spacer

EBI Dbfetch

ID   CH466654; SV 2; linear; genomic DNA; CON; MUS; 1614244 BP.
XX
AC   CH466654;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009848419 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1614244
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-1614244
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-1614244
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 6325cd929869d019729a905818f0b983.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000215.
DR   Ensembl-Gn; ENSMUSG00000001918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003099; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006021; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007209; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023159; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030376; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041117; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058230; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063594; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070802; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074365; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006178; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108496; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144408; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176506; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70975916.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1614244
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3135..5662
FT                   /estimated_length=2528
FT                   /gap_type="unknown"
FT   assembly_gap    10870..12030
FT                   /estimated_length=1161
FT                   /gap_type="unknown"
FT   assembly_gap    13471..15238
FT                   /estimated_length=1768
FT                   /gap_type="unknown"
FT   assembly_gap    21006..22983
FT                   /estimated_length=1978
FT                   /gap_type="unknown"
FT   assembly_gap    26469..26592
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    28785..28804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31321..31479
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    48362..51408
FT                   /estimated_length=3047
FT                   /gap_type="unknown"
FT   assembly_gap    62930..63442
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    70679..71738
FT                   /estimated_length=1060
FT                   /gap_type="unknown"
FT   assembly_gap    75245..76784
FT                   /estimated_length=1540
FT                   /gap_type="unknown"
FT   assembly_gap    78562..79685
FT                   /estimated_length=1124
FT                   /gap_type="unknown"
FT   assembly_gap    88164..88480
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    93649..97683
FT                   /estimated_length=4035
FT                   /gap_type="unknown"
FT   assembly_gap    104785..104804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            110332..119731
FT                   /locus_tag="mCG_4771"
FT                   /note="gene_id=mCG4771.1"
FT   mRNA            join(110332..110366,117442..117703,117829..118028,
FT                   118485..119731)
FT                   /locus_tag="mCG_4771"
FT                   /product="mCG4771"
FT                   /note="gene_id=mCG4771.1 transcript_id=mCT4205.1 created on
FT                   02-MAY-2002"
FT   CDS             join(117487..117703,117829..118028,118485..118943)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4771"
FT                   /product="mCG4771"
FT                   /note="gene_id=mCG4771.1 transcript_id=mCT4205.1
FT                   protein_id=mCP18092.1"
FT                   /db_xref="GOA:G3X9P6"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:2149035"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9P6"
FT                   /protein_id="EDL42125.1"
FT                   /translation="MAEGPSLHPKLQVASNIPIEIRSQIPQEPARNLAFQMSQSPLVTP
FT                   GSTMQSSLSVPERNLLQQESEGSSRQSGSMPLSDKYVNKQTGPMASRKFRKERTVYTKE
FT                   QQRLLQKHFDECQYPNEKKIMELAVSVGVTKMEIKIWFKNNRAKYRRMNLQNIKQALPE
FT                   SNGISKAVSESTHFPGSIPVVASDNGESMCSGTFGEDSMPKFNCSQESSLYCFQACDGD
FT                   MCCPQEYLLDGHAPVTAWNSGQSAAVEYQTDIAVAEAPVRLAYAAQAPEDAHNSGPSAD
FT                   ELWQRILEDF"
FT   assembly_gap    124160..124179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    125220..125239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    143868..163602
FT                   /estimated_length=19735
FT                   /gap_type="unknown"
FT   assembly_gap    164956..167582
FT                   /estimated_length=2627
FT                   /gap_type="unknown"
FT   assembly_gap    186837..186856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(190339..195872)
FT                   /gene="Obox6"
FT                   /locus_tag="mCG_2062"
FT                   /note="gene_id=mCG2062.2"
FT   mRNA            complement(join(190339..191039,191469..191668,
FT                   191795..192054,195828..195872))
FT                   /gene="Obox6"
FT                   /locus_tag="mCG_2062"
FT                   /product="oocyte specific homeobox 6, transcript variant
FT                   mCT168557"
FT                   /note="gene_id=mCG2062.2 transcript_id=mCT168557.0 created
FT                   on 02-MAY-2002"
FT   mRNA            complement(join(190339..191039,191469..192054,
FT                   195828..195872))
FT                   /gene="Obox6"
FT                   /locus_tag="mCG_2062"
FT                   /product="oocyte specific homeobox 6, transcript variant
FT                   mCT7838"
FT                   /note="gene_id=mCG2062.2 transcript_id=mCT7838.2 created on
FT                   02-MAY-2002"
FT   CDS             complement(join(190566..191039,191469..191668,
FT                   191795..192038))
FT                   /codon_start=1
FT                   /gene="Obox6"
FT                   /locus_tag="mCG_2062"
FT                   /product="oocyte specific homeobox 6, isoform CRA_a"
FT                   /note="gene_id=mCG2062.2 transcript_id=mCT168557.0
FT                   protein_id=mCP91418.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VHG3"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VHG3"
FT                   /protein_id="EDL42123.1"
FT                   /translation="MLQYNQSPHMPQDPSLHSKFQMSSSAPIEISFQMHQEPARNLPFQ
FT                   MCQSPLVIPRSPMQSSHSVPERDLCPQESQGPSGKSRPMVRSPSYGDRRVSLVTPRKHR
FT                   KIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQIWFKNHRAKSKRESL
FT                   QNVPAALPETNGSSEAVSESVHFPDSLPVVASANGESMWSGTFGEDSIPNLNWSQESSP
FT                   PHYQACDSARYCPQEYLLNGHAPVTAWNSGQSVAVEVQTGLAVAEAPVVMVASTQGPEY
FT                   AQDSGPSTEELWQRVLEDFDELGD"
FT   CDS             complement(join(190566..191039,191469..192038))
FT                   /codon_start=1
FT                   /gene="Obox6"
FT                   /locus_tag="mCG_2062"
FT                   /product="oocyte specific homeobox 6, isoform CRA_b"
FT                   /note="gene_id=mCG2062.2 transcript_id=mCT7838.2
FT                   protein_id=mCP23777.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9U1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:2149036"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9U1"
FT                   /protein_id="EDL42124.1"
FT                   /translation="MLQYNQSPHMPQDPSLHSKFQMSSSAPIEISFQMHQEPARNLPFQ
FT                   MCQSPLVIPRSPMQSSHSVPERDLCPQESQGPSGKSSIQMQPGLVMDPALPILRSLLMH
FT                   SPHQIPSRSSVRAGFQGSLGPMVRSPSYGDRRVSLVTPRKHRKIRTVYTEEQKCVLKKH
FT                   FHKCTYPSREQRMALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAV
FT                   SESVHFPDSLPVVASANGESMWSGTFGEDSIPNLNWSQESSPPHYQACDSARYCPQEYL
FT                   LNGHAPVTAWNSGQSVAVEVQTGLAVAEAPVVMVASTQGPEYAQDSGPSTEELWQRVLE
FT                   DFDELGD"
FT   assembly_gap    196793..196812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    219471..219490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(223795..236770)
FT                   /gene="Crx"
FT                   /locus_tag="mCG_2059"
FT                   /note="gene_id=mCG2059.1"
FT   mRNA            complement(join(223795..224994,225906..226057,
FT                   228006..228138,236678..236770))
FT                   /gene="Crx"
FT                   /locus_tag="mCG_2059"
FT                   /product="cone-rod homeobox containing gene"
FT                   /note="gene_id=mCG2059.1 transcript_id=mCT7836.1 created on
FT                   02-MAY-2002"
FT   CDS             complement(join(224347..224994,225906..226057,
FT                   228006..228105))
FT                   /codon_start=1
FT                   /gene="Crx"
FT                   /locus_tag="mCG_2059"
FT                   /product="cone-rod homeobox containing gene"
FT                   /note="gene_id=mCG2059.1 transcript_id=mCT7836.1
FT                   protein_id=mCP23764.2"
FT                   /db_xref="GOA:Q543C9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013851"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:1194883"
FT                   /db_xref="UniProtKB/TrEMBL:Q543C9"
FT                   /protein_id="EDL42122.1"
FT                   /translation="MMAYMNPGPHYSVNALALSGPNVDLMHQAVPYSSAPRKQRRERTT
FT                   FTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQ
FT                   QQPPGAQTKARPAKRKAGTSPRPSTDVCTDPLGISDSYSPSLPGPSGSPTTAVATVSIW
FT                   SPASEAPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYASPSSYFSGLDPYL
FT                   SPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYSTYSPVDSLEFKDPTGTWKFTYN
FT                   PMDPLDYKDQSAWKFQIL"
FT   assembly_gap    227076..227327
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    252258..256628
FT                   /estimated_length=4371
FT                   /gap_type="unknown"
FT   gene            258461..260846
FT                   /locus_tag="mCG_131788"
FT                   /note="gene_id=mCG131788.1"
FT   mRNA            join(258461..258554,259666..259823,260516..260846)
FT                   /locus_tag="mCG_131788"
FT                   /product="mCG131788"
FT                   /note="gene_id=mCG131788.1 transcript_id=mCT133129.1
FT                   created on 20-NOV-2003"
FT   CDS             join(258521..258554,259666..259823,260516..260752)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131788"
FT                   /product="mCG131788"
FT                   /note="gene_id=mCG131788.1 transcript_id=mCT133129.1
FT                   protein_id=mCP76995.1"
FT                   /db_xref="GOA:B6ZND9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:2451355"
FT                   /db_xref="UniProtKB/TrEMBL:B6ZND9"
FT                   /protein_id="EDL42121.1"
FT                   /translation="MEEIDGMIVQMRLKDSKTVLISKTELTDEQFQKLRKHFETDRCPN
FT                   EETLQAFAEELKLRKDLIRSWFITQRHRMRGYRRLFMRYYRDWKTSREYSTTRSFDRQK
FT                   NSKECSQNDPGLPEALEALKRLKLSSGYQSRDGMSQDF"
FT   gene            complement(274009..>279170)
FT                   /gene="Sepw1"
FT                   /locus_tag="mCG_2060"
FT                   /note="gene_id=mCG2060.2"
FT   mRNA            complement(join(274009..274338,276647..276745,
FT                   276842..276916,277104..277157,277248..277272,
FT                   279051..>279170))
FT                   /gene="Sepw1"
FT                   /locus_tag="mCG_2060"
FT                   /product="selenoprotein W, muscle 1"
FT                   /note="gene_id=mCG2060.2 transcript_id=mCT7835.2 created on
FT                   01-MAY-2002"
FT   CDS             complement(join(276662..276745,276842..276916,
FT                   277104..277157,277248..>277262))
FT                   /codon_start=1
FT                   /gene="Sepw1"
FT                   /locus_tag="mCG_2060"
FT                   /product="selenoprotein W, muscle 1"
FT                   /note="gene_id=mCG2060.2 transcript_id=mCT7835.2
FT                   protein_id=mCP23768.1"
FT                   /protein_id="EDL42120.1"
FT                   /translation="GYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVH
FT                   SKKRGDGYVDTESKFRKLVTAIKAALAQCQ"
FT   assembly_gap    284089..284115
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            complement(294677..302902)
FT                   /locus_tag="mCG_2065"
FT                   /note="gene_id=mCG2065.1"
FT   mRNA            complement(join(294677..294728,295013..295069,
FT                   295191..295267,295750..295816,295928..296103,
FT                   296293..296493,296568..296672,296977..297072,
FT                   298579..298649,299014..299213,299628..299736,
FT                   302129..302193,302669..302902))
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, transcript variant mCT7841"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT7841.1 created on
FT                   01-MAY-2002"
FT   mRNA            complement(join(294677..294728,295013..295069,
FT                   295191..295267,295750..295816,295928..296103,
FT                   296293..296493,296568..296672,296977..297072,
FT                   298221..298244,298579..298649,299014..299213,
FT                   299628..299736,302129..302193,302669..302902))
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, transcript variant mCT168474"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT168474.0 created
FT                   on 01-MAY-2002"
FT   mRNA            complement(join(294677..295069,295191..295267,
FT                   295750..295816,295928..296103,296293..296493,
FT                   296568..296672,296977..297072,298579..298649,
FT                   299014..299213,299628..299736,302129..302193,
FT                   302357..>302589))
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, transcript variant mCT194145"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT194145.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(294680..295069,295191..295267,
FT                   295750..295816,295928..296103,296293..296493,
FT                   296568..296672,296977..297072,298579..298649,
FT                   299014..299213,299628..299736,302129..302193,
FT                   302669..302902))
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, transcript variant mCT168475"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT168475.0 created
FT                   on 01-MAY-2002"
FT   CDS             complement(join(294722..294728,295013..295069,
FT                   295191..295267,295750..295816,295928..296103,
FT                   296293..296493,296568..296672,296977..297072,
FT                   298579..298649,299014..299213,299628..299736,
FT                   302129..302193,302669..302892))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, isoform CRA_c"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT7841.1
FT                   protein_id=mCP23779.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BK35"
FT                   /db_xref="InterPro:IPR011211"
FT                   /db_xref="InterPro:IPR011687"
FT                   /db_xref="MGI:MGI:2154441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BK35"
FT                   /protein_id="EDL42118.1"
FT                   /translation="MAAGGNRDGEKRGSRSQADSGFLGLRPTSVDPALRRRRRGPRNKK
FT                   RGWRRLAEEPLGLEVDQFLEDVRLQERTTGGLLAEAPNEKLFFVDTGFKRKEPRKKRTL
FT                   VQKKSQRLQKPLRVDLALENHSKIPAPKDILAHQVPNAKKLRRKEELWEKLAKQGELPR
FT                   DVRKAQARLLSPPTPKAKPGPQDIIERPFYDLWNPDNPLDTPLIGQDAFFLEQTKKKGV
FT                   RRPQRLHIKPSQVPAVEVIPAGASYNPTFEDHQALLREAHEVELQREKEAEKLERQLAL
FT                   PTSEQAATQESVFREMCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRM
FT                   EKKTEQQRRREKAARKLRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRR
FT                   IRRLAEADKPRRLGRLKYQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQKRNMIE
FT                   PRERAKFKRKYKVKLVEKRAYREIQL"
FT   CDS             complement(join(294722..294728,295013..295069,
FT                   295191..295267,295750..295816,295928..296103,
FT                   296293..296493,296568..296672,296977..297072,
FT                   298221..298244,298579..298649,299014..299213,
