Dbfetch

ID   CH466636; SV 1; linear; genomic DNA; CON; MUS; 2956610 BP.
XX
AC   CH466636;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009757723 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2956610
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-2956610
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; af1265cb2c24c3ba95675260dfaeffe4.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000211.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000025892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033538; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034311; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0034290; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034218; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0034220; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034284; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033994; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034804; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033321; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033323; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033966; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0033968; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0034125; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034068; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0034070; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034210; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0034212; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034112; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034823; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033025; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033437; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033439; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212533; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091072; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091147; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0091151; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091091; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0091095; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091077; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091081; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090649; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090653; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091599; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091217; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091221; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090578; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0090582; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0090793; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0090797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090625; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0090629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0090813; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0090817; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090649; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091913; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091917; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090656; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090660; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089682; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089686; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2956610
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    24803..24822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40703..50598
FT                   /estimated_length=9896
FT                   /gap_type="unknown"
FT   assembly_gap    76395..79774
FT                   /estimated_length=3380
FT                   /gap_type="unknown"
FT   assembly_gap    119526..119578
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    130838..130857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    179517..179536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    185889..185908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    206168..206600
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    228232..232679
FT                   /estimated_length=4448
FT                   /gap_type="unknown"
FT   assembly_gap    284151..284333
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    308931..309006
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    388986..389005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    413846..413865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    450973..451031
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    452641..452912
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    454346..454365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    484015..484034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    521459..521478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    523802..523989
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    537282..537394
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            complement(642999..>669172)
FT                   /gene="Casp12"
FT                   /locus_tag="mCG_18440"
FT                   /note="gene_id=mCG18440.1"
FT   mRNA            complement(join(642999..643893,656809..656927,
FT                   657297..657406,660969..661118,661784..662018,
FT                   662807..662980,663361..663455,665175..665252,
FT                   666695..666754,668920..>669172))
FT                   /gene="Casp12"
FT                   /locus_tag="mCG_18440"
FT                   /product="caspase 12"
FT                   /note="gene_id=mCG18440.1 transcript_id=mCT14333.1 created
FT                   on 07-MAY-2002"
FT   CDS             complement(join(656829..656927,657297..657406,
FT                   660969..661118,661784..662018,662807..662980,
FT                   663361..663455,665175..665252,666695..666754,
FT                   668920..>669172))
FT                   /codon_start=1
FT                   /gene="Casp12"
FT                   /locus_tag="mCG_18440"
FT                   /product="caspase 12"
FT                   /note="gene_id=mCG18440.1 transcript_id=mCT14333.1
FT                   protein_id=mCP6787.1"
FT                   /protein_id="EDL09317.1"
FT                   /translation="ARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGES
FT                   ASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPS
FT                   ESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEI
FT                   YPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQEM
FT                   ETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNSNC
FT                   RSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDF
FT                   IAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQM
FT                   PTIERVSMTRYFYLFPGN"
FT   assembly_gap    673857..673876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(678716..>706633)
FT                   /gene="Casp4"
FT                   /locus_tag="mCG_18434"
FT                   /note="gene_id=mCG18434.2"
FT   mRNA            complement(join(678716..678964,679400..679503,
FT                   686957..687066,688181..688324,690542..690776,
FT                   691707..691880,693993..694247,706591..>706633))
FT                   /gene="Casp4"
FT                   /locus_tag="mCG_18434"
FT                   /product="caspase 4, apoptosis-related cysteine peptidase,
FT                   transcript variant mCT190258"
FT                   /note="gene_id=mCG18434.2 transcript_id=mCT190258.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(678792..678964,679400..679503,
FT                   686957..687066,688181..688324,690542..690776,
FT                   691707..691880,692588..692685,693993..694247,
FT                   706591..706631))
FT                   /gene="Casp4"
FT                   /locus_tag="mCG_18434"
FT                   /product="caspase 4, apoptosis-related cysteine peptidase,
FT                   transcript variant mCT14327"
FT                   /note="gene_id=mCG18434.2 transcript_id=mCT14327.1 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(679405..679503,686957..687066,
FT                   688181..688324,690542..690776,691707..691880,
FT                   692588..692685,693993..694247,706591..706597))
FT                   /codon_start=1
FT                   /gene="Casp4"
FT                   /locus_tag="mCG_18434"
FT                   /product="caspase 4, apoptosis-related cysteine peptidase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18434.2 transcript_id=mCT14327.1
FT                   protein_id=mCP6792.1 isoform=CRA_a"
FT                   /db_xref="GOA:P70343"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="MGI:MGI:107700"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70343"
FT                   /protein_id="EDL09318.1"
FT                   /translation="MAENKHPDKPLKVLEQLGKEVLTEYLEKLVQSNVLKLKEEDKQKF
FT                   NNAERSDKRWVFVDAMKKKHSKVGEMLLQTFFSVDPGSHHGEANLEMEEPEESLNTLKL
FT                   CSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLE
FT                   DLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTP
FT                   DVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRN
FT                   MEADAVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFL
FT                   KVQQSFEKASIHSQMPTIDRATLTRYFYLFPGN"
FT   CDS             complement(join(679405..679503,686957..687066,
FT                   688181..688324,690542..690776,691707..691880,
FT                   693993..>694049))
FT                   /codon_start=1
FT                   /gene="Casp4"
FT                   /locus_tag="mCG_18434"
FT                   /product="caspase 4, apoptosis-related cysteine peptidase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18434.2 transcript_id=mCT190258.0
FT                   protein_id=mCP111248.0 isoform=CRA_b"
FT                   /protein_id="EDL09319.1"
FT                   /translation="VKCFSRHSSVWTQAATMVKIYPIKEANGRTRKALIICNTEFKHLS
FT                   LRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMS
FT                   HGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGNSGEMWI
FT                   RESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLI
FT                   SCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDRATLTRYFYLFPGN"
FT   gene            complement(708213..717017)
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /note="gene_id=mCG18435.2"
FT   mRNA            complement(join(708213..708322,708732..708835,
FT                   709279..709388,711178..711318,711731..711965,
FT                   712334..712507,712976..713088,715640..715702,
FT                   715959..716225,716802..716988))
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, transcript variant mCT185369"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185369.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(708214..708322,708732..708835,
FT                   709279..709388,711178..711318,711731..711965,
FT                   712334..712969))
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, transcript variant mCT185370"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185370.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(708217..708322,708732..708835,
FT                   709279..709388,711178..711318,711731..711965,
FT                   712334..712507,712976..713088,715640..715702,
FT                   715959..716225,716701..716828))
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, transcript variant mCT14328"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT14328.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(708737..708835,709279..709388,
FT                   711178..711318,711731..711965,712334..712507,
FT                   712976..713088,715640..715702,715959..716225,
FT                   716802..716808))
FT                   /codon_start=1
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, isoform CRA_d"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185369.0
FT                   protein_id=mCP106629.0 isoform=CRA_d"
FT                   /protein_id="EDL09323.1"
FT                   /translation="MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKL
FT                   ANITAMDKARDLCDHVSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDS
FT                   KGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRL
FT                   ALIICNTEFQHLSPRVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPE
FT                   HKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIII
FT                   QACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRH
FT                   PVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLF
FT                   PGH"
FT   CDS             complement(join(708737..708835,709279..709388,
FT                   711178..711318,711731..711965,712334..712507,
FT                   712976..713088,715640..715702,715959..716115))
FT                   /codon_start=1
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, isoform CRA_a"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT14328.1
FT                   protein_id=mCP6795.1 isoform=CRA_a"
FT                   /protein_id="EDL09320.1"
FT                   /translation="MDKIKLANITAMDKARDLCDHVSKKGPQASQIFITYICNEDCYLA
FT                   GILELQSAPSAETFVATEDSKGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPLEKAQKL
FT                   WKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVGAQVDLREMKLLLEDLGYTVKVK
FT                   ENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIF
FT                   QMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAH
FT                   IEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPE
FT                   FRLQMPTADRVTLTKRFYLFPGH"
FT   CDS             complement(join(708737..708835,709279..709388,
FT                   711178..711318,711731..711965,712334..712495))
FT                   /codon_start=1
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, isoform CRA_b"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185370.0
FT                   protein_id=mCP106628.0 isoform=CRA_b"
FT                   /protein_id="EDL09321.1"
FT                   /translation="MNTTTRTRLALIICNTEFQHLSPRVGAQVDLREMKLLLEDLGYTV
FT                   KVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVD
FT                   TIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIK
FT                   KAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFE
FT                   QPEFRLQMPTADRVTLTKRFYLFPGH"
FT   mRNA            complement(join(712792..713088,715640..715702,
FT                   715959..716225,716802..717017))
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, transcript variant mCT185371"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185371.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(712955..713088,715640..715702,
FT                   715959..716225,716802..716808))
FT                   /codon_start=1
FT                   /gene="Casp1"
FT                   /locus_tag="mCG_18435"
FT                   /product="caspase 1, isoform CRA_c"
FT                   /note="gene_id=mCG18435.2 transcript_id=mCT185371.0
FT                   protein_id=mCP106627.0 isoform=CRA_c"
FT                   /protein_id="EDL09322.1"
FT                   /translation="MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKL
FT                   ANITAMDKARDLCDHVSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDS
FT                   KGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPLEKAQKLWKENPSEVLCSRI"
FT   assembly_gap    731593..734704
FT                   /estimated_length=3112
FT                   /gap_type="unknown"
FT   assembly_gap    761700..761719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    763910..763929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    765388..765594
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    773346..773365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    776925..776944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    783638..783657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    937037..937170
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    940689..940708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    941901..943237
FT                   /estimated_length=1337
FT                   /gap_type="unknown"
FT   assembly_gap    962810..962829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    974709..974728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980982..981599
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   gene            complement(1036221..>1038584)
FT                   /locus_tag="mCG_118566"
FT                   /note="gene_id=mCG118566.1"
FT   mRNA            complement(1036221..>1038584)
FT                   /locus_tag="mCG_118566"
FT                   /product="mCG118566"
FT                   /note="gene_id=mCG118566.1 transcript_id=mCT119723.1
FT                   created on 25-JUN-2002"
FT   CDS             complement(1037301..>1038104)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118566"
FT                   /product="mCG118566"
FT                   /note="gene_id=mCG118566.1 transcript_id=mCT119723.1
FT                   protein_id=mCP72598.1"
FT                   /protein_id="EDL09324.1"
FT                   /translation="LVAEFSAAGILPNKSAYDQKNIRRRVYDALNVLMAMNIISKEKKE
FT                   IKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRQAEQQA
FT                   RRPPLPNSVIHLPFIIVNTSRKTVIDCSISYDKFEYLFNFDNAFEIHDDIEVLKRMGMA
FT                   CGLESGNCSAEDLKVARSLVPKALEPYVTEMAQGSTGGVFVTTTGSTSNGTRLSASDLS
FT                   NGADGMLATSSNGSQYSGSRVETPVSYVGEDDDDDDDFNENDEED"
FT   assembly_gap    1057826..1058322
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    1108291..1108471
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    1119606..1119625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1139622..1139641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1145856..1146041
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    1147778..1148064
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    1167163..1170203
FT                   /estimated_length=3041
FT                   /gap_type="unknown"
FT   assembly_gap    1203035..1203054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1221492..1595846
FT                   /gene="Gria4"
FT                   /locus_tag="mCG_118567"
FT                   /note="gene_id=mCG118567.1"
FT   mRNA            join(1221492..1221882,1222358..1222534,1223753..1223911,
FT                   1352304..1352543,1479435..1479619,1497715..1497768,
FT                   1503877..1504035,1513439..1513606,1514690..1514794,
FT                   1536914..1537024,1544977..1545183,1552713..1553083,
FT                   1555093..1555291,1560945..1561192,1583088..1583202,
FT                   1591512..1591646,1595650..1595846)
FT                   /gene="Gria4"
FT                   /locus_tag="mCG_118567"
FT                   /product="glutamate receptor, ionotropic, AMPA4 (alpha 4),
FT                   transcript variant mCT119724"
FT                   /note="gene_id=mCG118567.1 transcript_id=mCT119724.1
FT                   created on 21-FEB-2003"
FT   mRNA            join(<1221492..1221882,1222358..1222534,1223753..1223911,
FT                   1352304..1352543,1479435..1479619,1497715..1497768,
FT                   1503877..1504035,1513439..1513606,1514690..1514794,
FT                   1536914..1537024,1538350..1538939)
FT                   /gene="Gria4"
FT                   /locus_tag="mCG_118567"
FT                   /product="glutamate receptor, ionotropic, AMPA4 (alpha 4),
FT                   transcript variant mCT190260"
FT                   /note="gene_id=mCG118567.1 transcript_id=mCT190260.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1222384..1222534,1223753..1223911,1352304..1352543,
FT                   1479435..1479619,1497715..1497768,1503877..1504035,
FT                   1513439..1513606,1514690..1514794,1536914..1537024,
FT                   1538350..1538382)
FT                   /codon_start=1
FT                   /gene="Gria4"
FT                   /locus_tag="mCG_118567"
FT                   /product="glutamate receptor, ionotropic, AMPA4 (alpha 4),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG118567.1 transcript_id=mCT190260.0
FT                   protein_id=mCP111247.0 isoform=CRA_a"
FT                   /protein_id="EDL09325.1"
