEVCAAIFYLLKSHVDHPSQDVKSIETVL
FT                   FMFLKKVKTQWIFLGCFIFGLLQKSEQEKLVVFFGRRLSQKIQHKLYQCLETISGNAEL
FT                   QEQIDGMKLFCCLSEIEDEAFLVKVMNCMQQINFVAKNYSDLILAAYCLKHCSTLKKLS
FT                   FSTQNVLNEKGNQRCMKKLIICWNDMCSVFVRSKDIQVLQIKDTSFNEPAIRILYEYLK
FT                   YPSFTLNKLVANNVHFFGDNHAFFELIQNCSLQYLDLGCSFLTHSEVKLLCDVLNQAEC
FT                   NIEKLVVSHCKLSPDDCKIFGSVLMSSKTLKVLNLAYNNLNQGISLLCKALCHPDCILE
FT                   YLVLANCSLSEQCWDYLSEVLRQNKTLSHLDISSNDLKDKGLKILCRALTLPYCALKSL
FT                   YLNNCQITARGCQDLAKVLRNNQNLKCLHISNNKLKDAGLMLLCKAIKHPNCHLEDLRL
FT                   EACEITGASNEDLRYAFMQCETLQMINLMGNALEVSRMIFFPRF"
FT   gene            complement(<181354..227353)
FT                   /locus_tag="mCG_23594"
FT                   /note="gene_id=mCG23594.2"
FT   mRNA            complement(join(<181354..182624,207174..208228,
FT                   209225..209285,209485..209611,226362..226436,
FT                   227246..227353))
FT                   /locus_tag="mCG_23594"
FT                   /product="mCG23594"
FT                   /note="gene_id=mCG23594.2 transcript_id=mCT23530.2 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(181354..182624,207174..208228,
FT                   209225..209285,209485..209611,226362..226436,
FT                   227246..227248))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23594"
FT                   /product="mCG23594"
FT                   /note="gene_id=mCG23594.2 transcript_id=mCT23530.2
FT                   protein_id=mCP6730.2"
FT                   /protein_id="EDL37178.1"
FT                   /translation="MYLEDSPATSFRLGPGWSVQRRRHQRNAMTYADVHVNFTWEEWAL
FT                   LNPSQKSLYKEVMLETYENLTAIGYNWEDHYIEEQFQSSRRDGRHKRGHTGEKPYECNH
FT                   CGTAFARHGHLQRHKGTHTGEKLYECNRCGKVFAWNCHLRIHKRTHSGEKPYECDQCGT
FT                   AFASHCRLQRHKRTHTGEKPYECNQCGKAFTQHSTLQVHKRTHTGEKPYECSQCGKAYS
FT                   RHSHLQRHKRTHTGEKPYVCNQCGKAFAYQNSLQYHKRTHTGEKSYECKQCGKFFPCRK
FT                   HLQIHKRTHAGQKGYECNKCGKAFAFHSHFQRHKRHIGEKPYECNHCDKAFASHNNLQK
FT                   HIRRHTGEKPYKCNLCDKAYAHHSHLQTHERVHTEEKPYKCNQCDKAFSQQSSLQVHKR
FT                   IHTGEKPYECNQCGKAFTCHRYLQRHKRTHTGEKPYECNQFAFAQHGHLQMHIMIHTGE
FT                   KPYKCNQCGKALASHSYLRVHKRTHTGEKPYGCDQCGKTFAQHSYLQIHKRIHTGEKPY
FT                   KCNQCGKAFASHSNLQVHKRTHTGEKAYECNQCGKAFAYHSCLQIHKRKHTGEKPYKCN
FT                   QCNKAFVQHSDLQMHIITHTGEKPYKCNQCGKAFASHSYLQVHKRTHTGEKPYECNQCG
FT                   KAFAYHGRLQIHKRTHTGEKPYECNQCGKAFAYHGRLQIHKRTHTGEKPYECNQCGKAF
FT                   AQHSNLQVHKRTHTGEKPYECNQCGKAFAYHSYLQVHKRIHTGEKPYECDQCGKTFAYH
FT                   GHLQIHERTHTGEKPYECNKCDKAFAGQNDLKRHERIHTGEKPYKCNDCSKSFACNTSL
FT                   RIHKAAHTGVKPYECKQCSKSFASHGQLQSHERIHTGEKSYKCNQYGKAFA"
FT   gene            complement(279734..285353)
FT                   /gene="Ccr5"
FT                   /locus_tag="mCG_16378"
FT                   /note="gene_id=mCG16378.1"
FT   mRNA            complement(join(279734..282568,285291..285353))
FT                   /gene="Ccr5"
FT                   /locus_tag="mCG_16378"
FT                   /product="chemokine (C-C motif) receptor 5"
FT                   /note="gene_id=mCG16378.1 transcript_id=mCT17344.2 created
FT                   on 21-MAY-2002"
FT   CDS             complement(281493..282557)
FT                   /codon_start=1
FT                   /gene="Ccr5"
FT                   /locus_tag="mCG_16378"
FT                   /product="chemokine (C-C motif) receptor 5"
FT                   /note="gene_id=mCG16378.1 transcript_id=mCT17344.2
FT                   protein_id=mCP9318.1"
FT                   /db_xref="GOA:P51682"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002240"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:107182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51682"
FT                   /protein_id="EDL37177.1"
FT                   /translation="MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIF
FT                   GFVGNMMVFLILISCKKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCK
FT                   VFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASL
FT                   PEIIFTRSQKEGFHYTCSPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHT
FT                   LFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAM
FT                   QATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSV
FT                   YTRSTGEHEVSTGL"
FT   gene            complement(297703..304878)
FT                   /gene="Ccr2"
FT                   /locus_tag="mCG_16379"
FT                   /note="gene_id=mCG16379.2"
FT   mRNA            complement(join(297703..301171,302794..302890,
FT                   304620..304878))
FT                   /gene="Ccr2"
FT                   /locus_tag="mCG_16379"
FT                   /product="chemokine (C-C motif) receptor 2"
FT                   /note="gene_id=mCG16379.2 transcript_id=mCT17346.1 created
FT                   on 21-MAY-2002"
FT   CDS             complement(300039..301160)
FT                   /codon_start=1
FT                   /gene="Ccr2"
FT                   /locus_tag="mCG_16379"
FT                   /product="chemokine (C-C motif) receptor 2"
FT                   /note="gene_id=mCG16379.2 transcript_id=mCT17346.1
FT                   protein_id=mCP9314.1"
FT                   /db_xref="GOA:Q543S8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002237"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:106185"
FT                   /db_xref="UniProtKB/TrEMBL:Q543S8"
FT                   /protein_id="EDL37176.1"
FT                   /translation="MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPC
FT                   HKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLF
FT                   LLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALK
FT                   ARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNIL
FT                   SLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTF
FT                   QESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKR
FT                   LCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL"
FT   gene            complement(376238..385215)
FT                   /gene="Ccr3"
FT                   /locus_tag="mCG_16380"
FT                   /note="gene_id=mCG16380.2"
FT   mRNA            complement(join(376238..378573,385020..385215))
FT                   /gene="Ccr3"
FT                   /locus_tag="mCG_16380"
FT                   /product="chemokine (C-C motif) receptor 3"
FT                   /note="gene_id=mCG16380.2 transcript_id=mCT17345.3 created
FT                   on 15-JUL-2003"
FT   CDS             complement(377483..378562)
FT                   /codon_start=1
FT                   /gene="Ccr3"
FT                   /locus_tag="mCG_16380"
FT                   /product="chemokine (C-C motif) receptor 3"
FT                   /note="gene_id=mCG16380.2 transcript_id=mCT17345.3
FT                   protein_id=mCP9315.1"
FT                   /db_xref="GOA:P51678"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002238"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104616"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51678"
FT                   /protein_id="EDL37175.1"
FT                   /translation="MAFNTDEIKTVVESFETTPYEYEWAPPCEKVRIKELGSWLLPPLY
FT                   SLVFIIGLLGNMMVVLILIKYRKLQIMTNIYLFNLAISDLLFLFTVPFWIHYVLWNEWG
FT                   FGHYMCKMLSGFYYLALYSEIFFIILLTIDRYLAIVHAVFALRARTVTFATITSIITWG
FT                   LAGLAALPEFIFHESQDSFGEFSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVIC
FT                   YSGIIKTLLRCPNKKKHKAIRLIFVVMIVFFIFWTPYNLVLLFSAFHSTFLETSCQQSK
FT                   HLDLAMQVTEVIAYTHCCINPVIYAFVGERFRKHLRLFFHRNVAVYLGKYIPFLPGEKM
FT                   ERTSSVSPSTGEQEISVVF"
FT   gene            <428182..>429252
FT                   /gene="Ccr1l1"
FT                   /locus_tag="mCG_16376"
FT                   /note="gene_id=mCG16376.0"
FT   mRNA            <428182..>429252
FT                   /gene="Ccr1l1"