FT                   299628..299736,302129..302193,302669..302892))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, isoform CRA_d"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT168474.0
FT                   protein_id=mCP91409.0 isoform=CRA_d"
FT                   /protein_id="EDL42119.1"
FT                   /translation="MAAGGNRDGEKRGSRSQADSGFLGLRPTSVDPALRRRRRGPRNKK
FT                   RGWRRLAEEPLGLEVDQFLEDVRLQERTTGGLLAEAPNEKLFFVDTGFKRKEPRKKRTL
FT                   VQKKSQRLQKPLRVDLALENHSKIPAPKDILAHQVPNAKKLRRKEELWEKLAKQGELPR
FT                   DVRKAQARLLSPPTPKAKPGPQDIIERPFYDLWNPDNPLDTPLIGQDAFFLEQTKKKGV
FT                   RKPWPSHPCRPQRLHIKPSQVPAVEVIPAGASYNPTFEDHQALLREAHEVELQREKEAE
FT                   KLERQLALPTSEQAATQESVFREMCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTG
FT                   AAGPEKRMEKKTEQQRRREKAARKLRVQQAALRAARLQHQELFRLRGIKAQVARRLAEL
FT                   ARRREQRRIRRLAEADKPRRLGRLKYQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKS
FT                   FQKRNMIEPRERAKFKRKYKVKLVEKRAYREIQL"
FT   CDS             complement(join(295009..295069,295191..295267,
FT                   295750..295816,295928..296103,296293..296493,
FT                   296568..296672,296977..297072,298579..298649,
FT                   299014..299213,299628..299736,302129..302193,
FT                   302669..302892))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, isoform CRA_a"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT168475.0
FT                   protein_id=mCP91410.0 isoform=CRA_a"
FT                   /protein_id="EDL42116.1"
FT                   /translation="MAAGGNRDGEKRGSRSQADSGFLGLRPTSVDPALRRRRRGPRNKK
FT                   RGWRRLAEEPLGLEVDQFLEDVRLQERTTGGLLAEAPNEKLFFVDTGFKRKEPRKKRTL
FT                   VQKKSQRLQKPLRVDLALENHSKIPAPKDILAHQVPNAKKLRRKEELWEKLAKQGELPR
FT                   DVRKAQARLLSPPTPKAKPGPQDIIERPFYDLWNPDNPLDTPLIGQDAFFLEQTKKKGV
FT                   RRPQRLHIKPSQVPAVEVIPAGASYNPTFEDHQALLREAHEVELQREKEAEKLERQLAL
FT                   PTSEQAATQESVFREMCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRM
FT                   EKKTEQQRRREKAARKLRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRR
FT                   IRRLAEADKPRRLGRLKYQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQKRNMIE
FT                   PRERAKFKRKYKVKLVEKRAYREIQ"
FT   CDS             complement(join(295009..295069,295191..295267,
FT                   295750..295816,295928..296103,296293..296493,
FT                   296568..296672,296977..297072,298579..298649,
FT                   299014..299213,299628..299736,302129..302193,
FT                   302357..>302367))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2065"
FT                   /product="mCG2065, isoform CRA_b"
FT                   /note="gene_id=mCG2065.1 transcript_id=mCT194145.0
FT                   protein_id=mCP115115.0 isoform=CRA_b"
FT                   /protein_id="EDL42117.1"
FT                   /translation="KRINGLLAEAPNEKLFFVDTGFKRKEPRKKRTLVQKKSQRLQKPL
FT                   RVDLALENHSKIPAPKDILAHQVPNAKKLRRKEELWEKLAKQGELPRDVRKAQARLLSP
FT                   PTPKAKPGPQDIIERPFYDLWNPDNPLDTPLIGQDAFFLEQTKKKGVRRPQRLHIKPSQ
FT                   VPAVEVIPAGASYNPTFEDHQALLREAHEVELQREKEAEKLERQLALPTSEQAATQESV
FT                   FREMCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRMEKKTEQQRRREK
FT                   AARKLRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRRIRRLAEADKPRR
FT                   LGRLKYQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQKRNMIEPRERAKFKRKYK
FT                   VKLVEKRAYREIQ"
FT   gene            complement(305071..324374)
FT                   /gene="Ehd2"
FT                   /locus_tag="mCG_2068"
FT                   /note="gene_id=mCG2068.1"
FT   mRNA            complement(join(305071..307631,308905..309069,
FT                   314330..314742,320216..320313,320743..321202,
FT                   324256..324374))
FT                   /gene="Ehd2"
FT                   /locus_tag="mCG_2068"
FT                   /product="EH-domain containing 2, transcript variant
FT                   mCT7844"
FT                   /note="gene_id=mCG2068.1 transcript_id=mCT7844.1 created on
FT                   01-MAY-2002"
FT   mRNA            complement(join(305830..307631,308905..309069,
FT                   314330..314742,320216..320313,320743..320873,
FT                   321153..321202,324256..>324288))
FT                   /gene="Ehd2"
FT                   /locus_tag="mCG_2068"
FT                   /product="EH-domain containing 2, transcript variant
FT                   mCT194141"
FT                   /note="gene_id=mCG2068.1 transcript_id=mCT194141.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(307080..307631,308905..309069,
FT                   314330..314742,320216..320313,320743..320873,
FT                   321153..>321182))
FT                   /codon_start=1
FT                   /gene="Ehd2"
FT                   /locus_tag="mCG_2068"
FT                   /product="EH-domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG2068.1 transcript_id=mCT194141.0
FT                   protein_id=mCP115116.0 isoform=CRA_a"
FT                   /protein_id="EDL42114.1"
FT                   /translation="SPWVTQWASKPTTDCFVAVMHGETEGTVPGNALVVDPEKPFRKLN
FT                   PFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLI
FT                   ILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWALGKVV
FT                   GTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARL
FT                   VRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQEL
FT                   LMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQEELESVEAGVQGGAFEGTRMGP
FT                   FVERGPDEAIEDGEEGSEDDAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
FT                   LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPTNLPRRLVPPSKRRQK
FT                   GSAE"
FT   CDS             complement(join(307080..307631,308905..309069,
FT                   314330..314742,320216..320313,320743..321146))
FT                   /codon_start=1
FT                   /gene="Ehd2"
FT                   /locus_tag="mCG_2068"
FT                   /product="EH-domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG2068.1 transcript_id=mCT7844.1
FT                   protein_id=mCP23754.1 isoform=CRA_b"
FT                   /protein_id="EDL42115.1"
FT                   /translation="MFSWLKKGGARGQRPEAIRTVTSSLKELYRTKLLPLEEHYRFGSF
FT                   HSPALEDADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGE
FT                   TEGTVPGNALVVDPEKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQ
FT                   RVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKAD
FT                   MVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRD
FT                   IQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFA
FT                   KIQLEHHISPGDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQ
FT                   EELESVEAGVQGGAFEGTRMGPFVERGPDEAIEDGEEGSEDDAEWVVTKDKSKYDEIFY
FT                   NLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKL
FT                   EGHGLPTNLPRRLVPPSKRRQKGSAE"
FT   gene            complement(328088..>346294)
FT                   /locus_tag="mCG_2090"
FT                   /note="gene_id=mCG2090.2"
FT   mRNA            complement(join(328088..329714,331908..332010,
FT                   332191..332285,332490..332638,333876..333937,
FT                   335514..335623,335840..336020,336176..336811,
FT                   343737..343913,344303..>346294))
FT                   /locus_tag="mCG_2090"
FT                   /product="mCG2090"
FT                   /note="gene_id=mCG2090.2 transcript_id=mCT7866.2 created on
FT                   01-MAY-2002"
FT   CDS             complement(join(328603..329714,331908..332010,
FT                   332191..332285,332490..332638,333876..333937,
FT                   335514..335623,335840..336020,336176..336811,
FT                   343737..343913,344303..>346294))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2090"
FT                   /product="mCG2090"
FT                   /note="gene_id=mCG2090.2 transcript_id=mCT7866.2
FT                   protein_id=mCP23751.2"
FT                   /protein_id="EDL42113.1"
FT                   /translation="LLPSSLDCLQLHVQEAAANHLNPEPSQPAPSVDLDFLEDDILGSP
FT                   AAGGGGGGGGAPDQPCDILQQSLQEANITEQTLEAEAELDLGPFQLPTLQPADNGAGAT
FT                   GAAGATAVTAGPQALFPGSADLLGLQAPPTVLTHQALVPPQDVVNKALSVQPFLQPVGL
FT                   GNVTLQPISGLQGLPNGSPGNAAAATLGLTPIQVVGQPVMALNPPTSQLLAKQVPVSGY
FT                   LASAAGPSEPVTLASAGVSPQGAGLVIQKNLPAAVTTTLNGNSVFAGTGAATAAASGAP
FT                   SGQPLAVAPGLGTSPLVQAPSVILHRTPTPIQPKPTGVLPSKLYQLTPKPFPPTGATLT
FT                   IQGEPGTLPQQPKAPQNLTFMATGKAGQNVVLSGFPAPALQANVFKQPPVTTTGTAPPQ
FT                   PPGALSKPMSVHLLNQGSSIVIPAQHMLPGQNQFLLPGTPAVQLPQSLSALPANVGGQI
FT                   LTAAAPHAGGQLIANPILTNQNLAGPLSLGPVLAPHSGAHSAAHILSAAPIQVGQPALF
FT                   QMPVSLATGSLPTQSQPAPTGPTATTVLQGVTLPPSAVAMLNTPDGLVQPSTPAATTGE
FT                   ATPVLAVQPATQVPPAVTTPLPMGLQQPQAQQPPQVPTPQAATQPQATPPQASPSLASS
FT                   PEKIVLGQAPPAATTAILTQDSLQMFLPQERSQQPLSTEGPHLSVPASVIVSAPPPAQD
FT                   PALATPVTKGAGLGAQTPDSRASPAPAPQIPAAAPLKAPGPASSPSLPHQAPLGDSPHM
FT                   PSPHPARPPSRPPSRPHSRPPSQPQSLTCPPSEPTLHPCPPPQGPPTLPGIFVIQNQLG
FT                   APPPASTPASTAPGPPQPPLRPPSQPPEGPLPPASHLPPASTPSAVASSSEPSARLPVP
FT                   TPPDFQLQFPPSQGPHKSPTPPPALHMVPEPTAPPPPPPRTFQMVTAPFPALPQPKALL
FT                   ERFHQVPSGIILQNKAGGTPTTPQTSTTLGTLTGPTASVLVSGQAPPGTPAASSHVPAS
FT                   TPMATTGLPPLLPAENKAFASNLPTLSVAKATVSGPGKPPAIQYDSKLCSLKKQPLLQP
FT                   SKEACFLEHLHKHQGSVLHPDYKTAFPSFEDALHRLLPYHVYQGALPSPNDYHKVDEEF
FT                   ETVSTQLLKRTQAMLNKYRLLLLEESRRVSPSAEMVMIDRMFIQEEKTTLALDKQLAKE
FT                   KPDEYVSSSRSLGFPVPVSSEGHRLPSHGQSSSSSTSGTSAQPPPHLPTKLVIRHGGAG
FT                   GSPSVTWARASSSLSSTSSSSSSSSAASSLDADEDGPMPTRNRPPIKTYEARSRIGLKL
FT                   KIKQEAGLSKVVHNTALDPVHQPLPAPTPAKGAEPPPHPAPPPLPPATQAQMNGTLDHP
FT                   PPAVRKPTVPASCPRLPLRKTYRENMGNPGAAEGAQGRPRGAGSPTPLPTKVDEATSGL
FT                   IRELAAVEDELYQRVLKGGPPPPETPASATSQGPTEPSWEAPVLPPAKRRKSESPDVDQ
FT                   ASFSSDSPQDDTLTEHLQSAIDSILNLQQAPGRTPAGPYPHTGPTPGTPTSPAPLHRPD
FT                   AFPPSSHNGGLGARTLNR"
FT   gene            <435811..453057
FT                   /locus_tag="mCG_131777"
FT                   /note="gene_id=mCG131777.1"
FT   mRNA            join(<435811..436545,438402..438460,438776..438969,
FT                   439060..439135,439935..440141,446503..446589,
FT                   447089..447231,447537..447640,449015..449090,
FT                   449568..449656,451867..452007,452145..452326,
FT                   452416..453057)
FT                   /locus_tag="mCG_131777"
FT                   /product="mCG131777"
FT                   /note="gene_id=mCG131777.1 transcript_id=mCT133123.1
FT                   created on 02-MAY-2002"
FT   CDS             join(435811..436545,438402..438460,438776..438969,
FT                   439060..439135,439935..440141,446503..446589,
FT                   447089..447231,447537..447640,449015..449090,
FT                   449568..449656,451867..452007,452145..452326,
FT                   452416..452584)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131777"
FT                   /product="mCG131777"
FT                   /note="gene_id=mCG131777.1 transcript_id=mCT133123.1
FT                   protein_id=mCP76975.1"
FT                   /protein_id="EDL42112.1"
FT                   /translation="MQVLQMIAKSQRIFSHTQVATASAQRPGPEGKQSTLKPLQGPWPP
FT                   QTLPPAPTVDSFQIGPGHSEPEGSPVRRRKTMPAVSRETSPGGPRRDTKGGPKVASAPP
FT                   SLTGPGLLPSRNPDSSSLAKGTLDLGDIIPNAGSRQSQLGGDEPAGTQLVGKQGQGENG
FT                   LASGAMRGEKGPACPRGGGYRLFSGHPRAQRFSGFRKEKVKMDVCCAASPSQVAMASFS
FT                   SAGPLADPPRDMKSKLTIFNRIQGGNIYRLPHPVKEESLAGGCHQPNGGPTDWMESKST
FT                   FVCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEQQVKGQMVASVVQGPSVQAYSSPT
FT                   DSNDIDSPSPDPSQQCSQVTPVVLSSLLQGQEKDGEERDSKESCQYRKRKKRPQPKALF
FT                   APPAPSALGEPGPGGCHQSCLHSPVPFPVCFLDQVDSSFGICVVKDDTKISIEPHINVG
FT                   SRFQAEIPELQERLLARVDENVASLVWKPWGDVMTNPETQDRVMELCNVACSSVMPGGG
FT                   TNLELALHCLHDAQGSVQVALETLLLRGPQKPRTHPLADYRYTGSDIWTPMEKRLFKKA
FT                   FCAHKKDFYLIHKTIQTKSVAQCVEYYYIWKKMVKFDCGRAPGLEKRGRRELDEVERTE
FT                   DKVTCSPRERPTHRPTPELKIKTKSYRRESILHSSPSAAPKRTPEPPGSVESQGVFPCR
FT                   ECERVFDKIKSRNAHMKRHRLQEHVEPVRVKWPVKPYPLKEEEEEEEEELGADMGPLQW
FT                   "
FT   gene            455356..474695
FT                   /gene="Napa"
FT                   /locus_tag="mCG_2063"
FT                   /note="gene_id=mCG2063.1"
FT   mRNA            join(455356..455488,464272..464351,465770..465886,
FT                   469305..469351,469833..469910,470071..470126,
FT                   470197..470281,470842..470946,471923..471991,
FT                   472320..472370,473184..474695)
FT                   /gene="Napa"
FT                   /locus_tag="mCG_2063"
FT                   /product="N-ethylmaleimide sensitive fusion protein
FT                   attachment protein alpha"
FT                   /note="gene_id=mCG2063.1 transcript_id=mCT7839.1 created on
FT                   02-MAY-2002"
FT   CDS             join(455391..455488,464272..464351,465770..465886,
FT                   469305..469351,469833..469910,470071..470126,
FT                   470197..470281,470842..470946,471923..471991,
FT                   472320..472370,473184..473285)
FT                   /codon_start=1
FT                   /gene="Napa"
FT                   /locus_tag="mCG_2063"
FT                   /product="N-ethylmaleimide sensitive fusion protein
FT                   attachment protein alpha"
FT                   /note="gene_id=mCG2063.1 transcript_id=mCT7839.1
FT                   protein_id=mCP23769.2"
FT                   /protein_id="EDL42111.1"
FT                   /translation="MDNSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIY
FT                   ARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCL
FT                   MRAIEIYTDMGRFTIAAKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANK
FT                   CLLKVAGYAAQLEQYQKAIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAK
FT                   LAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTEAVKEYDSISRLDQWLTTMLL
FT                   RIKKTIQGDEEDLR"
FT   gene            476605..484230
FT                   /gene="Kptn"
FT                   /locus_tag="mCG_2079"
FT                   /note="gene_id=mCG2079.1"
FT   mRNA            join(476605..476901,477210..477292,477432..477516,
FT                   477590..477644,479755..479830,479920..479993,
FT                   480492..480601,480675..480752,481437..481512,
FT                   482433..482568,482657..482827,483830..484230)
FT                   /gene="Kptn"
FT                   /locus_tag="mCG_2079"
FT                   /product="kaptin"
FT                   /note="gene_id=mCG2079.1 transcript_id=mCT7855.1 created on
FT                   02-MAY-2002"
FT   CDS             join(476679..476901,477210..477292,477432..477516,
FT                   477590..477644,479755..479830,479920..479993,
FT                   480492..480601,480675..480752,481437..481512,
FT                   482433..482568,482657..482827,483830..483955)
FT                   /codon_start=1
FT                   /gene="Kptn"
FT                   /locus_tag="mCG_2079"
FT                   /product="kaptin"
FT                   /note="gene_id=mCG2079.1 transcript_id=mCT7855.1
FT                   protein_id=mCP23740.2"
FT                   /db_xref="GOA:G3X8R1"
FT                   /db_xref="InterPro:IPR029982"
FT                   /db_xref="MGI:MGI:1890380"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R1"
FT                   /protein_id="EDL42110.1"
FT                   /translation="MGEAAVAEGPCPLLEDSFTRFSSQSNVYGLAGGADGRGELLAATL
FT                   KGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDS
FT                   GDKGSPFLNIYCDYEPGSEYNLDSIAESCLNLELQFTPFQLCHAEVQVGDQLETVFLLS