FT                   /translation="KSFSKSERKRGERAPGRGAKKMRIICRQIVLLFSGFWGLAMGAFP
FT                   SSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAF
FT                   CSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGAL
FT                   LSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEEL
FT                   DRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVT
FT                   GFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQK
FT                   IDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFE
FT                   LKSTGPRKVGYWNDMDKLVLIQDAPTLGNDTAAIENRTVVVTTIMPLMKNPILRN"
FT   CDS             join(1222447..1222534,1223753..1223911,1352304..1352543,
FT                   1479435..1479619,1497715..1497768,1503877..1504035,
FT                   1513439..1513606,1514690..1514794,1536914..1537024,
FT                   1544977..1545183,1552713..1553083,1555093..1555291,
FT                   1560945..1561192,1583088..1583202,1591512..1591646,
FT                   1595650..1595814)
FT                   /codon_start=1
FT                   /gene="Gria4"
FT                   /locus_tag="mCG_118567"
FT                   /product="glutamate receptor, ionotropic, AMPA4 (alpha 4),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG118567.1 transcript_id=mCT119724.1
FT                   protein_id=mCP72599.1 isoform=CRA_b"
FT                   /db_xref="GOA:G5E863"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95811"
FT                   /db_xref="UniProtKB/TrEMBL:G5E863"
FT                   /protein_id="EDL09326.1"
FT                   /translation="MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFR
FT                   LAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVH
FT                   TLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRG
FT                   YSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNIL
FT                   EQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKK
FT                   LDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWG
FT                   QGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLI
FT                   QDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHI
FT                   GIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPF
FT                   MSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTE
FT                   EPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIII
FT                   SSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWT
FT                   YMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKG
FT                   YGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLS
FT                   NVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENG
FT                   RVLTPDCPKAVHTGTAIRQSSGLAVIASDLP"
FT   assembly_gap    1246201..1251889
FT                   /estimated_length=5689
FT                   /gap_type="unknown"
FT   assembly_gap    1273851..1273870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1284159..1284178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1294464..1294483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1344776..1344795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1407440..1407459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1421171..1421190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1444988..1445134
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    1451532..1451808
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    1507358..1507377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1512148..1512167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1515815..1515843
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1519409..1525053
FT                   /estimated_length=5645
FT                   /gap_type="unknown"
FT   assembly_gap    1598642..1598711
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1605255..1605329
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    1609024..1611141
FT                   /estimated_length=2118
FT                   /gap_type="unknown"
FT   assembly_gap    1614538..1614557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1619553..1619602
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    1623462..1625496
FT                   /estimated_length=2035
FT                   /gap_type="unknown"
FT   gene            complement(1629554..>1639876)
FT                   /gene="8430410K20Rik"
FT                   /locus_tag="mCG_9493"
FT                   /note="gene_id=mCG9493.1"
FT   mRNA            complement(join(1629554..1631698,1632295..1632900,
FT                   1639815..>1639876))
FT                   /gene="8430410K20Rik"
FT                   /locus_tag="mCG_9493"
FT                   /product="RIKEN cDNA 8430410K20"
FT                   /note="gene_id=mCG9493.1 transcript_id=mCT9324.1 created on
FT                   07-MAY-2002"
FT   CDS             complement(join(1631123..1631698,1632295..>1632855))
FT                   /codon_start=1
FT                   /gene="8430410K20Rik"
FT                   /locus_tag="mCG_9493"
FT                   /product="RIKEN cDNA 8430410K20"
FT                   /note="gene_id=mCG9493.1 transcript_id=mCT9324.1
FT                   protein_id=mCP6806.0"
FT                   /protein_id="EDL09327.1"
FT                   /translation="FELRANKALGLWHTLHILCTALFAVKICTGFLKMKQLKRKRKSNF
FT                   SVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGEGEQRTGTEVKR
FT                   RYLDWRALMKRKRMKANMKLVGSGFPLPTSDLDDSLTEDIDEKIAFRNDANFEWQNVAD
FT                   FRDAGGSLTEVKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDFPHIDEFFTL
FT                   NSTPSRPTYDEPHLLMNIEKQKLELEKRRLDIEAERLQVEKERLQIEKERLRHLDLEHE
FT                   RLQLEKERLQIEREKWRLQLVSTEKPALENELGQGEKSMLQPQDIEAEKLKLERERLQL
FT                   EKDRLQFLKFESEKLQIEKERLQVEKERLRIQKEGHLP"
FT   assembly_gap    1650357..1650376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1661650..1669472
FT                   /estimated_length=7823
FT                   /gap_type="unknown"
FT   assembly_gap    1679367..1679516
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            complement(1683245..1705179)
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /note="gene_id=mCG9494.2"
FT   mRNA            complement(join(1683245..1685107,1697893..1698129,
FT                   1701150..1701259,1704989..1705179))
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   transcript variant mCT9325"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT9325.2 created on
FT                   18-MAR-2003"
FT   mRNA            complement(join(1683245..1685107,1697885..1698129,
FT                   1701150..1701254,1704989..>1705090))
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   transcript variant mCT190259"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT190259.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1683310..1685107,1697885..1698129,