FT                   /locus_tag="mCG_16376"
FT                   /product="chemokine (C-C motif) receptor 1-like 1"
FT                   /note="gene_id=mCG16376.0 transcript_id=mCT17342.0 created
FT                   on 21-MAY-2002"
FT   CDS             428182..429252
FT                   /codon_start=1
FT                   /gene="Ccr1l1"
FT                   /locus_tag="mCG_16376"
FT                   /product="chemokine (C-C motif) receptor 1-like 1"
FT                   /note="gene_id=mCG16376.0 transcript_id=mCT17342.0
FT                   protein_id=mCP9316.0"
FT                   /db_xref="GOA:P51676"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002236"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104617"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51676"
FT                   /protein_id="EDL37174.1"
FT                   /translation="MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLV
FT                   FIIGVIGHVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGN
FT                   AMCKFVSGFYYLGLYSDMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAA
FT                   LVSIPCLYVFKSQMEFTYHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTR
FT                   IINVLHRRPNKKKAKVMRLIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVD
FT                   LSLMITEALAYTHCCVNPVIYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRA
FT                   SATPPSTVEIETSADL"
FT   gene            437896..443591
FT                   /gene="Ccr1"
FT                   /locus_tag="mCG_16377"
FT                   /note="gene_id=mCG16377.1"
FT   mRNA            join(437896..438294,442031..443591)
FT                   /gene="Ccr1"
FT                   /locus_tag="mCG_16377"
FT                   /product="chemokine (C-C motif) receptor 1"
FT                   /note="gene_id=mCG16377.1 transcript_id=mCT17343.2 created
FT                   on 21-MAY-2002"
FT   CDS             442098..443165
FT                   /codon_start=1
FT                   /gene="Ccr1"
FT                   /locus_tag="mCG_16377"
FT                   /product="chemokine (C-C motif) receptor 1"
FT                   /note="gene_id=mCG16377.1 transcript_id=mCT17343.2
FT                   protein_id=mCP9317.1"
FT                   /db_xref="GOA:P51675"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002236"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104618"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51675"
FT                   /protein_id="EDL37173.1"
FT                   /translation="MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVF
FT                   IIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDA
FT                   MCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAIL
FT                   ASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGI
FT                   IRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDL
FT                   AMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTS
FT                   SISPSTGEHELSAGF"
FT   gene            <462224..>487302
FT                   /locus_tag="mCG_1045544"
FT                   /note="gene_id=mCG1045544.0"
FT   mRNA            join(<462224..462421,485160..>487302)
FT                   /locus_tag="mCG_1045544"
FT                   /product="mCG1045544"
FT                   /note="gene_id=mCG1045544.0 transcript_id=mCT163248.0
FT                   created on 21-MAY-2002"
FT   CDS             join(<462224..462421,485160..>487302)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045544"
FT                   /product="mCG1045544"
FT                   /note="gene_id=mCG1045544.0 transcript_id=mCT163248.0
FT                   protein_id=mCP67072.0 partial"
FT                   /protein_id="EDL37170.1"
FT                   /translation="SSSSSSSSSSSSSSSSSPPPSPSSSPPPPHPPPPSXXXXXXXLPP
FT                   PSPSPLPLPPHPPLPPPPCSPKITQLHPPASENHSQSSPCLRKSLTVIPLPQKITHSHP
FT                   PASENHSQTSPCLRKSLTVIPLPRKSLSHPPASHSHTATSPCPTVTQHHPPASENHSQS