FT                   GNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNLPGSSQRLSALGCQS
FT                   GYVRVAHVDQKNQEILQTWTIQQDGPISRVIVFSLSASEATQDSPQQEGYSLLVASMLE
FT                   PAVVYWDLLNKGLDDQLLLPGSDQFDSVLCGLVTDVDLDGQPEVLVATYGQELLCYKYR
FT                   GLPEDSRGFRLLWRRSFASPLLAMAHVDLTGDGLRELAVISLKGVHILQHSLIQASELV
FT                   LTRLRHQVEQRKHQQGLGDRVGPRPVEHPAS"
FT   gene            <486869..517672
FT                   /gene="Slc8a2"
FT                   /locus_tag="mCG_2077"
FT                   /note="gene_id=mCG2077.3"
FT   mRNA            join(<486869..487133,490535..491225,497233..497897,
FT                   501656..502078,507063..507166,507296..507313,
FT                   509515..509639,509891..509990,513783..514061,
FT                   515406..517109)
FT                   /gene="Slc8a2"
FT                   /locus_tag="mCG_2077"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 2, transcript variant mCT194142"
FT                   /note="gene_id=mCG2077.3 transcript_id=mCT194142.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<486871..487133,490535..491225,497233..497897,
FT                   501656..502078,507063..507166,507296..507313,
FT                   509515..509639,509891..509990,513783..514061,
FT                   515406..515782)
FT                   /codon_start=1
FT                   /gene="Slc8a2"
FT                   /locus_tag="mCG_2077"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG2077.3 transcript_id=mCT194142.0
FT                   protein_id=mCP115118.0 isoform=CRA_a"
FT                   /protein_id="EDL42108.1"
FT                   /translation="PSCIPLPLQSSPLSGAALSTPPFSLSPPPPLGSALLPAPSRFPSS
FT                   HPLSSLLPALPQSPAPLPLSPFSPRAEAPTAGAQRGPARPQGRTSPPPMAPLALMGVVL
FT                   LLGVPHCLGEATPTPSLPPPTANDSDASPEGCQGSYRCQPGVLLPVWEPEDPSLGDKVA
FT                   RAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGTVRIWNETVS
FT                   NLTLMALGSSAPEILLTVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCVYVIPAGE
FT                   SRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLIFFPVCVVFAWMAD
FT                   KRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGTGPAEAR
FT                   ELDASRREVIQILKDLKQKHPDKDLEQLMGIAKYYALLHQQKSRAFYRIQATRLMTGAG
FT                   NVLRRHAADAARRPGATDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQGGEGN
FT                   STFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKDLRIGIIDDDIFEEDEHFFVRLL
FT                   NLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVD
FT                   VRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEY
FT                   EKKDNFFIELGQPQWLKRGISALLLNQGNGDKKITAEQEEAQRIAEMGKPVLGENNRLE
FT                   VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFIEAVTVSAGDEEEDEDGPREERLP
FT                   SCFDYVMHFLTVFWKVLFACVPPTEYCNGWACFGVCILVIGVLTALIGDLASHFGCTVG
FT                   LKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVA
FT                   AVYWAVQGRPFEVRAGTLAFSVTLFTVFAFVCIAVLLYRRRPQIGGELGGPRGPKLATT
FT                   ALFLGLWFLYILFSSLEAYCHIRGF"
FT   mRNA            join(486873..487133,490535..491225,497233..497897,
FT                   501656..502078,507063..507166,507296..507313,
FT                   509515..509639,509891..509990,513783..514061,
FT                   515406..516479,516788..517672)
FT                   /gene="Slc8a2"
FT                   /locus_tag="mCG_2077"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 2, transcript variant mCT7853"
FT                   /note="gene_id=mCG2077.3 transcript_id=mCT7853.2 created on
FT                   02-MAY-2002"
FT   CDS             join(490551..491225,497233..497897,501656..502078,
FT                   507063..507166,507296..507313,509515..509639,
FT                   509891..509990,513783..514061,515406..515782)
FT                   /codon_start=1
FT                   /gene="Slc8a2"
FT                   /locus_tag="mCG_2077"
FT                   /product="solute carrier family 8 (sodium/calcium
FT                   exchanger), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG2077.3 transcript_id=mCT7853.2
FT                   protein_id=mCP23739.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8K596"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR004836"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="MGI:MGI:107996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K596"
FT                   /protein_id="EDL42109.1"
FT                   /translation="MAPLALMGVVLLLGVPHCLGEATPTPSLPPPTANDSDASPEGCQG
FT                   SYRCQPGVLLPVWEPEDPSLGDKVARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKE
FT                   KEITITKANGETSVGTVRIWNETVSNLTLMALGSSAPEILLTVIEVCGHNFQAGELGPG
FT                   TIVGSAAFNMFVVIAVCVYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPG
FT                   VVQVWEALLTLIFFPVCVVFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIE
FT                   LDGTFVGTEVPGELGALGTGPAEARELDASRREVIQILKDLKQKHPDKDLEQLMGIAKY
FT                   YALLHQQKSRAFYRIQATRLMTGAGNVLRRHAADAARRPGATDGAPDDEDDGASRIFFE
FT                   PSLYHCLENCGSVLLSVACQGGEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGET
FT                   QKDLRIGIIDDDIFEEDEHFFVRLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTIL
FT                   DDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDA
FT                   CGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGISALLLNQGNGDKKI
FT                   TAEQEEAQRIAEMGKPVLGENNRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQ
FT                   FIEAVTVSAGDEEEDEDGPREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCNGWACFG
FT                   VCILVIGVLTALIGDLASHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCAD
FT                   ASIGNVTGSNAVNVFLGLGVAWSVAAVYWAVQGRPFEVRAGTLAFSVTLFTVFAFVCIA
FT                   VLLYRRRPQIGGELGGPRGPKLATTALFLGLWFLYILFSSLEAYCHIRGF"
FT   gene            531662..542958
FT                   /gene="Mrg2"
FT                   /locus_tag="mCG_2070"
FT                   /note="gene_id=mCG2070.2"
FT   mRNA            join(531662..531695,531906..532078,533906..534087,
FT                   534223..534382,534475..534525,535306..535356,
FT                   535511..535660,538601..538712,538880..539028,
FT                   540342..540418,540593..540651,541190..541273,
FT                   542209..542282,542818..542958)
FT                   /gene="Mrg2"
FT                   /locus_tag="mCG_2070"
FT                   /product="myeloid ecotropic viral integration site-related
FT                   gene 2"
FT                   /note="gene_id=mCG2070.2 transcript_id=mCT7846.2 created on
FT                   02-MAY-2002"
FT   CDS             join(532067..532078,533906..534087,534223..534382,
FT                   534475..534525,535306..535356,535511..535660,
FT                   538601..538712,538880..539028,540342..540418,
FT                   540593..540651,541190..541273,542209..542258)
FT                   /codon_start=1
FT                   /gene="Mrg2"
FT                   /locus_tag="mCG_2070"
FT                   /product="myeloid ecotropic viral integration site-related
FT                   gene 2"
FT                   /note="gene_id=mCG2070.2 transcript_id=mCT7846.2
FT                   protein_id=mCP23774.1"
FT                   /db_xref="GOA:P97368"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:108519"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97368"
FT                   /protein_id="EDL42107.1"
FT                   /translation="MARRYDELRHYPGITEHTTALASFSEAAPSVPRAPGPYTPHRPPQ
FT                   LQAPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCS
FT                   SDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHR
FT                   YITCLKGKMPIDLVIEDRDGSCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPG
FT                   PSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMR
FT                   AWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASF
FT                   NPEGQPMAGFTETQPQVTVRTPGSMGMNLNLEGEWHYL"
FT   assembly_gap    542959..544838
FT                   /estimated_length=1880
FT                   /gap_type="unknown"
FT   gene            complement(544866..568361)
FT                   /locus_tag="mCG_2071"
FT                   /note="gene_id=mCG2071.2"
FT   mRNA            complement(join(544866..545005,545149..545325,
FT                   545979..546263,548231..548337,549473..549590,
FT                   549876..550049,550169..550405,551710..551811,
FT                   552302..552496,556852..557026,559120..559337,
FT                   560649..560751,561531..561785,562526..562837,
FT                   564314..565276,568325..568361))
FT                   /locus_tag="mCG_2071"
FT                   /product="mCG2071, transcript variant mCT7847"
FT                   /note="gene_id=mCG2071.2 transcript_id=mCT7847.2 created on
FT                   01-MAY-2002"
FT   mRNA            complement(join(544869..545005,545149..545325,
FT                   545979..546263,548231..548337,549473..549590,
FT                   549876..550049,550169..550405,551710..551811,
FT                   552302..552496,556852..557026,559120..559337,
FT                   560649..560751,561531..561785,562526..562837,
FT                   564314..565511,568011..>568148))
FT                   /locus_tag="mCG_2071"
FT                   /product="mCG2071, transcript variant mCT194143"
FT                   /note="gene_id=mCG2071.2 transcript_id=mCT194143.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(552342..552496,556852..557026,
FT                   559120..559337,560649..560751,561531..561785,
FT                   562526..562837,564314..>565090))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2071"
FT                   /product="mCG2071, isoform CRA_a"
FT                   /note="gene_id=mCG2071.2 transcript_id=mCT194143.0
FT                   protein_id=mCP115117.0 isoform=CRA_a"
FT                   /protein_id="EDL42105.1"
FT                   /translation="VRILSLSDQNGDCFCDSSLIGTMPPPRTREGRGHRDRDHHRAPRE
FT                   EEAPEKWDWNCPETRCLLEDVFFRDEDYIRRGSEECQKFWAFFERLQRFQHLKTSQKKK
FT                   KDPGMPKHGIAALADLPLTYDPRYRINLSILSPDTRGRHGPGRGLPPERVSEFRRALLH
FT                   YLDFQQKQAFGRLAKLQRERAALPIAQYGNRILQTLKEHQVVVVAGDTGCGKSTQVPQY
FT                   LLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVGYQIRFESTRSAATKIVFLTV
FT                   GLLLRQIQREPSLPQYQVLIVDEVHERHLHNDFLLGVLQRLLPQRPDLKVILMSATINI
FT                   SLFSSYFSHAPVVQVPGRLFPITVVYQPQEADQTASKSEKLDPRPFLRVLEAIDNKYPP
FT                   EERGDLLVFLSGMAEITTVLDAAQAYASLTQRWVVLPLHSALSVSDQDKVFDVAPAGVR
FT                   KCILSTNIAETSVTIDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWISQASAEQRKGRAG
FT                   RTGPGVCYRLYAESDYDAFAPYPVPEIRRVALDALVLQMKSMSVGDPRTFPFIEPPPPA
FT                   SVETAILYLQEQGALDSSEALTPIGSLLAQLPVDVVIGKMLILGSMFSLAEPVLTIAAA
FT                   LSVQSPFTRSAQSNLDCATARRPLESDQG"
FT   CDS             complement(join(552342..552496,556852..557026,
FT                   559120..559337,560649..560751,561531..561785,
FT                   562526..562837,564314..565024))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2071"
FT                   /product="mCG2071, isoform CRA_b"
FT                   /note="gene_id=mCG2071.2 transcript_id=mCT7847.2
FT                   protein_id=mCP23767.2 isoform=CRA_b"
FT                   /protein_id="EDL42106.1"
FT                   /translation="MPPPRTREGRGHRDRDHHRAPREEEAPEKWDWNCPETRCLLEDVF
FT                   FRDEDYIRRGSEECQKFWAFFERLQRFQHLKTSQKKKKDPGMPKHGIAALADLPLTYDP
FT                   RYRINLSILSPDTRGRHGPGRGLPPERVSEFRRALLHYLDFQQKQAFGRLAKLQRERAA
FT                   LPIAQYGNRILQTLKEHQVVVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISL
FT                   AKRVGFESLSQYGSQVGYQIRFESTRSAATKIVFLTVGLLLRQIQREPSLPQYQVLIVD
FT                   EVHERHLHNDFLLGVLQRLLPQRPDLKVILMSATINISLFSSYFSHAPVVQVPGRLFPI
FT                   TVVYQPQEADQTASKSEKLDPRPFLRVLEAIDNKYPPEERGDLLVFLSGMAEITTVLDA
FT                   AQAYASLTQRWVVLPLHSALSVSDQDKVFDVAPAGVRKCILSTNIAETSVTIDGIRFVV
FT                   DSGKVKEMSYDPQAKLQRLQEFWISQASAEQRKGRAGRTGPGVCYRLYAESDYDAFAPY
FT                   PVPEIRRVALDALVLQMKSMSVGDPRTFPFIEPPPPASVETAILYLQEQGALDSSEALT
FT                   PIGSLLAQLPVDVVIGKMLILGSMFSLAEPVLTIAAALSVQSPFTRSAQSNLDCATARR
FT                   PLESDQG"
FT   assembly_gap    572988..574905
FT                   /estimated_length=1918
FT                   /gap_type="unknown"
FT   gene            complement(<587172..>588206)
FT                   /locus_tag="mCG_63940"
FT                   /note="gene_id=mCG63940.2"
FT   mRNA            complement(<587172..>588206)
FT                   /locus_tag="mCG_63940"
FT                   /product="mCG63940"
FT                   /note="gene_id=mCG63940.2 transcript_id=mCT64123.2 created
FT                   on 01-MAY-2002"
FT   CDS             complement(587172..588206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63940"
FT                   /product="mCG63940"
FT                   /note="gene_id=mCG63940.2 transcript_id=mCT64123.2
FT                   protein_id=mCP43125.2"
FT                   /protein_id="EDL42104.1"
FT                   /translation="MMNHTTSEYYDYEYDHEHYSDLPDVPVDCPAGTCFTSDVYLIVLL
FT                   VLYAAVFLVGVPGNTLVAWVTWKESRHRLGASWFLHLTMADLLCCVSLPFLAVPIAQKG
FT                   HWPYGAAGCWLLSSITILSMYASVLLLTGLSGDLFLLAFRPSWKGADHRTLGVRVVQAS
FT                   SWMLGLLLTVPSAVYRRLLQEHYPPRLVCGIDYGGSVSAEVAITTVRFLFGFLGPLVFM
FT                   AGCHGILQRQMARRHWPLGTAVVVGFFICWTPYHVLRVIIAAAPPHSLLLARVLEAEPL
FT                   FNGLALAHSALNPIMFLYFGRKQLCKSLQAACHWALRDPQDEESAVTKVSISTSHEMVS
FT                   EMPV"
FT   assembly_gap    590932..594401
FT                   /estimated_length=3470
FT                   /gap_type="unknown"
FT   gene            complement(<600082..>601134)
FT                   /locus_tag="mCG_2078"
FT                   /note="gene_id=mCG2078.1"
FT   mRNA            complement(<600082..>601134)
FT                   /locus_tag="mCG_2078"
FT                   /product="mCG2078"
FT                   /note="gene_id=mCG2078.1 transcript_id=mCT7854.1 created on
FT                   01-MAY-2002"
FT   CDS             complement(600082..>601134)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2078"
FT                   /product="mCG2078"
FT                   /note="gene_id=mCG2078.1 transcript_id=mCT7854.1
FT                   protein_id=mCP23780.0"
FT                   /protein_id="EDL42103.1"
FT                   /translation="DPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSV
FT                   VFLVGVPGNALVVWVTAFEARRAVNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFD
FT                   ATACIVLPSLILLNMYASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLA
FT                   LLLTIPSFVYREAYKDFYSEHTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICY
FT                   TFLLLRTWSRKATRSTKTLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKL
FT                   NSLCVSLAYINCCVNPIIYVMAGQGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTT
FT                   DTSTRKSQAV"
FT   assembly_gap    602766..604176
FT                   /estimated_length=1411
FT                   /gap_type="unknown"
FT   assembly_gap    612729..612748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    615970..616597
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    618601..618620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    619771..621211
FT                   /estimated_length=1441
FT                   /gap_type="unknown"
FT   gene            complement(626202..638926)
FT                   /gene="Ccdc9"
FT                   /locus_tag="mCG_2075"
FT                   /note="gene_id=mCG2075.1"
FT   mRNA            complement(join(626202..626579,627419..627538,
FT                   627903..628275,628367..628460,628659..628794,
FT                   628892..628938,630522..630703,632759..632932,
FT                   633019..633102,634518..634766,634913..635011,
FT                   636436..636540,636660..636711,638865..638926))
FT                   /gene="Ccdc9"
FT                   /locus_tag="mCG_2075"
FT                   /product="coiled-coil domain containing 9"
FT                   /note="gene_id=mCG2075.1 transcript_id=mCT7851.2 created on