FT                   1704989..1705070))
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   transcript variant mCT181333"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT181333.0 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(1683505..1685107,1697885..>1698123))
FT                   /codon_start=1
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT190259.0
FT                   protein_id=mCP111250.0 isoform=CRA_b"
FT                   /protein_id="EDL09329.1"
FT                   /translation="EQVELAMDNSYNLNEQSSWNGISSEKKKNYLASEDHGQKILSVLQ
FT                   SFREQNVFYDFKIIMKEEIIPCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKA
FT                   VKAFLDYAYTGKTRITDDNVEMFFQLSSFLQVSFLSKACSDFLIKSISLVNCLHLLSLS
FT                   DSYGSAQLFSHTLYFVQHHFHLLYKSSDFLEMNFGVLQKCLESDELNVPEEEMVLKAVL
FT                   TWIKYNLESRQKHLPHLITKVRLHQLSEDTLQDYLLNEEYLLKSTNCFDIIVDAIKCVQ
FT                   GSSGLFPDARPSTTEKYIFIHKTEENGENQYTFCYNIKTDSWKILPQSHLIDLPGSSLS
FT                   SYGEKIFLTGGCKGKCCRRIRLHIAQSYHDATDQTWCYCPAKNEFFCVSAMKTPRTMHT
FT                   SVMALNRLFVIGGKTRGSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNII
FT                   YVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICD
FT                   LSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHS
FT                   SRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF"
FT   CDS             complement(join(1683505..1685107,1697885..1698105))
FT                   /codon_start=1
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT181333.0
FT                   protein_id=mCP104255.0 isoform=CRA_a"
FT                   /protein_id="EDL09328.1"
FT                   /translation="MDNSYNLNEQSSWNGISSEKKKNYLASEDHGQKILSVLQSFREQN
FT                   VFYDFKIIMKEEIIPCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLD
FT                   YAYTGKTRITDDNVEMFFQLSSFLQVSFLSKACSDFLIKSISLVNCLHLLSLSDSYGSA
FT                   QLFSHTLYFVQHHFHLLYKSSDFLEMNFGVLQKCLESDELNVPEEEMVLKAVLTWIKYN
FT                   LESRQKHLPHLITKVRLHQLSEDTLQDYLLNEEYLLKSTNCFDIIVDAIKCVQGSSGLF
FT                   PDARPSTTEKYIFIHKTEENGENQYTFCYNIKTDSWKILPQSHLIDLPGSSLSSYGEKI
FT                   FLTGGCKGKCCRRIRLHIAQSYHDATDQTWCYCPAKNEFFCVSAMKTPRTMHTSVMALN
FT                   RLFVIGGKTRGSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSE
FT                   VEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKV
FT                   YSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWE
FT                   EVSPMPRALTEFYCQVIQFNKYRDPWYSNHF"
FT   CDS             complement(join(1685072..1685107,1697893..1698105))
FT                   /codon_start=1
FT                   /gene="Kbtbd3"
FT                   /locus_tag="mCG_9494"
FT                   /product="kelch repeat and BTB (POZ) domain containing 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9494.2 transcript_id=mCT9325.2
FT                   protein_id=mCP6808.2 isoform=CRA_c"
FT                   /protein_id="EDL09330.1"
FT                   /translation="MDNSYNLNEQSSWNGISSEKKKNYLASEDHGQKILSVLQSFREQN
FT                   VFYDFKIIMKEEIIPCHRCVLAACSDGYVRSKHERKR"
FT   gene            1705281..1720106
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /note="gene_id=mCG9497.2"
FT   mRNA            join(1705281..1705669,1706004..1706229,1711708..1711829,
FT                   1712292..1712453,1715554..1715625,1718084..1720106)
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, transcript
FT                   variant mCT9328"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT9328.3 created on
FT                   18-MAR-2003"
FT   mRNA            join(1705282..1705669,1706004..1706189,1712292..1712453,
FT                   1715554..1715625,1718084..1720106)
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, transcript
FT                   variant mCT169663"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT169663.1 created
FT                   on 18-MAR-2003"
FT   mRNA            join(<1705451..1705635,1706004..1706229,1712292..1712453,
FT                   1715554..1715625,1718084..1719958)
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, transcript
FT                   variant mCT190262"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT190262.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1705451..1705635,1706004..1706229,1711708..1711829,
FT                   1712292..1712453,1715554..1715625,1718084..1718890)
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, transcript
FT                   variant mCT190263"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT190263.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(1705487..1705669,1706004..1706229,1711708..1711829,
FT                   1712292..1712453,1715554..1715625,1718084..1718248)
FT                   /codon_start=1
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT9328.3
FT                   protein_id=mCP6789.3 isoform=CRA_c"
FT                   /protein_id="EDL09333.1"
FT                   /translation="MVFPAKRLCVVPSMEGVRWAFSCGTWLPSRAEWLLAMRSIQPEEK
FT                   ERIGKFVFARDAKAALAGRLMIRKLVAEKLNIPWDHIRLQRTSKGKPVLAKDSLNPYPN
FT                   FNFNISHQGDYAVLAAEPEVQVGIDIMKTSFPGRGSIPEFFHIMKRKFTKKEWETIRSF
FT                   NDEWTQLDMFYRHWALKESFIKAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETCLILDG
FT                   EEEKEWAFEESKIDEHHFVAVAVRKPDGSRHQNVSYQDDSKLSQRKFTILNFNDLVASA
FT                   IPMTPEDPSFWDCFCFTEEILIRNGTKS"
FT   CDS             join(1705487..1705669,1706004..1706189,1712292..1712453,
FT                   1715554..1715625,1718084..1718248)
FT                   /codon_start=1
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT169663.1
FT                   protein_id=mCP92837.1 isoform=CRA_d"
FT                   /protein_id="EDL09334.1"
FT                   /translation="MVFPAKRLCVVPSMEGVRWAFSCGTWLPSRAEWLLAMRSIQPEEK
FT                   ERIGKFVFARDAKAALAGRLMIRKLVAEKLNIPWDHIRLQRTSKGKPVLAKDSLNPYPN
FT                   FNFNISHQGDYAVLAAEPEALKESFIKAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETC
FT                   LILDGEEEKEWAFEESKIDEHHFVAVAVRKPDGSRHQNVSYQDDSKLSQRKFTILNFND
FT                   LVASAIPMTPEDPSFWDCFCFTEEILIRNGTKS"
FT   CDS             join(<1705504..1705635,1706004..1706229,1711708..1711829,
FT                   1712292..1712453,1715554..1715625,1718084..1718248)
FT                   /codon_start=1
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT190263.0
FT                   protein_id=mCP111252.0 isoform=CRA_b"
FT                   /protein_id="EDL09332.1"
FT                   /translation="EAVRGAIHGGRSLGILLRYLAAKSSRMASGDAVYPAGGEGAHRQA
FT                   GRLMIRKLVAEKLNIPWDHIRLQRTSKGKPVLAKDSLNPYPNFNFNISHQGDYAVLAAE
FT                   PEVQVGIDIMKTSFPGRGSIPEFFHIMKRKFTKKEWETIRSFNDEWTQLDMFYRHWALK