FT                   APCFRKSLTVIPLPQKITHSHPSASENHSQSSPCLRKSLAVSPLPQKITHSHPPASENH
FT                   SQTSPCLRKSLTVISLPQKITHSHPPASHSHTATSPCPTVTQHHPPASENHSQSSPCLR
FT                   KSLRVIPLPQKITHSHPPASKITHRHSPASENHSLSSPCLRKSLTVIPLSQKITHRHPP
FT                   ASENHSLSSPCLRKSLTVIPLPHTLTQPHPPSPQLLSIIPLPQKITHSQPPASENHSQS
FT                   SPCLRKSLTDIPLPQKITHCHPPASENHSQSSLGLRKSLTVIPLPHTVTQPHPPAPQLL
FT                   SIIPLCQKITHCHPPVSVNHSQSSPCLRKSLTVIPLPQKITHSYPPASENHSQTSPSLR
FT                   KSLTVIPLPQKITHSHPPASENHSQLCPCLRKSLTDIPLPQKITHCHHPASENHSQPSP
FT                   CLTQSYSNIPLPHSYSTSSICLRKSLTVSPPLQKITHSHPPASENHSQSSPCLRKSLTV
FT                   MPLPQKITHSHPPASENHSQSAPCFRKSLTVIPLPQKITHSHPSASENHSRHPPASENH
FT                   SLSSPCPRKSLTVIPLPHTVTQPHPPAPQLLSIIPLPQKITHSQPPASENHSQTSPASE
FT                   NHLQSSPCLKQSHSHIPLPHSYSASSP"
FT   gene            complement(478297..481505)
FT                   /locus_tag="mCG_148284"
FT                   /note="gene_id=mCG148284.0"
FT   mRNA            complement(join(478297..479754,481431..481505))
FT                   /locus_tag="mCG_148284"
FT                   /product="mCG148284"
FT                   /note="gene_id=mCG148284.0 transcript_id=mCT188547.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(478778..478912)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148284"
FT                   /product="mCG148284"
FT                   /note="gene_id=mCG148284.0 transcript_id=mCT188547.0
FT                   protein_id=mCP109723.0"
FT                   /protein_id="EDL37172.1"
FT                   /translation="MGHQDLNRKHVLCHTVLCVGNLRHLSGVVSLQSLSDEGERLLRH"
FT   gene            complement(<483166..484062)
FT                   /locus_tag="mCG_148283"
FT                   /note="gene_id=mCG148283.0"
FT   mRNA            complement(<483166..484062)
FT                   /locus_tag="mCG_148283"
FT                   /product="mCG148283"
FT                   /note="gene_id=mCG148283.0 transcript_id=mCT188546.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<483166..483711)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148283"
FT                   /product="mCG148283"
FT                   /note="gene_id=mCG148283.0 transcript_id=mCT188546.0
FT                   protein_id=mCP109722.0"
FT                   /protein_id="EDL37171.1"
FT                   /translation="MTVSDFLRRGSTRRPGVKRTREPALRFPPVGHERRGRRAPGARSD
FT                   VRACAGSTWKLSPAGPGPPAVCAVAASPRLGSDIVGSWGPRGPIWSHLCSSYSEPRLSP
FT                   RHVKSPQSRDPAPPPEPPWPQALWESCRETDLPQPGHLAADGPATAWARSRGVGWVAAL
FT                   ISRLRRINEIKSAGGPDLI"
FT   assembly_gap    1233..1380
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    55732..55751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    73221..74012
FT                   /estimated_length=792
FT                   /gap_type="unknown"
FT   assembly_gap    77285..77965
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    87525..87634
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    100229..100785
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    103897..103916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    111240..111259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    112341..112360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    113449..113468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    114651..114670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    116048..118224
FT                   /estimated_length=2177
FT                   /gap_type="unknown"
FT   assembly_gap    131266..131285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    159677..163344
FT                   /estimated_length=3668
FT                   /gap_type="unknown"
FT   assembly_gap    166883..166902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    176216..176235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    177240..178175
FT                   /estimated_length=936
FT                   /gap_type="unknown"