FT                   01-MAY-2002"
FT   CDS             complement(join(626476..626579,627419..627538,
FT                   627903..628275,628367..628460,628659..628794,
FT                   628892..628938,630522..630703,632759..632932,
FT                   633019..633102,634518..634766,634913..635011,
FT                   636436..636540,636660..636662))
FT                   /codon_start=1
FT                   /gene="Ccdc9"
FT                   /locus_tag="mCG_2075"
FT                   /product="coiled-coil domain containing 9"
FT                   /note="gene_id=mCG2075.1 transcript_id=mCT7851.2
FT                   protein_id=mCP23773.2"
FT                   /protein_id="EDL42102.1"
FT                   /translation="MATTLDLKSKEEKDAELDKRIEALRRKNEALIRRYQEIEEDRKKA
FT                   ELEGVAVTAPRKSRSMEKENMAVEEKSLGPSRRTPGTPRPPGASRGGRTHPQQGGRAGV
FT                   GRASQGWEDGAGEQLRGGPGGRGRRGRGRGSPHLLGAGDNSTSDRKSKEWEERRRQNIE
FT                   KMNEEMEKIAEYERNQREGVLEPNPVRNFLDDPRRRGGPLEESERDRREGSRRHGRNWG
FT                   GSDFERVRSGLEQERQGRRAGLGSGGDMTMSMTGRERSEYLRWKQEREKIDQERLQRHR
FT                   KPTGQWRREWDAEKTDGMFKDGPAPTHELSHRYDDQAWARPPKPPTFGEFLSQHKAEVS
FT                   SRRRRKNSRPQAKVAPRAYSDHDNRWETREEAVSSAPESSQSISLEETPTQQASETPAP
FT                   AHRPPEEDGEEDVGEEEEGEEEGEDEEDEEWEDVSEDVTEEEEEEEEEFEEDEEGPKDQ
FT                   EAATVPDHQPEAEPAGKPTCEQVDPVPAGSQELLSPVPVEPPIPFSPSEDHQPVSDWGG
FT                   DQPPLASLESGPSLAGTPKSSEEEGPEASPGGMHEAGGEVGPEGQETAEITDFQRVRFC
FT                   KVVAAAPPPGAAR"
FT   assembly_gap    642111..642130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    643145..643164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    648268..651981
FT                   /estimated_length=3714
FT                   /gap_type="unknown"
FT   gene            662804..671391
FT                   /gene="Bbc3"
FT                   /locus_tag="mCG_2081"
FT                   /note="gene_id=mCG2081.2"
FT   mRNA            join(662804..663049,665314..665602,666815..667005,
FT                   670306..671391)
FT                   /gene="Bbc3"
FT                   /locus_tag="mCG_2081"
FT                   /product="Bcl-2 binding component 3"
FT                   /note="gene_id=mCG2081.2 transcript_id=mCT7857.2 created on
FT                   02-MAY-2002"
FT   CDS             join(665329..665602,666815..667005,670306..670422)
FT                   /codon_start=1
FT                   /gene="Bbc3"
FT                   /locus_tag="mCG_2081"
FT                   /product="Bcl-2 binding component 3"
FT                   /note="gene_id=mCG2081.2 transcript_id=mCT7857.2
FT                   protein_id=mCP23744.2"
FT                   /db_xref="GOA:B2RVL4"
FT                   /db_xref="MGI:MGI:2181667"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVL4"
FT                   /protein_id="EDL42101.1"
FT                   /translation="MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLP
FT                   AAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHL
FT                   ESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRH
FT                   RPSPWRVMYNLFMGLLPLPRDPGAPEMEPN"
FT   gene            complement(673678..740823)
FT                   /gene="Uble1a"
FT                   /locus_tag="mCG_2058"
FT                   /note="gene_id=mCG2058.2"
FT   mRNA            complement(join(673678..674069,683844..683913,
FT                   689936..690080,711987..712092,719770..719869,
FT                   721472..721614,723249..723422,731327..731438,
FT                   740614..740823))
FT                   /gene="Uble1a"
FT                   /locus_tag="mCG_2058"
FT                   /product="ubiquitin-like 1 (sentrin) activating enzyme E1A,
FT                   transcript variant mCT168473"
FT                   /note="gene_id=mCG2058.2 transcript_id=mCT168473.0 created
FT                   on 30-APR-2002"
FT   CDS             complement(join(674043..674069,683844..683913,
FT                   689936..690080,711987..712092,719770..719869,
FT                   721472..721614,723249..723422,731327..731438,
FT                   740614..740723))
FT                   /codon_start=1
FT                   /gene="Uble1a"
FT                   /locus_tag="mCG_2058"
FT                   /product="ubiquitin-like 1 (sentrin) activating enzyme E1A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2058.2 transcript_id=mCT168473.0
FT                   protein_id=mCP91406.0 isoform=CRA_a"
FT                   /protein_id="EDL42099.1"
FT                   /translation="MVEKEEAGGGGGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLI
FT                   VGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGAQFLIQTGSVGRNRAEASLERAQ
FT                   NLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRDVIIKVDQICHRNSIKFFTGDVF
FT                   GYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPEAKRAKLDSSETTMVKKKVLFCPVKE
FT                   ALEVDWSGEKAKAALKRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDVF
FT                   DSLGISPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKVCLGTMCV"
FT   mRNA            complement(join(680282..681157,683844..683913,
FT                   689936..690080,711987..712092,719770..719869,
FT                   721472..721614,723249..723422,731327..731438,
FT                   740614..740823))
FT                   /gene="Uble1a"
FT                   /locus_tag="mCG_2058"
FT                   /product="ubiquitin-like 1 (sentrin) activating enzyme E1A,
FT                   transcript variant mCT7834"
FT                   /note="gene_id=mCG2058.2 transcript_id=mCT7834.2 created on
FT                   30-APR-2002"
FT   CDS             complement(join(681065..681157,683844..683913,
FT                   689936..690080,711987..712092,719770..719869,
FT                   721472..721614,723249..723422,731327..731438,
FT                   740614..740723))
FT                   /codon_start=1
FT                   /gene="Uble1a"
FT                   /locus_tag="mCG_2058"
FT                   /product="ubiquitin-like 1 (sentrin) activating enzyme E1A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2058.2 transcript_id=mCT7834.2
FT                   protein_id=mCP23735.1 isoform=CRA_b"
FT                   /protein_id="EDL42100.1"
FT                   /translation="MVEKEEAGGGGGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLI
FT                   VGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGAQFLIQTGSVGRNRAEASLERAQ
FT                   NLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRDVIIKVDQICHRNSIKFFTGDVF
FT                   GYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPEAKRAKLDSSETTMVKKKVLFCPVKE
FT                   ALEVDWSGEKAKAALKRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDVF
FT                   DSLGISPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKG
FT                   SGIVECLGPQ"
FT   assembly_gap    695708..695727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            754138..755931
FT                   /locus_tag="mCG_1050071"
FT                   /note="gene_id=mCG1050071.1"
FT   mRNA            754138..755931
FT                   /locus_tag="mCG_1050071"
FT                   /product="mCG1050071"
FT                   /note="gene_id=mCG1050071.1 transcript_id=mCT167775.1
FT                   created on 30-APR-2002"
FT   CDS             754912..755202
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050071"
FT                   /product="mCG1050071"
FT                   /note="gene_id=mCG1050071.1 transcript_id=mCT167775.1
FT                   protein_id=mCP76963.1"
FT                   /protein_id="EDL42098.1"
FT                   /translation="MKVAFPALDSRGSWPPLSPGIAPSLGQNRVQSPPWEQRSPPCALA
FT                   GRELWRLLSSSAKWVPHALLWRVIMGPALRVLRMRGLGPFLPCWSRKIRGT"
FT   gene            <762395..763505
FT                   /locus_tag="mCG_1050088"
FT                   /note="gene_id=mCG1050088.1"
FT   mRNA            join(<762395..762993,763476..763505)
FT                   /locus_tag="mCG_1050088"
FT                   /product="mCG1050088"
FT                   /note="gene_id=mCG1050088.1 transcript_id=mCT167792.1
FT                   created on 30-APR-2002"
FT   CDS             <762397..762603
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050088"
FT                   /product="mCG1050088"
FT                   /note="gene_id=mCG1050088.1 transcript_id=mCT167792.1
FT                   protein_id=mCP77009.1"
FT                   /protein_id="EDL42097.1"
FT                   /translation="TPTMKMATLYLGGSSGLTLFRHVCEIVNEPQCLGCSLPNTGVHFP
FT                   GEFGIFFFWGLHRFHPKTVSHSS"
FT   gene            773164..790710
FT                   /locus_tag="mCG_2069"
FT                   /note="gene_id=mCG2069.2"
FT   mRNA            join(773164..773386,774362..774513,775195..775291,
FT                   775384..775523,776855..776965,778262..778368,
FT                   778710..778827,781991..782349,782531..782910,
FT                   787021..790710)
FT                   /locus_tag="mCG_2069"
FT                   /product="mCG2069"
FT                   /note="gene_id=mCG2069.2 transcript_id=mCT7845.2 created on
FT                   30-APR-2002"
FT   CDS             join(773224..773386,774362..774513,775195..775291,
FT                   775384..775523,776855..776965,778262..778368,
FT                   778710..778827,781991..782349,782531..782910,
FT                   787021..788510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2069"
FT                   /product="mCG2069"
FT                   /note="gene_id=mCG2069.2 transcript_id=mCT7845.2
FT                   protein_id=mCP23734.2"
FT                   /protein_id="EDL42094.1"
FT                   /translation="MDSKGYSMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRR
FT                   AKEGSSRGRGSRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGEHPEDEEDLYEEEI
FT                   EYGESEEPMGDDDYDDYSKELNQYRRSKDSRGRGLSRGRGRGSRGGRGKGMGRGRGRGG
FT                   RGGMSKGGMNDDEDFYDDDMGDGGGGSYRRSDHDKPHQQSDKKGKVICKYFVEGRCTWG
FT                   DHCNFSHDIELPKKRELCKFYITGFCARAENCPYIHERDFPCKLYHTTGNCINGDDCMF
FT                   SHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPP
FT                   GPPAPTSPNGRPMQGGPPPPPPPPPPPPGPPQMSLPTHEPLSPQQLQQDMYNKKIPSLF
FT                   EIVVRPTGQLAEKLGVRFPGPGGPSGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPD
FT                   MHPDMHPDMHPDMHPDMHPDMPMGPGMNPGPPMGPGGPPMMPYGPGDSPHSGMMPPIPP
FT                   AQNFYENFYPQQEGMEMEPGLVGDAGDTGNWYSSDEDEGGSSVTSILKTLRQQTSSRPQ
FT                   ASVGEPSSSGLGDPRLQKGHPTGSRLSDPRLSRDPRLSRHAETSGGSGPGDSGPSDPRL
FT                   ARALPTSKAEGSLHSSPAGPSSSKGQPPAEEEEGERALREKAVNIPLDPLPGHPLRDPR
FT                   SQLQQFSHIKKDVTLSKPSFARTVLWNPEDLIPLPIPKQDVPPVPAALQSLPALDPRLH
FT                   RSTPPGPPNTRQRPGSTDPSTSGSNLPDFELLSRILKTVNVNTPGQSEKPSDPRVRKTP
FT                   TDPRLQKPADPVAASRAAKPCPTEASPPAASPSGDSSPPATAPYDPRVLAAGGLGQGSS
FT                   SGQSSVLSGISLYDPRTPNAGGKTAEPASDTSAQPKGPEGNGKGSASKAKEPPFVRKSA
FT                   LEQPETGKASTDGATATDRYNSYNRPRPKATAAPTAASSTPPPEGATPQPGVHNLPVPT
FT                   LFGTVKPAPKTGTGSPFAGNSPAREGEQDAGSLKDVFKGFDPTASPFCQ"
FT   gene            complement(788549..790709)
FT                   /locus_tag="mCG_140199"
FT                   /note="gene_id=mCG140199.0"
FT   mRNA            complement(join(788549..788849,788865..790709))
FT                   /locus_tag="mCG_140199"
FT                   /product="mCG140199, transcript variant mCT168468"
FT                   /note="gene_id=mCG140199.0 transcript_id=mCT168468.0
FT                   created on 30-APR-2002"
FT   mRNA            complement(join(788549..788849,788865..789044,
FT                   789899..790706))
FT                   /locus_tag="mCG_140199"
FT                   /product="mCG140199, transcript variant mCT168467"
FT                   /note="gene_id=mCG140199.0 transcript_id=mCT168467.0
FT                   created on 30-APR-2002"
FT   CDS             complement(789264..789578)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140199"
FT                   /product="mCG140199, isoform CRA_a"
FT                   /note="gene_id=mCG140199.0 transcript_id=mCT168468.0
FT                   protein_id=mCP91416.0 isoform=CRA_a"
FT                   /protein_id="EDL42095.1"
FT                   /translation="MWDMAGNSGPPHLKGLGPFPRKGPTHQLDTCYFLRSHLGKDLLIQ
FT                   HNRSLMPSFCQLGRKKQTLSGTLQITWLRGVEAASRHTVPGPLLASLLGGLAGGHTTDP
FT                   "
FT   CDS             complement(790046..790240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140199"
FT                   /product="mCG140199, isoform CRA_b"
FT                   /note="gene_id=mCG140199.0 transcript_id=mCT168467.0
FT                   protein_id=mCP91415.0 isoform=CRA_b"
FT                   /protein_id="EDL42096.1"
FT                   /translation="MTGAHYQAWLLQKGGFQRGVGTQTLPHCTHPTYPMLTRAPALASG
FT                   PRGQGWGPKTNLIDDCLRK"
FT   gene            805798..808513
FT                   /gene="Tmem160"
FT                   /locus_tag="mCG_2087"
FT                   /note="gene_id=mCG2087.1"
FT   mRNA            join(805798..806186,807137..807229,808177..808513)
FT                   /gene="Tmem160"
FT                   /locus_tag="mCG_2087"
FT                   /product="transmembrane protein 160"
FT                   /note="gene_id=mCG2087.1 transcript_id=mCT7862.1 created on
FT                   30-APR-2002"
FT   CDS             join(805979..806186,807137..807229,808177..808442)
FT                   /codon_start=1
FT                   /gene="Tmem160"
FT                   /locus_tag="mCG_2087"
FT                   /product="transmembrane protein 160"
FT                   /note="gene_id=mCG2087.1 transcript_id=mCT7862.1
FT                   protein_id=mCP23747.2"
FT                   /protein_id="EDL42093.1"
FT                   /translation="MGGGWWWARVARLARLRFRGSLQPPQRPRSGGARGSFAPGHGPRA
FT                   GASPPPVSELDRADAWLLRKAHETAFLSWFRNGLLSSGIGVISFMQSDMGREAAYGFFL
FT                   LGGLCVVWGGASYAVGLAALRGPMQLSLAGAAAGVGAVLAASLLWACAVGLYMGQLELD
FT                   VELVPEDDGAASTEGPDEAGRPPPE"
FT   gene            complement(808734..828703)
FT                   /gene="Npas1"
FT                   /locus_tag="mCG_123654"
FT                   /note="gene_id=mCG123654.0"
FT   mRNA            complement(join(808734..809320,812197..812291,
FT                   813817..813964,814341..814447,814792..814949,
FT                   815161..815276,816259..816427,818118..818207,
FT                   818372..818445,827608..827843,828522..828703))
FT                   /gene="Npas1"
FT                   /locus_tag="mCG_123654"
FT                   /product="neuronal PAS domain protein 1"
FT                   /note="gene_id=mCG123654.0 transcript_id=mCT124888.0
FT                   created on 30-APR-2002"
FT   CDS             complement(join(808851..809320,812197..812291,
FT                   813817..813964,814341..814447,814792..814949,
FT                   815161..815276,816259..816427,818118..818207,
FT                   818372..818445,827608..827843,828522..828643))
FT                   /codon_start=1
FT                   /gene="Npas1"
FT                   /locus_tag="mCG_123654"
FT                   /product="neuronal PAS domain protein 1"
FT                   /note="gene_id=mCG123654.0 transcript_id=mCT124888.0
FT                   protein_id=mCP76967.1"
FT                   /db_xref="GOA:A2RSH6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="MGI:MGI:109205"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSH6"
FT                   /protein_id="EDL42091.1"
FT                   /translation="MATPYPRSGGRGEVKCGGGRGAGVPWDFLPGLMVKAPPGPCLQAQ
FT                   RKEKSRNAARWRRGKENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALG
FT                   APPWGLRAVGPPAGLAPGRRGPVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYIS
FT                   ETVSIYLGLSQVELTGSSVFDYIHPGDHSEVLEQLGLRAASIGPPTPPSVSSSSSSSSS
FT                   SLVDTPEIEASPTEASPAFRAQERSFFVRMKSTLTKRGLNVKASGYKVIHVTGRLRARA
FT                   LGLVALGHTLPPAPLAELPLHGHMIVFRLSLGLTILACESRVSDHMDMGPSELVGRSCY
FT                   QFVHGQDATRIRQSHLDLLDKGQVVTGYYRWLQRAGGFVWLQSVATVAGNGKSTGEHHV