FT                   ESFIKAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETCLILDGEEEKEWAFEESKIDEHH
FT                   FVAVAVRKPDGSRHQNVSYQDDSKLSQRKFTILNFNDLVASAIPMTPEDPSFWDCFCFT
FT                   EEILIRNGTKS"
FT   CDS             join(<1706215..1706229,1712292..1712453,1715554..1715625,
FT                   1718084..1718248)
FT                   /codon_start=1
FT                   /gene="Aasdhppt"
FT                   /locus_tag="mCG_9497"
FT                   /product="aminoadipate-semialdehyde
FT                   dehydrogenase-phosphopantetheinyl transferase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9497.2 transcript_id=mCT190262.0
FT                   protein_id=mCP111251.0 isoform=CRA_a"
FT                   /protein_id="EDL09331.1"
FT                   /translation="RLVFQALKESFIKAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETC
FT                   LILDGEEEKEWAFEESKIDEHHFVAVAVRKPDGSRHQNVSYQDDSKLSQRKFTILNFND
FT                   LVASAIPMTPEDPSFWDCFCFTEEILIRNGTKS"
FT   assembly_gap    1758451..1758633
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    1761733..1761913
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    1771585..1771612
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1803691..1803710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1825736..1829265
FT                   /estimated_length=3530
FT                   /gap_type="unknown"
FT   assembly_gap    1857527..1858046
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    1865333..1865352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1875170..1875348
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    1875857..1876117
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    1907004..1907023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1916343..1916362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1984721..1984740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1986009..1986028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2004874..2004893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2034628..2034647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2061246..2061265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2066026..2067181
FT                   /estimated_length=1156
FT                   /gap_type="unknown"
FT   assembly_gap    2089874..2089967
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   gene            complement(<2112722..>2247154)
FT                   /locus_tag="mCG_9496"
FT                   /note="gene_id=mCG9496.1"
FT   mRNA            complement(join(<2112722..2112929,2141358..2141512,
FT                   2209161..2209304,2246669..>2247154))
FT                   /locus_tag="mCG_9496"
FT                   /product="mCG9496"
FT                   /note="gene_id=mCG9496.1 transcript_id=mCT9327.0 created on
FT                   07-MAY-2002"
FT   CDS             complement(join(2112722..2112929,2141358..2141512,
FT                   2209161..2209304,2246669..>2247154))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9496"
FT                   /product="mCG9496"
FT                   /note="gene_id=mCG9496.1 transcript_id=mCT9327.0
FT                   protein_id=mCP6814.0"
FT                   /protein_id="EDL09335.1"
FT                   /translation="VMEIKGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHD
FT                   ATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQL
FT                   WQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYKV
FT                   ETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTPDGKAIQMRIGIHSGSVLA
FT                   GVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREDSFTFIPRSREELP
FT                   DNFPKEIPGVCYFLELRTDPKPPKPSLSSSRIKKVSYNIGTMFLRETSL"
FT   assembly_gap    2120080..2121623
FT                   /estimated_length=1544
FT                   /gap_type="unknown"
FT   assembly_gap    2124080..2126128
FT                   /estimated_length=2049
FT                   /gap_type="unknown"
FT   assembly_gap    2164928..2164947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2183604..2183684
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    2199626..2199645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2200615..2202798
FT                   /estimated_length=2184
FT                   /gap_type="unknown"
FT   assembly_gap    2204186..2204530
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    2256706..2259494
FT                   /estimated_length=2789
FT                   /gap_type="unknown"
FT   assembly_gap    2260453..2262169
FT                   /estimated_length=1717
FT                   /gap_type="unknown"
FT   assembly_gap    2325526..2325545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2330590..2330609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2346019..2347908
FT                   /estimated_length=1890
FT                   /gap_type="unknown"
FT   assembly_gap    2414602..2414741
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2453267..2453677
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    2472627..2472944
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    2512570..2512589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2527276..>2571257)
FT                   /locus_tag="mCG_3419"
FT                   /note="gene_id=mCG3419.1"
FT   mRNA            complement(join(2527276..2528764,2530997..2531098,
FT                   2541960..2542040,2543202..2543357,2547339..2547551,
FT                   2551940..2552077,2554738..2554854,2559044..2559130,
FT                   2560946..2561036,2571005..>2571257))
FT                   /locus_tag="mCG_3419"
FT                   /product="mCG3419"
FT                   /note="gene_id=mCG3419.1 transcript_id=mCT2496.1 created on
FT                   07-MAY-2002"
FT   CDS             complement(join(2528621..2528764,2530997..2531098,
FT                   2541960..2542040,2543202..2543357,2547339..2547551,
FT                   2551940..2552077,2554738..2554854,2559044..2559130,
FT                   2560946..2561036,2571005..>2571255))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3419"
FT                   /product="mCG3419"
FT                   /note="gene_id=mCG3419.1 transcript_id=mCT2496.1
FT                   protein_id=mCP18126.1"
FT                   /protein_id="EDL09336.1"
FT                   /translation="AQASLHCDFRKLTENSEESSASCSRSDRRQENRKPSDKKPLETWS
FT                   YNANQHSTGGRREQLQAESMSCDPPGRGLQQDMTLTIAGPEAESTYILNVDEKNKLGAK
FT                   IIKAEMMGNMELAEQLKAQLKEANKFKETQMPAKRLGVEHEDEQEVILIQTDKSGRMWP
FT                   VSSPRETLDMKAERRKRKRVSTHEDKERVRYFPDDDHLSLKDLVKNEKIGTDINQNRLF
FT                   MKMASKFMGKSDEDNYTLDDMFVSKAAEKEHLGKKEESQRRRAIAEHQSLAAKMAKCLY
FT                   CFDSSQFPKHLIVAIGVKMFRKSLVKMFEDKELDCIFLETNMGLKKHYHMVYECIPLPK
FT                   EVGDMAPIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFAVDFGLQGGFAHI
FT                   IEDQYRFPHYFGKEIIGGMLDLEPRLWRKGIRESFEDQRKKSLQFAQWWKPYDITKSKS
FT                   S"
FT   assembly_gap    2540787..2540806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2571616..2597533)
FT                   /locus_tag="mCG_3415"
FT                   /note="gene_id=mCG3415.1"
FT   mRNA            complement(join(<2571616..2571654,2573309..2573424,
FT                   2580716..2580806,2583317..2583436,2584110..2584184,
FT                   2590692..2590814,2592067..2592177,2597174..2597533))
FT                   /locus_tag="mCG_3415"
FT                   /product="mCG3415, transcript variant mCT2503"
FT                   /note="gene_id=mCG3415.1 transcript_id=mCT2503.2 created on
FT                   18-MAR-2003"
FT   CDS             complement(join(<2571616..2571654,2573309..2573424,
FT                   2580716..2580806,2583317..2583436,2584110..2584184,
FT                   2590692..2590814,2592067..2592177,2597174..2597266))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3415"
FT                   /product="mCG3415, isoform CRA_b"
FT                   /note="gene_id=mCG3415.1 transcript_id=mCT2503.2
FT                   protein_id=mCP18122.3 isoform=CRA_b"
FT                   /protein_id="EDL09338.1"
FT                   /translation="MEAFSVRFESASSIEERKEQTRNARAEVLRQAKHNFEKEQRGEER
FT                   KRLRDEDTWMLPDVHERIEQFSQEHSEKKKKKKDKHSKKVKKEKKKKRKKQKCQKQSES
FT                   TDSSAISDKEKTWKVKDKRTEEECDSHDIQRDEWMTIDFMSIKTVSSSSLKAEKETLRQ
FT                   IEREKTQVLEQSKLLERELNPYWKDGGTGLPSKTCILPVTKAKGVEDGGLSWLRKSCQR
FT                   MKEQAQKENRNFEDIVAEKYGSMEIFQSKLKEAE"
FT   mRNA            complement(join(<2571640..2571654,2573309..2573424,
FT                   2580716..2580806,2583317..2583436,2584110..2584223,
FT                   2590692..2590814,2592067..2592177,2597174..>2597225))
FT                   /locus_tag="mCG_3415"
FT                   /product="mCG3415, transcript variant mCT190261"
FT                   /note="gene_id=mCG3415.1 transcript_id=mCT190261.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<2571640..2571654,2573309..2573424,
FT                   2580716..2580806,2583317..2583436,2584110..2584223,
FT                   2590692..2590814,2592067..2592177,2597174..>2597224))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3415"
FT                   /product="mCG3415, isoform CRA_a"
FT                   /note="gene_id=mCG3415.1 transcript_id=mCT190261.0
FT                   protein_id=mCP111249.0 isoform=CRA_a"
FT                   /protein_id="EDL09337.1"
FT                   /translation="EERKEQTRNARAEVLRQAKHNFEKEQRGEERKRLRDEDTWMLPDV
FT                   HERIEQFSQEHSEKKKKKKDKHSKKVKKEKKKKRKKQKCQKQSESTDSSASSEDEWVEA
FT                   APSQISDKEKTWKVKDKRTEEECDSHDIQRDEWMTIDFMSIKTVSSSSLKAEKETLRQI
FT                   EREKTQVLEQSKLLERELNPYWKDGGTGLPSKTCILPVTKAKGVEDGGLSWLRKSCQRM
FT                   KEQAQKENRNFEDIVAEKYGSMEIF"
FT   assembly_gap    2584722..2585052
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    2592819..2593419
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   gene            2596787..2598757
FT                   /locus_tag="mCG_147281"
FT                   /note="gene_id=mCG147281.0"
FT   mRNA            2596787..2598757
FT                   /locus_tag="mCG_147281"
FT                   /product="mCG147281"
FT                   /note="gene_id=mCG147281.0 transcript_id=mCT187544.0
FT                   created on 13-JAN-2004"
FT   CDS             2597500..2597601
FT                   /codon_start=1
FT                   /locus_tag="mCG_147281"
FT                   /product="mCG147281"
FT                   /note="gene_id=mCG147281.0 transcript_id=mCT187544.0
FT                   protein_id=mCP109194.0"
FT                   /protein_id="EDL09339.1"
FT                   /translation="MRYYEPCDILTHFSIGLLKHSSKLEVTYFPLLA"
FT   gene            complement(2614318..>2665679)
FT                   /gene="Alkbh8"
FT                   /locus_tag="mCG_3417"
FT                   /note="gene_id=mCG3417.1"
FT   mRNA            complement(join(2614318..2616323,2618522..2618630,
FT                   2620901..2620997,2631445..2631705,2633348..2633499,
FT                   2641730..2641836,2651830..2651900,2653412..2653516,
FT                   2656420..2656551,2657887..2658124,2662548..2662683,
FT                   2665403..>2665679))
FT                   /gene="Alkbh8"
FT                   /locus_tag="mCG_3417"
FT                   /product="alkB, alkylation repair homolog 8 (E. coli)"
FT                   /note="gene_id=mCG3417.1 transcript_id=mCT2494.1 created on
FT                   07-MAY-2002"
FT   CDS             complement(join(2615766..2616323,2618522..2618630,
FT                   2620901..2620997,2631445..2631705,2633348..2633499,
FT                   2641730..2641836,2651830..2651900,2653412..2653516,
FT                   2656420..2656551,2657887..2658124,2662548..2662683,
FT                   2665403..>2665584))
FT                   /codon_start=1
FT                   /gene="Alkbh8"
FT                   /locus_tag="mCG_3417"
FT                   /product="alkB, alkylation repair homolog 8 (E. coli)"
FT                   /note="gene_id=mCG3417.1 transcript_id=mCT2494.1
FT                   protein_id=mCP18124.1"
FT                   /protein_id="EDL09340.1"
FT                   /translation="QSSWEVNISGEEREKCTPPDWGLGIWRIANPGLLLSAPCLLCPDQ
FT                   HGPTQTAKSAVYGLGSITMNINHKGVLKLTKMEKKFLRKQSKARHVLLKHEGIQAVSYP
FT                   TQSLVIANGGLGNGVSRKQLLLTLEKCGPVEALLMPPNKPYAFVIFQTIEESKKAYFTL
FT                   NGKEIIDDLGQKIFLYLNFVEKAQWKNMGLEALPPGLLVVEEIISSEEEKKLLESVNWT
FT                   EDTGNQNCLPEVCSSILEKLLKEGYIKHKPDQLTINQYEPGHGIPAHIDTHSAFEDEII
FT                   SLSLGSAIVMDFKHPEGVTVQVMLPRRSLLVMTGESRYLWTHGITPRKFDTVQASEQFK
FT                   GGIITSDIGDLTLSKRGMRTSFTFRKVRRMPCNCSYSSVCDRQRKATPPSLTESSKEAL
FT                   ELEQKHVHQVYNEIASHFSSTRHSPWPRIVEFLKALPSGSIVADIGCGNGKYLGINKDL
FT                   YMANIMQNYEELQKCDTILGVYKRKIKQKTTNNTKTERQFQALVCDALAVPVRSGSCDA
FT                   CISIAVIHHFATAERRVEALQELARLLRPGGQALIYVWAMEQEYKNQKSKYLRGKRISQ
FT                   GDKDELNSATSTEEFLVNQTPEGVNEDPALSVNSSSITKEEEYKSRKVPNSELPIHINR
FT                   TCFHSQDVLVPWHLKRNPGKDKAIEPSGVAGCPDPSPVFHRYYHVFCDGELEASCQAVG
FT                   DVSILQSYYDQGNWCVVLQKV"
FT   assembly_gap    2655142..2655928
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    2664177..2664196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2700689..2700785
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    2761913..2761932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2783636..2784040
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    2787659..2787847
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   gene            2802411..2863890
FT                   /locus_tag="mCG_142425"