FT   assembly_gap    182658..182677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    183794..183999
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    200243..201525
FT                   /estimated_length=1283
FT                   /gap_type="unknown"
FT   assembly_gap    215604..215623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    227606..228157
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    238096..238115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    245724..245743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    254048..254067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    258243..258736
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    264149..264970
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    269336..269355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    274493..274512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    350880..350900
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    361727..361832
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    366442..366461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    367763..367782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    368797..368816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    374733..374752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    391284..391303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    397382..399313
FT                   /estimated_length=1932
FT                   /gap_type="unknown"
FT   assembly_gap    401726..401745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    414325..414468
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    446500..446974
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    462330..462349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    473445..478296
FT                   /estimated_length=4852
FT                   /gap_type="unknown"
FT   assembly_gap    481025..481044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01082693.1:1..1232),gap(148),
CO   complement(AAHY01082694.1:1..54351),gap(20),
CO   complement(AAHY01082695.1:1..17469),gap(792),
CO   complement(AAHY01082696.1:1..3272),gap(681),
CO   complement(AAHY01082697.1:1..9559),gap(110),
CO   complement(AAHY01082698.1:1..12594),gap(557),
CO   complement(AAHY01082699.1:1..3111),gap(20),AAHY01082700.1:1..7323,gap(20),
CO   complement(AAHY01082701.1:1..1081),gap(20),
CO   complement(AAHY01082702.1:1..1088),gap(20),
CO   complement(AAHY01082703.1:1..1182),gap(20),
CO   complement(AAHY01082704.1:1..1377),gap(2177),
CO   complement(AAHY01082705.1:1..13041),gap(20),
CO   complement(AAHY01082706.1:1..28391),gap(3668),
CO   complement(AAHY01082707.1:1..3538),gap(20),
CO   complement(AAHY01082708.1:1..9313),gap(20),AAHY01082709.1:1..1004,gap(936),
CO   AAHY01082710.1:1..4482,gap(20),complement(AAHY01082711.1:1..1116),gap(206),
CO   complement(AAHY01082712.1:1..16243),gap(1283),
CO   complement(AAHY01082713.1:1..14078),gap(20),AAHY01082714.1:1..11982,
CO   gap(552),complement(AAHY01082715.1:1..9938),gap(20),
CO   complement(AAHY01082716.1:1..7608),gap(20),
CO   complement(AAHY01082717.1:1..8304),gap(20),
CO   complement(AAHY01082718.1:1..4175),gap(494),
CO   complement(AAHY01082719.1:1..5412),gap(822),
CO   complement(AAHY01082720.1:1..4365),gap(20),
CO   complement(AAHY01082721.1:1..5137),gap(20),
CO   complement(AAHY01082722.1:1..76367),gap(21),AAHY01082723.1:1..10826,
CO   gap(106),complement(AAHY01082724.1:1..4609),gap(20),AAHY01082725.1:1..1301,
CO   gap(20),complement(AAHY01082726.1:1..1014),gap(20),
CO   complement(AAHY01082727.1:1..5916),gap(20),
CO   complement(AAHY01082728.1:1..16531),gap(20),
CO   complement(AAHY01082729.1:1..6078),gap(1932),
CO   complement(AAHY01082730.1:1..2412),gap(20),
CO   complement(AAHY01082731.1:1..12579),gap(144),
CO   complement(AAHY01082732.1:1..32031),gap(475),
CO   complement(AAHY01082733.1:1..15355),gap(20),
CO   complement(AAHY01082734.1:1..11095),gap(4852),
CO   complement(AAHY01082735.1:1..2728),gap(20),AAHY01082736.1:1..6406)
//


spacer
spacer