FT                   LWVSHVLSNAEGSQTPLDAFQLPAIVSQEEPSRPGPEPTEEEPPVDGKQAVPADQDKDK
FT                   DPQARGKRIKVEASPKEARGSEDSGEEELSDPPAPPRPEFTSVIRAGALKHDPVLPWGL
FT                   TTPGDPSPALLHAGFLPPVVRGLCTPGTIRYGPAELSLMYPHLHRLGAGPSLPEAFYPT
FT                   LGLPYPGPTGTRVQRKGD"
FT   gene            825443..827524
FT                   /locus_tag="mCG_140203"
FT                   /note="gene_id=mCG140203.0"
FT   mRNA            join(825443..825598,827017..827524)
FT                   /locus_tag="mCG_140203"
FT                   /product="mCG140203"
FT                   /note="gene_id=mCG140203.0 transcript_id=mCT168482.0
FT                   created on 30-APR-2002"
FT   CDS             join(825478..825598,827017..827069)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140203"
FT                   /product="mCG140203"
FT                   /note="gene_id=mCG140203.0 transcript_id=mCT168482.0
FT                   protein_id=mCP91411.0"
FT                   /protein_id="EDL42092.1"
FT                   /translation="MLFSLPPPPLWVPGQEGNRNPLQPHPKDPILPECVCVGGGGTVQL
FT                   ETSVATLVHLAS"
FT   gene            <833756..834285
FT                   /locus_tag="mCG_1050069"
FT                   /note="gene_id=mCG1050069.1"
FT   mRNA            <833756..834285
FT                   /locus_tag="mCG_1050069"
FT                   /product="mCG1050069"
FT                   /note="gene_id=mCG1050069.1 transcript_id=mCT167773.1
FT                   created on 17-SEP-2002"
FT   CDS             <833757..833912
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050069"
FT                   /product="mCG1050069"
FT                   /note="gene_id=mCG1050069.1 transcript_id=mCT167773.1
FT                   protein_id=mCP76943.1"
FT                   /protein_id="EDL42090.1"
FT                   /translation="LKWIFMGAMVAVARVPPAASWPSCLRDMRLCGPFPQTQLRTSHRF
FT                   MRNSPR"
FT   assembly_gap    838816..838835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    846792..847915
FT                   /estimated_length=1124
FT                   /gap_type="unknown"
FT   gene            complement(851580..>920446)
FT                   /gene="Grlf1"
FT                   /locus_tag="mCG_2086"
FT                   /note="gene_id=mCG2086.1"
FT   mRNA            complement(join(851580..852707,853281..853386,
FT                   866110..866241,867325..867402,904387..904531,
FT                   916766..>920446))
FT                   /gene="Grlf1"
FT                   /locus_tag="mCG_2086"
FT                   /product="glucocorticoid receptor DNA binding factor 1"
FT                   /note="gene_id=mCG2086.1 transcript_id=mCT7865.1 created on
FT                   30-APR-2002"
FT   CDS             complement(join(852350..852707,853281..853386,
FT                   866110..866241,867325..867402,904387..904531,
FT                   916766..920446))
FT                   /codon_start=1
FT                   /gene="Grlf1"
FT                   /locus_tag="mCG_2086"
FT                   /product="glucocorticoid receptor DNA binding factor 1"
FT                   /note="gene_id=mCG2086.1 transcript_id=mCT7865.1
FT                   protein_id=mCP23752.1"
FT                   /db_xref="GOA:B2RTN5"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1929494"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTN5"
FT                   /protein_id="EDL42088.1"
FT                   /translation="MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRP
FT                   SADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQT
FT                   FQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLG
FT                   IDVSRGMNRNFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKN
FT                   LQVVETSARSNVNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLV
FT                   SRIVKNHNENWPSVSRKMQASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLY
FT                   LAALPLAFEALIPNLDEVDHLSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMEN
FT                   ERIPFDLMDTVPAEQLYETHLEKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSF
FT                   IMNEDFYQWLEESVYMDIYGKHQKQIIDRAKEEFQELLLEYSELFYELELDAKPSKEKM
FT                   GVIQDVLGEEQRFKALQKLQAERDALILKHIHFVYHPTKETCPSCPACVDAKIEHLISS
FT                   RFIRPSDRNQKNSLSDLNIDRINLVILGKDGLARELANEIRALCTNDDKYVIDGKMYEL
FT                   SLRPIEGNVRLPVNSFQTPTFQPHGCLCLYNSKESLSYVVESIEKSRESTLGRRDNHLV
FT                   HLPLTLILVNKRGDTSGETLHSLIQQGQQIASKLQCVFLDPASAGIGYGRNINEKQISQ
FT                   VLKGLLDSKRNLNLVSSTASIKDLADVDLRIVMCLMCGDPFSADDVLSPVLQSQTCKSS
FT                   HCGSSNSVLLELPIGLHKKRIELSVLSYHSSFSIRKSRLVHGYIVFYSAKRKASLAMLR
FT                   AFLCEVQDIIPIQLVALTDGAIDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHK
FT                   LELFHPFFKDVVEKKNIIEATHMYDNVAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDV
FT                   EPPSYHLFREDATLPSLSKDHSKFSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPV
FT                   HFDITKDLSYLDQGHREGQRKSMSSSPWMPQDGFDPSDYAEPMDAVVKPRNEEENIYSV
FT                   PHDSTQGKIITIRNINKAQSNGSGNGSDSEMDTSSLERGRKVSAVSKPVLYRTRCTRLG
FT                   RFASYRTSFSVGSDDELGPIRKKEEDQASQGYKGDNAVIPYETDEDPRRRNILRSLRRN
FT                   TKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYR
FT                   VSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYSMQIDLVE
FT                   AHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWP
FT                   TLMRPDFSSMDALTATRSYQTIIELFIQQCPFFFYNRPISEPPGAAPGSPSAMAPTVPF
FT                   LTSTPATSQPSPPQSPPPTPQSPMQPLLSSQLQAEHTL"
FT   gene            <853429..854231
FT                   /locus_tag="mCG_2064"
FT                   /note="gene_id=mCG2064.1"
FT   mRNA            <853429..854231
FT                   /locus_tag="mCG_2064"
FT                   /product="mCG2064"
FT                   /note="gene_id=mCG2064.1 transcript_id=mCT7840.1 created on
FT                   16-MAY-2002"
FT   CDS             853429..853776
FT                   /codon_start=1
FT                   /locus_tag="mCG_2064"
FT                   /product="mCG2064"
FT                   /note="gene_id=mCG2064.1 transcript_id=mCT7840.1
FT                   protein_id=mCP23762.2"
FT                   /protein_id="EDL42089.1"
FT                   /translation="MPKGKKAKGKKVALAPAVVKKQEAKKVINPLFEKRPKHFGTGQDI
FT                   QPKRDLMCFVKWPRYIRLQRQRAILYKWLKVPPAINPFTQALDRQTATQLLKLVHKYRP
FT                   ETKQEKKQRGY"
FT   assembly_gap    887946..888313
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   gene            complement(1002704..1003107)
FT                   /pseudo
FT                   /locus_tag="mCG_123675"
FT                   /note="gene_id=mCG123675.1"
FT   mRNA            complement(1002704..1003107)
FT                   /pseudo
FT                   /locus_tag="mCG_123675"
FT                   /note="gene_id=mCG123675.1 transcript_id=mCT124909.1
FT                   created on 30-APR-2002"
FT   assembly_gap    1012945..1012964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1017025..1023446
FT                   /estimated_length=6422
FT                   /gap_type="unknown"
FT   gene            complement(1026504..1030787)
FT                   /locus_tag="mCG_123665"
FT                   /note="gene_id=mCG123665.1"
FT   mRNA            complement(join(1026504..1027377,1028344..1028703,
FT                   1030723..1030787))
FT                   /locus_tag="mCG_123665"
FT                   /product="mCG123665"
FT                   /note="gene_id=mCG123665.1 transcript_id=mCT124899.1
FT                   created on 30-APR-2002"
FT   CDS             complement(join(1027094..1027377,1028344..1028703,
FT                   1030723..1030783))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123665"
FT                   /product="mCG123665"
FT                   /note="gene_id=mCG123665.1 transcript_id=mCT124899.1
FT                   protein_id=mCP77008.1"
FT                   /db_xref="MGI:MGI:2141810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B4J1L0"
FT                   /protein_id="EDL42087.1"
FT                   /translation="MGAETMESPSLFLCKGLLLTASLLICWNWSTAALLTSKEMRFSAA
FT                   EGAKVLLSVPDQEENLLSFSWYKGKDVNENFTIAHYKKSSDSLQLGKKVSGREEIYKDG
FT                   SMMLRAITLEDTGFYTLQTFKAHGQQEVTHVHLQVYKIVTKPYLQLNHTRLKRKSASIL
FT                   TCVSPDTGVDINWFFNYKPLNATERITLSPEKRELTISPVWRADVGIYLCEVSNSFSSK
FT                   KSYPLLMALAYG"
FT   gene            complement(1048901..1049500)
FT                   /pseudo
FT                   /locus_tag="mCG_50676"
FT                   /note="gene_id=mCG50676.2"
FT   mRNA            complement(1048901..1049500)
FT                   /pseudo
FT                   /locus_tag="mCG_50676"
FT                   /note="gene_id=mCG50676.2 transcript_id=mCT50859.2 created
FT                   on 30-APR-2002"
FT   assembly_gap    1071343..1071362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1075688..>1076525)
FT                   /locus_tag="mCG_2066"
FT                   /note="gene_id=mCG2066.2"
FT   mRNA            complement(1075688..>1076525)
FT                   /locus_tag="mCG_2066"
FT                   /product="mCG2066"
FT                   /note="gene_id=mCG2066.2 transcript_id=mCT7842.2 created on
FT                   29-APR-2002"
FT   CDS             complement(1076004..1076525)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2066"
FT                   /product="mCG2066"
FT                   /note="gene_id=mCG2066.2 transcript_id=mCT7842.2
FT                   protein_id=mCP23772.0"
FT                   /protein_id="EDL42086.1"
FT                   /translation="MAVGKNKCLKKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIG
FT                   KTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMD
FT                   LTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVCQ
FT                   IRKKMMEIMT"
FT   gene            1078544..1082725
FT                   /gene="Ceacam9"
FT                   /locus_tag="mCG_2074"
FT                   /note="gene_id=mCG2074.1"
FT   mRNA            join(1078544..1078645,1080240..1080599,1081814..1082725)
FT                   /gene="Ceacam9"
FT                   /locus_tag="mCG_2074"
FT                   /product="CEA-related cell adhesion molecule 9"
FT                   /note="gene_id=mCG2074.1 transcript_id=mCT7850.1 created on
FT                   30-APR-2002"
FT   CDS             join(1078585..1078645,1080240..1080599,1081814..1082097)
FT                   /codon_start=1
FT                   /gene="Ceacam9"
FT                   /locus_tag="mCG_2074"
FT                   /product="CEA-related cell adhesion molecule 9"
FT                   /note="gene_id=mCG2074.1 transcript_id=mCT7850.1
FT                   protein_id=mCP23778.2"
FT                   /db_xref="GOA:Q78T27"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1347247"
FT                   /db_xref="UniProtKB/TrEMBL:Q78T27"
FT                   /protein_id="EDL42085.1"
FT                   /translation="MGAETMESPSLFLCKGLLLTAFLLTCWNAPAAAELTIELVPPMVA
FT                   EGGNSVLFVHEMPLNVQAFYWYKQRDSTKSYEVARYLTPTNQSSKMPQHSDRKTVFYSG
FT                   SLLIRNVTKADSGVYTLLTFNTEMESELTHVHLEVQEPVAQPTLQADSTAVTEAGSVTL
FT                   TCVSEDPGLSIRWLFNHQGLYFNDRMTLSQKNSRLTIDPAKREDAGEYQCEVSNGYSSK
FT                   MSLPLQMSVTSE"
FT   gene            1095071..1105929
FT                   /gene="Ap2s1"
FT                   /locus_tag="mCG_50001"
FT                   /note="gene_id=mCG50001.1"
FT   mRNA            join(1095071..1095172,1099853..1100002,1103895..1104008,
FT                   1105323..1105382,1105546..1105657,1105709..1105929)
FT                   /gene="Ap2s1"
FT                   /locus_tag="mCG_50001"
FT                   /product="adaptor-related protein complex 2, sigma 1
FT                   subunit, transcript variant mCT50184"
FT                   /note="gene_id=mCG50001.1 transcript_id=mCT50184.1 created
FT                   on 30-APR-2002"
FT   mRNA            join(1095071..1095172,1099853..1100002,1103895..1104008,
FT                   1105323..1105382,1105546..1105928)
FT                   /gene="Ap2s1"
FT                   /locus_tag="mCG_50001"
FT                   /product="adaptor-related protein complex 2, sigma 1
FT                   subunit, transcript variant mCT168480"
FT                   /note="gene_id=mCG50001.1 transcript_id=mCT168480.0 created
FT                   on 30-APR-2002"
FT   CDS             join(1095170..1095172,1099853..1100002,1103895..1104008,
FT                   1105323..1105382,1105546..1105647)
FT                   /codon_start=1
FT                   /gene="Ap2s1"
FT                   /locus_tag="mCG_50001"
FT                   /product="adaptor-related protein complex 2, sigma 1
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG50001.1 transcript_id=mCT168480.0
FT                   protein_id=mCP91419.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UJ76"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027156"
FT                   /db_xref="MGI:MGI:2141861"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJ76"
FT                   /protein_id="EDL42083.1"
FT                   /translation="MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAK
FT                   HTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLV
FT                   FNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE"
FT   CDS             join(1095170..1095172,1099853..1100002,1103895..1104008,
FT                   1105323..1105382,1105546..1105647)
FT                   /codon_start=1
FT                   /gene="Ap2s1"
FT                   /locus_tag="mCG_50001"
FT                   /product="adaptor-related protein complex 2, sigma 1
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG50001.1 transcript_id=mCT50184.1
FT                   protein_id=mCP43120.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UJ76"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027156"
FT                   /db_xref="MGI:MGI:2141861"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJ76"
FT                   /protein_id="EDL42084.1"
FT                   /translation="MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAK
FT                   HTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLV
FT                   FNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE"
FT   assembly_gap    1124648..1124667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1128079..1128461)
FT                   /locus_tag="mCG_1050080"
FT                   /note="gene_id=mCG1050080.1"
FT   mRNA            complement(1128079..1128461)
FT                   /locus_tag="mCG_1050080"
FT                   /product="mCG1050080"
FT                   /note="gene_id=mCG1050080.1 transcript_id=mCT167784.1
FT                   created on 30-APR-2002"
FT   CDS             complement(1128169..1128420)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050080"
FT                   /product="mCG1050080"
FT                   /note="gene_id=mCG1050080.1 transcript_id=mCT167784.1
FT                   protein_id=mCP76994.1"
FT                   /protein_id="EDL42082.1"
FT                   /translation="MKHAEPGTLQEHLEACKKQSACTHQTVCNRNTTSHIHRLGEEGQA
FT                   RHDRSEPRKDNRAPGASTRTTRTTARSVRRSALGPDSC"
FT   assembly_gap    1132482..1132584
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            complement(1137574..>1141271)
FT                   /locus_tag="mCG_140201"
FT                   /note="gene_id=mCG140201.0"
FT   mRNA            complement(join(1137574..1137614,1140781..>1141271))
FT                   /locus_tag="mCG_140201"
FT                   /product="mCG140201"
FT                   /note="gene_id=mCG140201.0 transcript_id=mCT168479.0
FT                   created on 29-APR-2002"
FT   gene            1137609..1154431
FT                   /gene="Slc1a5"
FT                   /locus_tag="mCG_2082"
FT                   /note="gene_id=mCG2082.1"
FT   mRNA            join(1137609..1138679,1141856..1141898,1142534..1142578,
FT                   1143056..1143097,1145962..1146122,1149832..1150065,
FT                   1151943..1152137,1152209..1152343,1153691..1154431)
FT                   /gene="Slc1a5"
FT                   /locus_tag="mCG_2082"
FT                   /product="solute carrier family 1 (neutral amino acid
FT                   transporter), member 5"
FT                   /note="gene_id=mCG2082.1 transcript_id=mCT7858.1 created on
FT                   30-APR-2002"
FT   CDS             join(1138105..1138679,1141856..1141898,1142534..1142578,
FT                   1143056..1143097,1145962..1146122,1149832..1150065,
FT                   1151943..1152137,1152209..1152343,1153691..1153928)
FT                   /codon_start=1
FT                   /gene="Slc1a5"
FT                   /locus_tag="mCG_2082"
FT                   /product="solute carrier family 1 (neutral amino acid
FT                   transporter), member 5"
FT                   /note="gene_id=mCG2082.1 transcript_id=mCT7858.1
FT                   protein_id=mCP23781.2"
FT                   /db_xref="GOA:Q9ESU7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="MGI:MGI:105305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ESU7"
FT                   /protein_id="EDL42080.1"
FT                   /translation="MAVDPPKADPKGVVAVDSTANGGPALGSREDQSAKAGGCCGSRDR
FT                   VRRCIRANLLVLLTVAAVVAGVGLGLGVSAAGGADALGPARLTAFAFPGELLLRLLKMI
FT                   ILPLVVCSLIGGAASLDPSALGRVGAWALLFFLVTTLLASALGVGLALALKPGAAVTAI
FT                   TSINDSVVDPCARSAPTKEVLDSFLDLVRNIFPSNLVSAAFRSFATSYEPKDNSCKIPQ
FT                   SCIQREINSTMVQLLCEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNDATM
FT                   VLVSWIMWYAPVGILFLVASKIVEMKDVRQLFISLGKYILCCLLGHAIHGLLVLPLIYF
FT                   LFTRKNPYRFLWGIMTPLATAFGTSSSSATLPLMMKCVEEKNGVAKHISRFILPIGATV
FT                   NMDGAALFQCVAAVFIAQLNGVSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILE
FT                   AVSLPVKDISLILAVDWLVDRSCTVLNVEGDAFGAGLLQSYVDRTKMPSSEPELIQVKN
FT                   EVSLNPLPLATEEGNPLLKQYQGPTGDSSATFEKESVM"
FT   CDS             complement(1140957..>1141271)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140201"
FT                   /product="mCG140201"
FT                   /note="gene_id=mCG140201.0 transcript_id=mCT168479.0
FT                   protein_id=mCP92148.0"
FT                   /protein_id="EDL42081.1"
FT                   /translation="RLALNCVSPGLPQTCGPSVPWVAGGTDSLTQAGQHTFSRMWEFQL
FT                   ASSGPRKLRFQNQGEVGVGTRLLRGRQGQGHTRPQLHPQQPFNTLGVLHQLLPGGLRTG
FT                   "
FT   gene            complement(1165408..1172869)
FT                   /gene="Fkrp"
FT                   /locus_tag="mCG_2084"
FT                   /note="gene_id=mCG2084.2"
FT   mRNA            complement(join(1165408..1165943,1166014..1166139,
FT                   1166520..1168114,1171201..1171260,1172837..1172869))
FT                   /gene="Fkrp"
FT                   /locus_tag="mCG_2084"
FT                   /product="fukutin related protein, transcript variant
FT                   mCT168478"
FT                   /note="gene_id=mCG2084.2 transcript_id=mCT168478.0 created
FT                   on 29-APR-2002"
FT   mRNA            complement(join(1165409..1168114,1171201..1171260,
FT                   1172837..1172869))
FT                   /gene="Fkrp"
FT                   /locus_tag="mCG_2084"
FT                   /product="fukutin related protein, transcript variant
FT                   mCT7861"
FT                   /note="gene_id=mCG2084.2 transcript_id=mCT7861.1 created on
FT                   29-APR-2002"
FT   CDS             complement(1166589..1168073)
FT                   /codon_start=1
FT                   /gene="Fkrp"
FT                   /locus_tag="mCG_2084"
FT                   /product="fukutin related protein, isoform CRA_a"
FT                   /note="gene_id=mCG2084.2 transcript_id=mCT168478.0
FT                   protein_id=mCP91417.0 isoform=CRA_a"
FT                   /protein_id="EDL42078.1"
FT                   /translation="MRLTRCWAALAAAIILNLLVFFYVSWLQHQPRNSRARGPRRTSAI
FT                   GPRVTVLIREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRIPNVRLALL
FT                   QPALDRPAAASRPETYVATEFVALVPDGARAESPGHLERMVEALRGSSARLVAAPVATA
FT                   NPARCLALNVSLREWTARYDPAPSAPRCDALDGDAVLLMRSRDLFNLSVPLARPLATSL
FT                   FLQTALRGWAVQLLDLTFAAARQPPLATAHARWKAEREGRSRRAALLRSLGIRLVSWEG
FT                   GRLEWFGCSKESARCFGTVAGDTPAYLYEGRWTPPCCLRALRETARYVVGVLEAAGVRY
FT                   WLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVE
FT                   GDFFRVQYSENNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFM
FT                   AQAPNNYRRFLELKFGPGVIENPEYPNPALLSLTGG"
FT   CDS             complement(1166589..1168073)
FT                   /codon_start=1
FT                   /gene="Fkrp"
FT                   /locus_tag="mCG_2084"
FT                   /product="fukutin related protein, isoform CRA_a"
FT                   /note="gene_id=mCG2084.2 transcript_id=mCT7861.1
FT                   protein_id=mCP23742.1 isoform=CRA_a"
FT                   /protein_id="EDL42079.1"
FT                   /translation="MRLTRCWAALAAAIILNLLVFFYVSWLQHQPRNSRARGPRRTSAI
FT                   GPRVTVLIREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRIPNVRLALL
FT                   QPALDRPAAASRPETYVATEFVALVPDGARAESPGHLERMVEALRGSSARLVAAPVATA
FT                   NPARCLALNVSLREWTARYDPAPSAPRCDALDGDAVLLMRSRDLFNLSVPLARPLATSL
FT                   FLQTALRGWAVQLLDLTFAAARQPPLATAHARWKAEREGRSRRAALLRSLGIRLVSWEG
FT                   GRLEWFGCSKESARCFGTVAGDTPAYLYEGRWTPPCCLRALRETARYVVGVLEAAGVRY
FT                   WLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVE
FT                   GDFFRVQYSENNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFM
FT                   AQAPNNYRRFLELKFGPGVIENPEYPNPALLSLTGG"
FT   gene            <1172493..1197059
FT                   /gene="Strn4"
FT                   /locus_tag="mCG_2083"
FT                   /note="gene_id=mCG2083.1"
FT   mRNA            join(<1172493..1172771,1178633..1178736,1179143..1179216,
FT                   1180275..1180353,1182600..1182797,1184811..1184952,
FT                   1186462..1186621,1187161..1187274,1187601..1187716,
FT                   1189062..1189237,1189314..1189361,1190011..1190132,
FT                   1193686..1193856,1193973..1194113,1194394..1194492,
FT                   1194687..1194773,1195865..1196096,1196330..1197059)
FT                   /gene="Strn4"
FT                   /locus_tag="mCG_2083"
FT                   /product="striatin, calmodulin binding protein 4"
FT                   /note="gene_id=mCG2083.1 transcript_id=mCT7860.1 created on
FT                   30-APR-2002"
FT   CDS             join(1172493..1172771,1178633..1178736,1179143..1179216,
FT                   1180275..1180353,1182600..1182797,1184811..1184952,
FT                   1186462..1186621,1187161..1187274,1187601..1187716,
FT                   1189062..1189237,1189314..1189361,1190011..1190132,
FT                   1193686..1193856,1193973..1194113,1194394..1194492,
FT                   1194687..1194773,1195865..1196034)
FT                   /codon_start=1
FT                   /gene="Strn4"
FT                   /locus_tag="mCG_2083"
FT                   /product="striatin, calmodulin binding protein 4"
FT                   /note="gene_id=mCG2083.1 transcript_id=mCT7860.1
FT                   protein_id=mCP23743.1"
FT                   /protein_id="EDL42077.1"
FT                   /translation="MEERAAAAVASAASSCRPLGSGTAPNPTAAAPASSPAPGPGPVGK
FT                   GGGGGGSPGPTAGPEPLSLPGILHFIQHEWARFEAEKARWEAERAELQAQVAFLQGERK
FT                   GQENLKTDLVRRIKMLEYALKQERAKYHKLKFGTDLNQGEKKTDLSEQVSNGPVESVTL
FT                   ENSPLVWKEGRQLLRQYLEEVGYTDTILDMRSKRVRSLLGRSLELNGAGEPVEGAPRAS
FT                   PGPGGLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLEQIPFLQNCEDEDSDEDDEL
FT                   DSVQHKKQRVRLPSKALVPEMEDEDEEDDSEDAINEFDFLGSGEDGEGSPDPRRCTSEG
FT                   NPHELESRRVKLQGILADLRDVDGLPPKVTVPPPGTPQPRPHEGSFGFSSDVFIMDTIG
FT                   GGEVSLGDLADLTVTNDNDLSCDLSDSKDAFKKTWNPKFTLRSHYDGIRSLAFHHSQSA
FT                   LLTASEDGTLKLWNLQKAVTAKKNAALDVEPIHAFRAHRGPVLAVTMGSNSEYCYSGGA
FT                   DARIHSWKIPDLNMDPYDGYDPSVLSHVLEGHGDAVWGLAFSPTSQRLASCSADGTVRI
FT                   WDPSSSGPSCLCTFPMDGEHGIPTSVAFTSTEPAHVVASFRSGDTVLYDLEAGSALLTL
FT                   ESRGSSGPAQINQVVSHPSQPLTITAHDDRGIRFLDNRTGKSVHSMVAHLDAVTCLAVD
FT                   PNGVFLMSGSHDCSLRLWSLDNKTCVQEITAHRKKHEEAIHAVACHPSKALIASAGADA
FT                   LAKVFV"
FT   gene            1199102..1235007
FT                   /gene="Prkd2"
FT                   /locus_tag="mCG_16552"
FT                   /note="gene_id=mCG16552.1"
FT   mRNA            join(1199102..1199155,1199604..1199985,1201941..1202079,
FT                   1203723..1203854,1204848..1205002,1205104..1205329,
FT                   1206148..1206225,1206317..1206470,1209369..1209486,
FT                   1210065..1210142,1211809..1212067,1212374..1212426,
FT                   1212940..1213012,1214119..1214225,1214751..1214912,
FT                   1220472..1220520,1221373..1221479,1222001..1222162,
FT                   1223411..1223509,1230230..1230497,1234031..1234116,
FT                   1234366..1235007)
FT                   /gene="Prkd2"
FT                   /locus_tag="mCG_16552"
FT                   /product="protein kinase D2, transcript variant mCT18316"
FT                   /note="gene_id=mCG16552.1 transcript_id=mCT18316.2 created
FT                   on 30-APR-2002"
FT   mRNA            join(<1199186..1199985,1201941..1202079,1203723..1203854,
FT                   1204848..1205002,1205104..1205329,1206148..1206225,
FT                   1206317..1206470,1209369..1209486,1210065..1210142,
FT                   1211809..1212067,1212374..1212426,1212940..1213012,
FT                   1214119..1214225,1222001..1222162,1223411..1223509,
FT                   1230230..1230497,1234031..1234116,1234366..1235004)
FT                   /gene="Prkd2"
FT                   /locus_tag="mCG_16552"
FT                   /product="protein kinase D2, transcript variant mCT194144"
FT                   /note="gene_id=mCG16552.1 transcript_id=mCT194144.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1199635..1199985,1201941..1202079,1203723..1203854,
FT                   1204848..1205002,1205104..1205329,1206148..1206225,
FT                   1206317..1206470,1209369..1209486,1210065..1210142,
FT                   1211809..1212067,1212374..1212426,1212940..1213012,
FT                   1214119..1214225,1222001..1222162,1223411..1223509,
FT                   1230230..1230497,1234031..1234116,1234366..1234566)
FT                   /codon_start=1
FT                   /gene="Prkd2"
FT                   /locus_tag="mCG_16552"
FT                   /product="protein kinase D2, isoform CRA_a"
FT                   /note="gene_id=mCG16552.1 transcript_id=mCT194144.0
FT                   protein_id=mCP115114.0 isoform=CRA_a"
FT                   /protein_id="EDL42075.1"
FT                   /translation="QISLSNACVLTTTARELSDLGPRVLGELWAADLDLAPMAAAPSHP
FT                   AGLPGSPGPGSPPPPGGLDLQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELA
FT                   HVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAADIQEGDLVEVVLS
FT                   ASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIP
FT                   NNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEELSRSTTDLLPRRPPSSSSSSSSS
FT                   SFYTGRPIELDKMLMSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNC
FT                   HKRCATRVPNDCLGEALINGDVPMEEAADYSEADKSSISDELEDSGVIPGSHSESALHA
FT                   SEEEEGEGHKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
FT                   LDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIITANVTYFVG
FT                   ETPGGAPGGPSGQGTEAVRGWETAIRQALMPVILQDAPSAPGHTPHRQASLSISVSNSQ
FT                   IQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRN
FT                   EVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLIT
FT                   QILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTP
FT                   AYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWS
FT                   HISSGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESD
FT                   DARWDQFVAERHGTPAEGDLGGACLPQDHEMQGLAERISIL"
FT   CDS             join(1199746..1199985,1201941..1202079,1203723..1203854,
FT                   1204848..1205002,1205104..1205329,1206148..1206225,
FT                   1206317..1206470,1209369..1209486,1210065..1210142,
FT                   1211809..1212067,1212374..1212426,1212940..1213012,
FT                   1214119..1214225,1214751..1214912,1220472..1220520,
FT                   1221373..1221479,1222001..1222162,1223411..1223509,
FT                   1230230..1230497,1234031..1234116,1234366..1234566)
FT                   /codon_start=1
FT                   /gene="Prkd2"
FT                   /locus_tag="mCG_16552"
FT                   /product="protein kinase D2, isoform CRA_b"
FT                   /note="gene_id=mCG16552.1 transcript_id=mCT18316.2
FT                   protein_id=mCP23758.2 isoform=CRA_b"
FT                   /protein_id="EDL42076.1"
FT                   /translation="MAAAPSHPAGLPGSPGPGSPPPPGGLDLQSPPPLLPQIPAPGSGV
FT                   SFHIQIGLTREFVLLPAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSAN
FT                   LLQLVRSAADIQEGDLVEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLV
FT                   RQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEEL
FT                   SRSTTDLLPRRPPSSSSSSSSSSFYTGRPIELDKMLMSKVKVPHTFLIHSYTRPTVCQA
FT                   CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEAADYSEADKSS
FT                   ISDELEDSGVIPGSHSESALHASEEEEGEGHKAQSSLGYIPLMRVVQSVRHTTRKSSTT
FT                   LREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSL
FT                   VPPGTNPHCFEIITANVTYFVGETPGGAPGGPSGQGTEAVRGWETAIRQALMPVILQDA
FT                   PSAPGHTPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGR
FT                   DVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDM
FT                   LEMILSSEKGRLPERLTKFLITQFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRF
FT                   PTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRL
FT                   PERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEK
FT                   SFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNA
FT                   AFMYPASPWSHISSGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKM
FT                   GERYITHESDDARWDQFVAERHGTPAEGDLGGACLPQDHEMQGLAERISIL"
FT   assembly_gap    1207468..1208607
FT                   /estimated_length=1140
FT                   /gap_type="unknown"
FT   assembly_gap    1213572..1213661
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    1215137..1218974
FT                   /estimated_length=3838
FT                   /gap_type="unknown"
FT   assembly_gap    1220452..1220471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1222204..1222223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1225081..1225100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1229777..1229796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1235905..1239438)
FT                   /locus_tag="mCG_148496"
FT                   /note="gene_id=mCG148496.0"
FT   mRNA            complement(join(1235905..1237464,1238763..1239438))
FT                   /locus_tag="mCG_148496"
FT                   /product="mCG148496"
FT                   /note="gene_id=mCG148496.0 transcript_id=mCT188759.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1236868..1237140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148496"
FT                   /product="mCG148496"
FT                   /note="gene_id=mCG148496.0 transcript_id=mCT188759.0
FT                   protein_id=mCP109515.0"
FT                   /protein_id="EDL42074.1"
FT                   /translation="MSELKSPGLHATGQMQWFHDCLFSAGEWTQEELDVQPVSELEGHQ
FT                   ETLFQKRSGQIGRQDGFQWEGDHAADAKDLSSVPGAHVHMADRDN"
FT   gene            <1240141..1252015
FT                   /locus_tag="mCG_16551"
FT                   /note="gene_id=mCG16551.2"
FT   mRNA            join(<1240141..1240224,1247676..1247772,1247889..1248068,
FT                   1249630..1252015)
FT                   /locus_tag="mCG_16551"
FT                   /product="mCG16551"
FT                   /note="gene_id=mCG16551.2 transcript_id=mCT18315.2 created
FT                   on 30-APR-2002"
FT   CDS             join(<1240141..1240224,1247676..1247772,1247889..1248068,
FT                   1249630..1250966)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16551"
FT                   /product="mCG16551"
FT                   /note="gene_id=mCG16551.2 transcript_id=mCT18315.2
FT                   protein_id=mCP23775.2"
FT                   /protein_id="EDL42073.1"
FT                   /translation="EAEDEEDAEEDEDAAAARRAAAALEEQLEALPGLIWDLGQQLGDL
FT                   SLESGGLDQESGRSSASSWNPGFYEDPSSTGGPDSPPSTFCGDSGFSGSGSYGRLGPSD
FT                   PRGIYASERPKSLGMAGDASPSAPESVGARVAVPRSFSAPYPTAAAGAETCSSAERRAR
FT                   AGPFLTPSPLHAVALRSPRPSGRVPCGSPDGAASRPLDGYISALLRRRRRRGAGQPRTS
FT                   PGGADGGARRQNGARPRPPEASPPPGGARPAREPSTERAWAAAWEAGGSTRTLLPPAAA
FT                   SPPSSPAEGRLVKAQYIPGAPAASRGLPGRAARRRAPPLTRGRSVEQSPPRERPRAAGR
FT                   RGRLAEPSGRRGSPRARKAARSQSETSLLGRAHAAPPPKYPTAERDEPRPPRPRRGPAP
FT                   TPTVQACRRWRSTAEIDAPDGRRPRARVPAPRGPAPSPSAPPRRLLYGCAGSDSECSAV
FT                   GRPVPLGRRMPSGCAPGGYGESESSASEGESPAFSSASSDSDGSGGLVWPQQLVAAAGA
FT                   SPSGPGGAAGGGTPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV"
FT   gene            1259481..1259979
FT                   /gene="Gng8"
FT                   /locus_tag="mCG_16549"
FT                   /note="gene_id=mCG16549.1"
FT   mRNA            join(1259481..1259579,1259787..1259979)
FT                   /gene="Gng8"
FT                   /locus_tag="mCG_16549"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 8 subunit"
FT                   /note="gene_id=mCG16549.1 transcript_id=mCT18313.1 created
FT                   on 30-APR-2002"
FT   CDS             join(1259496..1259579,1259787..1259915)
FT                   /codon_start=1
FT                   /gene="Gng8"
FT                   /locus_tag="mCG_16549"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma 8 subunit"
FT                   /note="gene_id=mCG16549.1 transcript_id=mCT18313.1
FT                   protein_id=mCP23771.2"
FT                   /db_xref="GOA:Q3UMY0"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:109163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UMY0"
FT                   /protein_id="EDL42072.1"
FT                   /translation="MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAK
FT                   DDPLVTPVPAAENPFRDKRLFCTLL"
FT   gene            1271041..1275450
FT                   /gene="Ptgir"
FT                   /locus_tag="mCG_16538"
FT                   /note="gene_id=mCG16538.2"
FT   mRNA            join(1271041..1271462,1272072..1272188,1273271..1275418)
FT                   /gene="Ptgir"
FT                   /locus_tag="mCG_16538"
FT                   /product="prostaglandin I receptor (IP), transcript variant
FT                   mCT168470"
FT                   /note="gene_id=mCG16538.2 transcript_id=mCT168470.0 created
FT                   on 30-APR-2002"
FT   mRNA            join(1271042..1272188,1273271..1275450)
FT                   /gene="Ptgir"
FT                   /locus_tag="mCG_16538"
FT                   /product="prostaglandin I receptor (IP), transcript variant
FT                   mCT18177"
FT                   /note="gene_id=mCG16538.2 transcript_id=mCT18177.1 created
FT                   on 30-APR-2002"
FT   CDS             join(1271331..1272188,1273271..1273666)
FT                   /codon_start=1
FT                   /gene="Ptgir"
FT                   /locus_tag="mCG_16538"
FT                   /product="prostaglandin I receptor (IP), isoform CRA_a"
FT                   /note="gene_id=mCG16538.2 transcript_id=mCT18177.1
FT                   protein_id=mCP23759.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U4F1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000370"
FT                   /db_xref="InterPro:IPR008365"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99535"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4F1"
FT                   /protein_id="EDL42070.1"
FT                   /translation="MKMMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSV
FT                   GPATSTLMFVAGVVGNGLALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVA
FT                   YARNSSLLGLAHGGTMLCDTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGP
FT                   RCARFALPSIYAFCCLFCSLPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLM
FT                   ALLVTSIFFCNGSVTLSLYHMYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVC
FT                   SLPLMIRGFTQAIAPDSREMGDLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLC
FT                   ARSVHGDLQAPLSRPASGRRDPPAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDG
FT                   CSVGMPSKSEAIAACSLC"
FT   CDS             join(1271331..1271462,1272072..1272188,1273271..1273666)
FT                   /codon_start=1
FT                   /gene="Ptgir"
FT                   /locus_tag="mCG_16538"
FT                   /product="prostaglandin I receptor (IP), isoform CRA_b"
FT                   /note="gene_id=mCG16538.2 transcript_id=mCT168470.0
FT                   protein_id=mCP91407.0 isoform=CRA_b"
FT                   /protein_id="EDL42071.1"
FT                   /translation="MKMMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSR
FT                   RHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMGDLLAF
FT                   RFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDPPAPT
FT                   SLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAACSLC"
FT   gene            complement(1279943..1288570)
FT                   /gene="Calm3"
FT                   /locus_tag="mCG_16540"
FT                   /note="gene_id=mCG16540.4"
FT   mRNA            complement(join(1279943..1281540,1281639..1281774,
FT                   1281950..1282056,1282149..1282292,1284199..1284229,
FT                   1288406..1288570))
FT                   /gene="Calm3"
FT                   /locus_tag="mCG_16540"
FT                   /product="calmodulin 3"
FT                   /note="gene_id=mCG16540.4 transcript_id=mCT18179.3 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(1281512..1281540,1281639..1281774,
FT                   1281950..1282056,1282149..1282292,1284199..1284229,
FT                   1288406..1288408))
FT                   /codon_start=1
FT                   /gene="Calm3"
FT                   /locus_tag="mCG_16540"
FT                   /product="calmodulin 3"
FT                   /note="gene_id=mCG16540.4 transcript_id=mCT18179.3
FT                   protein_id=mCP23745.3"
FT                   /protein_id="EDL42069.1"
FT                   /translation="MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT
FT                   EAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAA
FT                   ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK"
FT   gene            1309261..1311848
FT                   /locus_tag="mCG_16539"
FT                   /note="gene_id=mCG16539.2"
FT   mRNA            1309261..1311848
FT                   /locus_tag="mCG_16539"
FT                   /product="mCG16539"
FT                   /note="gene_id=mCG16539.2 transcript_id=mCT18178.2 created
FT                   on 30-APR-2002"
FT   CDS             1309635..1311620
FT                   /codon_start=1
FT                   /locus_tag="mCG_16539"
FT                   /product="mCG16539"
FT                   /note="gene_id=mCG16539.2 transcript_id=mCT18178.2
FT                   protein_id=mCP23760.2"
FT                   /db_xref="GOA:G3X9N3"
FT                   /db_xref="InterPro:IPR026523"
FT                   /db_xref="MGI:MGI:3645856"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9N3"
FT                   /protein_id="EDL42068.1"
FT                   /translation="MTMNLLQDWCKELEVEVHRALLITGIPERLQQADIEATLSPNLQP
FT                   LGNYRLRTVRAVTKEKSQAALVEFGADFDHSAIPIHIRGENGIWKILSKDRGQDARVLR
FT                   QMRRLLLDERPMDDFREIAIPLVLEAQAQAKGLGKEAKKAGSSEGAARSGRRGRRGGKR
FT                   RSRSHKLTAQKGQKRSRGGRRARSESEDSSDDSLGIVIEEIYAEDLSVDEDQRALYATL
FT                   QAAAKELTKKWAFRGDQEEGDGPREFLALVTVTDKAKKEEIEKDLPGTESICLNIKDEK
FT                   SGVPDLVALLAVRDTPAVEVETEVDDDDEDDEDEDDEDDDEDEDDDEDDSDSESLENGE
FT                   HGKEVMDSPEFVAIVAYTDPADPSAREEMLKIASVIETLGWGDKKDKKDVLPQVLSVMA
FT                   KDTSGPRVKVEEAGRQVDAMVLRKAEEDGNLLECISTLAEAENCPKGKKSGLGLLRGWT
FT                   AEGHQGGLLELVALLAAQDMVEAVREEEASRWGSGGSGGRKCDHSQGGLSEVLAFLASQ
FT                   ENLESNEESDEDSDTESEGDSEDTDSEESEPGDSVSKKPRAKRARTGSKGLPPAGATAV
FT                   STASRARKARRGGRGRGRAVTPEKKTGSGVSTEDHAGNNNKKKKGSAGAGARARAGEAK
FT                   GQPAAVPKSTRGKKARRGPRRAPKCR"
FT   gene            <1312935..1313361
FT                   /locus_tag="mCG_140198"
FT                   /note="gene_id=mCG140198.0"
FT   mRNA            <1312935..1313361
FT                   /locus_tag="mCG_140198"
FT                   /product="mCG140198"
FT                   /note="gene_id=mCG140198.0 transcript_id=mCT168466.0
FT                   created on 29-APR-2002"
FT   CDS             <1312935..1313240
FT                   /codon_start=1
FT                   /locus_tag="mCG_140198"
FT                   /product="mCG140198"
FT                   /note="gene_id=mCG140198.0 transcript_id=mCT168466.0
FT                   protein_id=mCP91414.0"
FT                   /protein_id="EDL42067.1"
FT                   /translation="LFPRVRMCACVCVCSTFYPQEVTGSWYLDPLGWNRSSDQPHTQTV
FT                   QLLSGDIQKLQGVSVPLCTQRQPLSLIPRTSGNEGTDGEAGQRGLWAGEETPLHVD"
FT   gene            <1316558..>1316877
FT                   /locus_tag="mCG_140197"
FT                   /note="gene_id=mCG140197.0"
FT   mRNA            <1316558..>1316877
FT                   /locus_tag="mCG_140197"
FT                   /product="mCG140197"
FT                   /note="gene_id=mCG140197.0 transcript_id=mCT168465.0
FT                   created on 29-APR-2002"
FT   CDS             <1316558..>1316877
FT                   /codon_start=1
FT                   /locus_tag="mCG_140197"
FT                   /product="mCG140197"
FT                   /note="gene_id=mCG140197.0 transcript_id=mCT168465.0
FT                   protein_id=mCP91412.0"
FT                   /protein_id="EDL42066.1"
FT                   /translation="LCSSLWPQTHRDPPASVLGLMACSTRLAMSSRSYANTGLYGALKE
FT                   LPVGGRLYPALAPCSGKEYVPPKARRRNWGTQEVSAVLWRQLSFCVFCVIFIFATVRGD
FT                   RAG"
FT   gene            1324269..1326912
FT                   /gene="0710005I19Rik"
FT                   /locus_tag="mCG_68157"
FT                   /note="gene_id=mCG68157.2"
FT   mRNA            join(1324269..1324403,1324721..1326009,1326532..1326912)
FT                   /gene="0710005I19Rik"
FT                   /locus_tag="mCG_68157"
FT                   /product="RIKEN cDNA 0710005I19"
FT                   /note="gene_id=mCG68157.2 transcript_id=mCT68343.2 created
FT                   on 30-APR-2002"
FT   CDS             join(1324734..1326009,1326532..1326548)
FT                   /codon_start=1
FT                   /gene="0710005I19Rik"
FT                   /locus_tag="mCG_68157"
FT                   /product="RIKEN cDNA 0710005I19"
FT                   /note="gene_id=mCG68157.2 transcript_id=mCT68343.2
FT                   protein_id=mCP43364.2"
FT                   /protein_id="EDL42065.1"
FT                   /translation="MSEPVAMTLLEDWCRGMGMDIHRSLLVTGIPEYCSHAEIEETLNG
FT                   VLLPLGTYRVLNKIFLRQENVKAALVEVSEGVNLSSIPREFPGRGGVWRVVCRDPTQDD
FT                   DFLKNLNEFLDGEGRTWEDMVRLLKLNPNPPLPNSNQPPPNWAEALGLLLGAVVQVIFY
FT                   MDAAIRSRDEEARAEEAAEAELMEAWASTARKRVKKEPGLGVEVGSAFKMEDRNYWKNT
FT                   EDHGDPPKPLVRRPGGKIRSRRRKQKKNLKQEPICWRKSQGSNYNSNYNKVNLEAGEAA
FT                   QSSEIPESVKSNKKPFVKQEETVWKKKRVWRDPSDLPRSALPAADSPGNLEDSDQDGGP
FT                   ENPAKKKAMTWASNKIPVPTRKKKKMVSLGTLSYVLLDAEATKNKTAILKKGLGARRAV
FT                   SVPHDAPASTSRPQKTKLGAFPRVSKDSRKL"
FT   gene            1328092..1329083
FT                   /locus_tag="mCG_140200"
FT                   /note="gene_id=mCG140200.0"
FT   mRNA            1328092..1329083
FT                   /locus_tag="mCG_140200"
FT                   /product="mCG140200"
FT                   /note="gene_id=mCG140200.0 transcript_id=mCT168472.0
FT                   created on 29-APR-2002"
FT   CDS             1328425..1328742
FT                   /codon_start=1
FT                   /locus_tag="mCG_140200"
FT                   /product="mCG140200"
FT                   /note="gene_id=mCG140200.0 transcript_id=mCT168472.0
FT                   protein_id=mCP91405.0"
FT                   /protein_id="EDL42064.1"
FT                   /translation="MHMCMCVYVEAEDYLGCHSSATSHLFMRQGSLTGLKLASMLGWTG
FT                   TAGLSCLCLPSSRATSRRYHVLFLFAQVLGIKLNSSFVQHAFPTGLSPPPPNEVSCKCE
FT                   L"
FT   assembly_gap    1329451..1330131
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   gene            complement(<1351907..1352390)
FT                   /locus_tag="mCG_1050076"
FT                   /note="gene_id=mCG1050076.1"
FT   mRNA            complement(<1351907..1352390)
FT                   /locus_tag="mCG_1050076"
FT                   /product="mCG1050076"
FT                   /note="gene_id=mCG1050076.1 transcript_id=mCT167780.1
FT                   created on 29-APR-2002"
FT   CDS             complement(<1351907..1352239)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050076"
FT                   /product="mCG1050076"
FT                   /note="gene_id=mCG1050076.1 transcript_id=mCT167780.1
FT                   protein_id=mCP76986.1"
FT                   /protein_id="EDL42063.1"
FT                   /translation="MQVSTSDCSCHTTACSTMSGNVTWFQQSPEGMISWILDLWTAFNN
FT                   DPCCLSRIQWPQEKYLNTHARLRLQNDGKKCHTVLYYAAHCALMLNRVHGAEVLQAVQR
FT                   LHKSRLM"
FT   assembly_gap    1356023..1356042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1359860..1362173
FT                   /locus_tag="mCG_1050067"
FT                   /note="gene_id=mCG1050067.1"
FT   mRNA            1359860..1362173
FT                   /locus_tag="mCG_1050067"
FT                   /product="mCG1050067, transcript variant mCT168464"
FT                   /note="gene_id=mCG1050067.1 transcript_id=mCT168464.0
FT                   created on 30-APR-2002"
FT   mRNA            join(1359860..1361157,1361578..1362173)
FT                   /locus_tag="mCG_1050067"
FT                   /product="mCG1050067, transcript variant mCT167771"
FT                   /note="gene_id=mCG1050067.1 transcript_id=mCT167771.1
FT                   created on 30-APR-2002"
FT   CDS             1359921..1361978
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050067"
FT                   /product="mCG1050067, isoform CRA_b"
FT                   /note="gene_id=mCG1050067.1 transcript_id=mCT168464.0
FT                   protein_id=mCP91408.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3YZV8"
FT                   /db_xref="InterPro:IPR026523"
FT                   /db_xref="InterPro:IPR026526"
FT                   /db_xref="MGI:MGI:3612184"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YZV8"
FT                   /protein_id="EDL42062.1"
FT                   /translation="MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLIQFL
FT                   QEEGRTLEDVARIIEKSTPHPPQPRKRTKELRVRRVPQMVTPPLRLVVGTYDSSNGSDS
FT                   ELSDFDTSKVKGNRSSSGRTRKVRKMPVSYLGSKFLGSDVESEDDQELVEAFLRRGEKP
FT                   SAPPPRRRVNLPVPMFENNLGPQPSKADRWREYVSQVSWGKLKQRVKGWAPRSGSEVGQ
FT                   TQQASTAAERAGEMRHSQASSDDDSSRNTGDRSDQMLGTRRWKPKIKWVSLRRCRKEQV
FT                   PPFAQGTGMPAEEHPEAAENQGAEAAANQRAEPLASPRAEAAASPRAETAADPRVEAVA
FT                   SPRAEAAASPRAEAVADPRAEAAASPRAEAAASPRTEAAASLRAEAVASPRAEAAASPR
FT                   AEAAADPRAEAAASPIAEAAANQKAELVDSPRAETAADPRAEAAASPRAEAVADPRVEA
FT                   AASPIAEAAANQKAELVDSPRAETAADPRAEAAASPRAEAAADPRAEVAASPRAEAAAS
FT                   PRAEAEASPRAEAAASPKAEAEANLRVEAAAYLRAGVPPDQRAEAIDSQRAEGPANQRT
FT                   GATENQRVEVLADQRAGVLHDQREEAGPQGIQEASAGSGSRAQKQVKTVRFQTPGRFSW
FT                   FRMRRRVFWHTPRLPTLPRRVPRAGEARSLRVLRADIRADVEHREQEEQL"
FT   CDS             join(1359921..1361157,1361578..1361978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050067"
FT                   /product="mCG1050067, isoform CRA_a"
FT                   /note="gene_id=mCG1050067.1 transcript_id=mCT167771.1
FT                   protein_id=mCP76941.1 isoform=CRA_a"
FT                   /protein_id="EDL42061.1"
FT                   /translation="MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLIQFL
FT                   QEEGRTLEDVARIIEKSTPHPPQPRKRTKELRVRRVPQMVTPPLRLVVGTYDSSNGSDS
FT                   ELSDFDTSKVKGNRSSSGRTRKVRKMPVSYLGSKFLGSDVESEDDQELVEAFLRRGEKP
FT                   SAPPPRRRVNLPVPMFENNLGPQPSKADRWREYVSQVSWGKLKQRVKGWAPRSGSEVGQ
FT                   TQQASTAAERAGEMRHSQASSDDDSSRNTGDRSDQMLGTRRWKPKIKWVSLRRCRKEQV
FT                   PPFAQGTGMPAEEHPEAAENQGAEAAANQRAEPLASPRAEAAASPRAETAADPRVEAVA
FT                   SPRAEAAASPRAEAVADPRAEAAASPRAEAAASPRTEAAASLRAEAVASPRAEAAASPR
FT                   AEAAADPRAEAAARVPPDQRAEAIDSQRAEGPANQRTGATENQRVEVLADQRAGVLHDQ
FT                   REEAGPQGIQEASAGSGSRAQKQVKTVRFQTPGRFSWFRMRRRVFWHTPRLPTLPRRVP
FT                   RAGEARSLRVLRADIRADVEHREQEEQL"
FT   gene            complement(1370194..1393503)
FT                   /gene="Ppp5c"
FT                   /locus_tag="mCG_16544"
FT                   /note="gene_id=mCG16544.1"
FT   mRNA            complement(join(1370194..1370717,1370807..1370888,
FT                   1371606..1371784,1371878..1371918,1372453..1372540,
FT                   1372650..1372792,1373272..1373377,1374160..1374258,
FT                   1374539..1374604,1375414..1375535,1380939..1381086,
FT                   1387956..1388197,1393297..1393503))
FT                   /gene="Ppp5c"
FT                   /locus_tag="mCG_16544"
FT                   /product="protein phosphatase 5, catalytic subunit"
FT                   /note="gene_id=mCG16544.1 transcript_id=mCT18308.2 created
FT                   on 29-APR-2002"
FT   CDS             complement(join(1370655..1370717,1370807..1370888,
FT                   1371606..1371784,1371878..1371918,1372453..1372540,
FT                   1372650..1372792,1373272..1373377,1374160..1374258,
FT                   1374539..1374604,1375414..1375535,1380939..1381086,
FT                   1387956..1388197,1393297..1393417))
FT                   /codon_start=1
FT                   /gene="Ppp5c"
FT                   /locus_tag="mCG_16544"
FT                   /product="protein phosphatase 5, catalytic subunit"
FT                   /note="gene_id=mCG16544.1 transcript_id=mCT18308.2
FT                   protein_id=mCP23749.2"
FT                   /db_xref="GOA:Q60676"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:102666"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60676"
FT                   /protein_id="EDL42060.1"
FT                   /translation="MAMAEGERTECAETPRDEPPADGTLKRAEELKTQANDYFKAKDYE
FT                   NAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAA
FT                   SNMALGKFRAALRDYETVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVD
FT                   SLDIESMTIEDEYSGPKLEDGKVTITFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCK
FT                   LSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVE
FT                   VILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPL
FT                   AQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSK
FT                   RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNK
FT                   ASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM"
FT   gene            1397131..1397911
FT                   /locus_tag="mCG_1050075"
FT                   /note="gene_id=mCG1050075.1"
FT   mRNA            join(1397131..1397208,1397669..1397911)
FT                   /locus_tag="mCG_1050075"
FT                   /product="mCG1050075"
FT                   /note="gene_id=mCG1050075.1 transcript_id=mCT167779.1
FT                   created on 30-APR-2002"
FT   CDS             join(1397156..1397208,1397669..1397780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050075"
FT                   /product="mCG1050075"
FT                   /note="gene_id=mCG1050075.1 transcript_id=mCT167779.1
FT                   protein_id=mCP76984.1"
FT                   /protein_id="EDL42059.1"
FT                   /translation="MVVLETFVGFWAKDSWAIQEGLERELHEQNIWEEKTGGLRTETSS
FT                   VRAGKPRRS"
FT   gene            complement(1401356..>1422444)
FT                   /gene="Hif3a"
FT                   /locus_tag="mCG_16541"
FT                   /note="gene_id=mCG16541.1"
FT   mRNA            complement(join(1401356..1401587,1402757..1402838,
FT                   1405182..1405293,1406553..1406824,1408226..1408327,
FT                   1410081..1410271,1410559..1410671,1414115..1414263,
FT                   1414502..1414608,1420447..1420592,1422025..1422215,
FT                   1422342..>1422444))
FT                   /gene="Hif3a"
FT                   /locus_tag="mCG_16541"
FT                   /product="hypoxia inducible factor 3, alpha subunit"
FT                   /note="gene_id=mCG16541.1 transcript_id=mCT18180.2 created
FT                   on 29-APR-2002"
FT   CDS             complement(join(1401490..1401587,1402757..1402838,
FT                   1405182..1405293,1406553..1406824,1408226..1408327,
FT                   1410081..1410271,1410559..1410671,1414115..>1414167))
FT                   /codon_start=1
FT                   /gene="Hif3a"
FT                   /locus_tag="mCG_16541"
FT                   /product="hypoxia inducible factor 3, alpha subunit"
FT                   /note="gene_id=mCG16541.1 transcript_id=mCT18180.2
FT                   protein_id=mCP23761.2"
FT                   /protein_id="EDL42058.1"
FT                   /translation="GGRGPQSESIICVHFLISRVEETGVVLSLEQTEQHTRRPPRLSAS
FT                   SQKGIPGNSVDSPAPRILAFLHPPALSEASLAADPRRFCSPDLRRLMAPILDGPPPAAT
FT                   PSTPQATRRPQSPLPADLPDKLAVGLENAHRLSTAQKNKTVETDLDIAQDSDTLDLEML
FT                   APYISMDDDFQLNSSEQLPKVHRRPPRVARRPRARSFHGLSPPIPEPSLLPRWGSDPRL
FT                   NCSSPSRGDRPTASLMPGTRKRALAQSSEDKGLELLETKPPKRSPRLEPGSFLLPPLSL
FT                   SFLLQGRQLPGNQQDPRAPLVHSHEPLGLAPSLLSLCQHEETVQPRNRFPPAAGLGQTH
FT                   "
FT   assembly_gap    1415562..1417714
FT                   /estimated_length=2153
FT                   /gap_type="unknown"
FT   assembly_gap    1418885..1418904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1439721..1464639
FT                   /gene="Psg16"
FT                   /locus_tag="mCG_16546"
FT                   /note="gene_id=mCG16546.2"
FT   mRNA            join(1439721..1439938,1456049..1456396,1459224..1459583,
FT                   1460683..1461042,1463687..1464639)
FT                   /gene="Psg16"
FT                   /locus_tag="mCG_16546"
FT                   /product="pregnancy specific glycoprotein 16"
FT                   /note="gene_id=mCG16546.2 transcript_id=mCT18310.2 created
FT                   on 30-APR-2002"
FT   CDS             join(1456240..1456396,1459224..1459583,1460683..1461042,
FT                   1463687..1463970)
FT                   /codon_start=1
FT                   /gene="Psg16"
FT                   /locus_tag="mCG_16546"
FT                   /product="pregnancy specific glycoprotein 16"
FT                   /note="gene_id=mCG16546.2 transcript_id=mCT18310.2
FT                   protein_id=mCP23753.2"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1347249"
FT                   /db_xref="UniProtKB/TrEMBL:Q60962"
FT                   /protein_id="EDL42057.1"
FT                   /translation="MGQMYSGREIVSSNGSLWIHNVTRKDTGLYTLRTVNRRGEIVSTS
FT                   FTFLYVYTSLFICGRPSFPAKLTIESVPPSVAEGGSVLLRVHNLQDKLRGLSWYKGAHV
FT                   SRNLEIARQIIAKNSSVPGPAHSGRETVYSNGSLLLQNVTRNDTGFYTLQTLSRHRKME
FT                   LAHVQLQVDTSLSSCCDTLDSTQLIIDPMPRYAAEGESILLRVLNLPEDFQVFCWYKGA
FT                   LTFQIFKIAEYSRARNSITKGPAQSRTERVYTNGSLLLQDVTEKDTGLYTLQTIDRNFK
FT                   IEKAHVQIQVNKPVTQPFMRVTDSTVRVQSSVVFTCFSDNTGVSIHWLFNNQSLQLTER
FT                   ITLSPSKCQLRINPVRKEDGGEYQCEVFNLASSKSSLPVSLAVMNE"
FT   assembly_gap    1486945..1492479
FT                   /estimated_length=5535
FT                   /gap_type="unknown"
FT   gene            complement(1503973..1504574)
FT                   /pseudo
FT                   /locus_tag="mCG_16542"
FT                   /note="gene_id=mCG16542.1"
FT   mRNA            complement(1503973..1504574)
FT                   /pseudo
FT                   /locus_tag="mCG_16542"
FT                   /note="gene_id=mCG16542.1 transcript_id=mCT18181.2 created
FT                   on 29-APR-2002"
FT   assembly_gap    1505441..1505460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1516563..>1528277
FT                   /locus_tag="mCG_123668"
FT                   /note="gene_id=mCG123668.1"
FT   mRNA            join(<1516563..1516929,1519766..1520125,1523157..1523516,
FT                   1524749..1525108,1526645..1526992,1527997..>1528277)
FT                   /locus_tag="mCG_123668"
FT                   /product="mCG123668"
FT                   /note="gene_id=mCG123668.1 transcript_id=mCT124902.1
FT                   created on 30-APR-2002"
FT   CDS             join(<1516563..1516929,1519766..1520125,1523157..1523516,
FT                   1524749..1525108,1526645..1526992,1527997..>1528277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123668"
FT                   /product="mCG123668"
FT                   /note="gene_id=mCG123668.1 transcript_id=mCT124902.1
FT                   protein_id=mCP76955.1"
FT                   /protein_id="EDL42056.1"
FT                   /translation="LLASLLTCWLLPTTTQVDIESLPPQVVEGENVLLRVDNLPENLLG
FT                   FIWYKGVTDMSLGIALYSLTYSRGVTGPVHSGRETLYRNGSLWIQNVTQEDTGFYTLRT
FT                   ISKHGEIISNTSMHLHVYSSILTCGRPPTSAQLSIESVPPSVAKGESVLLLARNLPENL
FT                   RAIFWYKGAIVFKNLEVARYVIAKNSSVLGPAHSGREIMYSNGSLVLQNVTRNDAGFYT
FT                   LRTLSTDLKAEVAHVQLQVDTCLSIYENPPTSAQLTVESAPTSVAEGESVLLLVHNLPE
FT                   NLRAVFWYKGAIVFKDLEVARYVIAKNSSVPGPAHSRRETVYSNGSLLIQNVTRNDAGF
FT                   YTLRTLSTDLKAEVAHVQLQVDNSFFTCCDPLASAPLTIDPVPQQAAKGENVLLQVHNL
FT                   PEDLRMFSWFKSMYSTQIFKIAEYSRAFNSVIRGPAHSRREIVYTNGSLLLQDATEKDT
FT                   GMYTLQTVDRNFKIETAHVKIQINACIHPSATGQLVIESVPPNVVEGRDVLLLVHNMPE
FT                   NLRSFSWYKGVAIVSKHEISRNIITSNRSVLGPAHSGRETVYSNGSLLLHNATQKDAGL
FT                   YTLLTLNRRFETQGIHVHIHIYKPVVQPFMRVTDTTVRVQSSVVLTCLSADTGISTQWL
FT                   FNNQNLRLTERMMLSPSKCQLRIDPVRREDAGEYRCEVSNPVSSKTSLPVSLTVVIE"
FT   assembly_gap    1534728..1534747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1542034..1542053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1549790..1549809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1551517..1551542
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    1554279..1556720
FT                   /estimated_length=2442
FT                   /gap_type="unknown"
FT   gene            <1564200..>1572448
FT                   /gene="Psg29"
FT                   /locus_tag="mCG_123669"
FT                   /note="gene_id=mCG123669.1"
FT   mRNA            join(<1564200..1564263,1565399..1565746,1569021..1569380,
FT                   1570874..1571233,1572174..>1572448)
FT                   /gene="Psg29"
FT                   /locus_tag="mCG_123669"
FT                   /product="pregnancy-specific glycoprotein 29"
FT                   /note="gene_id=mCG123669.1 transcript_id=mCT124903.1
FT                   created on 30-APR-2002"
FT   CDS             join(1564200..1564263,1565399..1565746,1569021..1569380,
FT                   1570874..1571233,1572174..1572448)
FT                   /codon_start=1
FT                   /gene="Psg29"
FT                   /locus_tag="mCG_123669"
FT                   /product="pregnancy-specific glycoprotein 29"
FT                   /note="gene_id=mCG123669.1 transcript_id=mCT124903.1
FT                   protein_id=mCP76961.1"
FT                   /db_xref="GOA:Q3URN6"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1891361"
FT                   /db_xref="UniProtKB/TrEMBL:Q3URN6"
FT                   /protein_id="EDL42055.1"
FT                   /translation="MKVSGLLFCQGCAPWQGVLLTASFLTCWYLSTTSKVTIELLPSQV
FT                   VEGEDVLFLVNNLPGNLTAFAWFKGRTNRKHGIALYAVASDLYVHSDRETLYNNGSLMI
FT                   HNVTQKDRGYYTLRTFNKHAETVSTTFTFLHVNPFLWNCGRLVTSSQPRIESFPSIVTE
FT                   GQHVILHVYNIPENLQGFIWFKGMTVHRHLEIGRYTIGRKSSVFGPAYSGREKLDSNGS
FT                   LRIENVTQKDAGLYTLRVLGTDMKSEEAHVELQVNNPAFQCCNPSTSSKLMVEAVPRYV
FT                   AEGESVLLLVHNLPEELISFTWYNSMYRVPAFKIVEFNVIRNITTWGDVYRGRDTVYAN
FT                   GSLMLQDVTEEDARMYTLETLNVNYTVERAHVQFYVNKPVTQPFVQITDTTANAQRSLT
FT                   FTCVTPDIATSILWFFNSHSLKPTERITLSPTKCGLRIDDVRSEDAGNYQCVVVNRNGD
FT                   AKASHPIRWP"
FT   assembly_gap    1585673..1588592
FT                   /estimated_length=2920
FT                   /gap_type="unknown"
FT   assembly_gap    1590284..1591635
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   assembly_gap    1593542..1598141
FT                   /estimated_length=4600
FT                   /gap_type="unknown"
FT   assembly_gap    1599329..1611554
FT                   /estimated_length=12226
FT                   /gap_type="unknown"
XX
CO   join(AAHY01059658.1:1..3134,gap(2528),complement(AAHY01059659.1:1..5207),
CO   gap(1161),AAHY01059660.1:1..1440,gap(1768),
CO   complement(AAHY01059661.1:1..5767),gap(1978),
CO   complement(AAHY01059662.1:1..3485),gap(124),AAHY01059663.1:1..2192,gap(20),
CO   complement(AAHY01059664.1:1..2516),gap(159),
CO   complement(AAHY01059665.1:1..16882),gap(3047),
CO   complement(AAHY01059666.1:1..11521),gap(513),
CO   complement(AAHY01059667.1:1..7236),gap(1060),
CO   complement(AAHY01059668.1:1..3506),gap(1540),
CO   complement(AAHY01059669.1:1..1777),gap(1124),
CO   complement(AAHY01059670.1:1..8478),gap(317),
CO   complement(AAHY01059671.1:1..5168),gap(4035),
CO   complement(AAHY01059672.1:1..7101),gap(20),AAHY01059673.1:1..19355,gap(20),
CO   AAHY01059674.1:1..1040,gap(20),AAHY01059675.1:1..18628,gap(19735),
CO   complement(AAHY01059676.1:1..1353),gap(2627),
CO   complement(AAHY01059677.1:1..19254),gap(20),AAHY01059678.1:1..9936,gap(20),
CO   AAHY01059679.1:1..22658,gap(20),AAHY01059680.1:1..7585,gap(252),
CO   complement(AAHY01059681.1:1..24930),gap(4371),
CO   complement(AAHY01059682.1:1..27460),gap(27),
CO   complement(AAHY01059683.1:1..258843),gap(1880),
CO   complement(AAHY01059684.1:1..28149),gap(1918),AAHY01059685.1:1..16026,
CO   gap(3470),complement(AAHY01059686.1:1..8364),gap(1411),
CO   complement(AAHY01059687.1:1..8552),gap(20),AAHY01059688.1:1..3221,gap(628),
CO   complement(AAHY01059689.1:1..2003),gap(20),
CO   complement(AAHY01059690.1:1..1150),gap(1441),
CO   complement(AAHY01059691.1:1..20899),gap(20),AAHY01059692.1:1..1014,gap(20),
CO   complement(AAHY01059693.1:1..5103),gap(3714),AAHY01059694.1:1..43726,
CO   gap(20),AAHY01059695.1:1..143088,gap(20),AAHY01059696.1:1..7956,gap(1124),
CO   AAHY01059697.1:1..40030,gap(368),complement(AAHY01059698.1:1..124631),
CO   gap(20),complement(AAHY01059699.1:1..4060),gap(6422),
CO   complement(AAHY01059700.1:1..47896),gap(20),AAHY01059701.1:1..53285,
CO   gap(20),complement(AAHY01059702.1:1..7814),gap(103),
CO   complement(AAHY01059703.1:1..74883),gap(1140),
CO   complement(AAHY01059704.1:1..4964),gap(90),
CO   complement(AAHY01059705.1:1..1475),gap(3838),
CO   complement(AAHY01059706.1:1..1477),gap(20),AAHY01059707.1:1..1732,gap(20),
CO   AAHY01059708.1:1..2857,gap(20),AAHY01059709.1:1..4676,gap(20),
CO   complement(AAHY01059710.1:1..99654),gap(681),
CO   complement(AAHY01059711.1:1..25891),gap(20),
CO   complement(AAHY01059712.1:1..59519),gap(2153),
CO   complement(AAHY01059713.1:1..1170),gap(20),AAHY01059714.1:1..68040,
CO   gap(5535),complement(AAHY01059715.1:1..12961),gap(20),
CO   complement(AAHY01059716.1:1..29267),gap(20),
CO   complement(AAHY01059717.1:1..7286),gap(20),
CO   complement(AAHY01059718.1:1..7736),gap(20),
CO   complement(AAHY01059719.1:1..1707),gap(26),
CO   complement(AAHY01059720.1:1..2736),gap(2442),
CO   complement(AAHY01059721.1:1..28952),gap(2920),
CO   complement(AAHY01059722.1:1..1691),gap(1352),
CO   complement(AAHY01059723.1:1..1906),gap(4600),
CO   complement(AAHY01059724.1:1..1187),gap(12226),
CO   complement(AAHY01059725.1:1..2690))
//


spacer
spacer