FT                   /note="gene_id=mCG142425.0"
FT   mRNA            join(2802411..2802658,2809135..2809363,2809771..2809871,
FT                   2811378..2811600,2862635..2862861,2863713..2863890)
FT                   /locus_tag="mCG_142425"
FT                   /product="mCG142425"
FT                   /note="gene_id=mCG142425.0 transcript_id=mCT180463.0
FT                   created on 11-FEB-2003"
FT   CDS             join(2811512..2811600,2862635..2862861,2863713..2863810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142425"
FT                   /product="mCG142425"
FT                   /note="gene_id=mCG142425.0 transcript_id=mCT180463.0
FT                   protein_id=mCP103385.0"
FT                   /db_xref="MGI:MGI:2149746"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5I9"
FT                   /protein_id="EDL09341.1"
FT                   /translation="MIARFRRPSRGFRGSSVLKESITDFYLQKRSHCWKSVLLIGREVA
FT                   PETEVATAARWTGSKKRRKTCSHLRNTQNPLMCKKIISGNLGNFLTGVKFLSLQQTSSD
FT                   QGIVRMNINHRGYPQRSGFKICLGRSDTKSIIC"
FT   assembly_gap    2827882..2832425
FT                   /estimated_length=4544
FT                   /gap_type="unknown"
FT   assembly_gap    2845726..2850327
FT                   /estimated_length=4602
FT                   /gap_type="unknown"
FT   assembly_gap    2852835..2852886
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    2857807..2857826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2861532..2861793
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    2869183..2869644
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    2875668..2875687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2897071..2897132
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2909736..2909866
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    2913961..2915484
FT                   /estimated_length=1524
FT                   /gap_type="unknown"
FT   assembly_gap    2922200..2928635
FT                   /estimated_length=6436
FT                   /gap_type="unknown"
FT   assembly_gap    2941702..2943421
FT                   /estimated_length=1720
FT                   /gap_type="unknown"
FT   assembly_gap    2944444..2945060
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    2947857..2947876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2949412..2949431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2953016..2953662
FT                   /estimated_length=647
FT                   /gap_type="unknown"
XX
CO   join(AAHY01030314.1:1..24802,gap(20),AAHY01030315.1:1..15880,gap(9896),
CO   AAHY01030316.1:1..25796,gap(3380),AAHY01030317.1:1..39751,gap(53),
CO   AAHY01030318.1:1..11259,gap(20),AAHY01030319.1:1..48659,gap(20),
CO   AAHY01030320.1:1..6352,gap(20),AAHY01030321.1:1..20259,gap(433),
CO   AAHY01030322.1:1..21631,gap(4448),AAHY01030323.1:1..51471,gap(183),
CO   AAHY01030324.1:1..24597,gap(76),AAHY01030325.1:1..79979,gap(20),
CO   AAHY01030326.1:1..24840,gap(20),AAHY01030327.1:1..37107,gap(59),
CO   AAHY01030328.1:1..1609,gap(272),AAHY01030329.1:1..1433,gap(20),
CO   AAHY01030330.1:1..29649,gap(20),AAHY01030331.1:1..37424,gap(20),
CO   AAHY01030332.1:1..2323,gap(188),complement(AAHY01030333.1:1..13292),
CO   gap(113),AAHY01030334.1:1..136462,gap(20),AAHY01030335.1:1..57716,
CO   gap(3112),AAHY01030336.1:1..26995,gap(20),AAHY01030337.1:1..2190,gap(20),
CO   AAHY01030338.1:1..1458,gap(207),AAHY01030339.1:1..7751,gap(20),
CO   AAHY01030340.1:1..3559,gap(20),AAHY01030341.1:1..6693,gap(20),
CO   AAHY01030342.1:1..153379,gap(134),complement(AAHY01030343.1:1..3518),
CO   gap(20),complement(AAHY01030344.1:1..1192),gap(1337),
CO   AAHY01030345.1:1..19572,gap(20),AAHY01030346.1:1..11879,gap(20),
CO   AAHY01030347.1:1..6253,gap(618),AAHY01030348.1:1..76226,gap(497),
CO   AAHY01030349.1:1..49968,gap(181),complement(AAHY01030350.1:1..11134),
CO   gap(20),AAHY01030351.1:1..19996,gap(20),AAHY01030352.1:1..6214,gap(186),
CO   complement(AAHY01030353.1:1..1736),gap(287),AAHY01030354.1:1..19098,
CO   gap(3041),AAHY01030355.1:1..32831,gap(20),AAHY01030356.1:1..43146,
CO   gap(5689),AAHY01030357.1:1..21961,gap(20),AAHY01030358.1:1..10288,gap(20),
CO   AAHY01030359.1:1..10285,gap(20),AAHY01030360.1:1..50292,gap(20),
CO   AAHY01030361.1:1..62644,gap(20),AAHY01030362.1:1..13711,gap(20),
CO   AAHY01030363.1:1..23797,gap(147),complement(AAHY01030364.1:1..6397),
CO   gap(277),AAHY01030365.1:1..55549,gap(20),AAHY01030366.1:1..4770,gap(20),
CO   AAHY01030367.1:1..3647,gap(29),AAHY01030368.1:1..3565,gap(5645),
CO   AAHY01030369.1:1..73588,gap(70),AAHY01030370.1:1..6543,gap(75),
CO   complement(AAHY01030371.1:1..3694),gap(2118),AAHY01030372.1:1..3396,
CO   gap(20),complement(AAHY01030373.1:1..4995),gap(50),
CO   complement(AAHY01030374.1:1..3859),gap(2035),AAHY01030375.1:1..24860,
CO   gap(20),complement(AAHY01030376.1:1..11273),gap(7823),
CO   complement(AAHY01030377.1:1..9894),gap(150),AAHY01030378.1:1..78934,
CO   gap(183),complement(AAHY01030379.1:1..3099),gap(181),
CO   AAHY01030380.1:1..9671,gap(28),AAHY01030381.1:1..32078,gap(20),
CO   complement(AAHY01030382.1:1..22025),gap(3530),AAHY01030383.1:1..28261,
CO   gap(520),AAHY01030384.1:1..7286,gap(20),AAHY01030385.1:1..9817,gap(179),
CO   complement(AAHY01030386.1:1..508),gap(261),AAHY01030387.1:1..30886,gap(20),
CO   AAHY01030388.1:1..9319,gap(20),AAHY01030389.1:1..68358,gap(20),
CO   AAHY01030390.1:1..1268,gap(20),AAHY01030391.1:1..18845,gap(20),
CO   AAHY01030392.1:1..29734,gap(20),AAHY01030393.1:1..26598,gap(20),
CO   AAHY01030394.1:1..4760,gap(1156),complement(AAHY01030395.1:1..22692),
CO   gap(94),AAHY01030396.1:1..30112,gap(1544),AAHY01030397.1:1..2456,gap(2049),
CO   AAHY01030398.1:1..38799,gap(20),AAHY01030399.1:1..18656,gap(81),
CO   AAHY01030400.1:1..15941,gap(20),AAHY01030401.1:1..969,gap(2184),
CO   AAHY01030402.1:1..1387,gap(345),AAHY01030403.1:1..52175,gap(2789),
CO   complement(AAHY01030404.1:1..958),gap(1717),AAHY01030405.1:1..63356,
CO   gap(20),AAHY01030406.1:1..5044,gap(20),AAHY01030407.1:1..15409,gap(1890),
CO   AAHY01030408.1:1..66693,gap(140),AAHY01030409.1:1..38525,gap(411),
CO   AAHY01030410.1:1..18949,gap(318),AAHY01030411.1:1..39625,gap(20),
CO   AAHY01030412.1:1..28197,gap(20),AAHY01030413.1:1..43915,gap(331),
CO   complement(AAHY01030414.1:1..7766),gap(601),AAHY01030415.1:1..61722,
CO   gap(787),AAHY01030416.1:1..8248,gap(20),AAHY01030417.1:1..36492,gap(97),
CO   AAHY01030418.1:1..61127,gap(20),AAHY01030419.1:1..21703,gap(405),
CO   AAHY01030420.1:1..3618,gap(189),AAHY01030421.1:1..40034,gap(4544),
CO   AAHY01030422.1:1..13300,gap(4602),AAHY01030423.1:1..2507,gap(52),
CO   AAHY01030424.1:1..4920,gap(20),AAHY01030425.1:1..3705,gap(262),
CO   complement(AAHY01030426.1:1..7389),gap(462),
CO   complement(AAHY01030427.1:1..6023),gap(20),AAHY01030428.1:1..21383,gap(62),
CO   AAHY01030429.1:1..12603,gap(131),AAHY01030430.1:1..4094,gap(1524),
CO   AAHY01030431.1:1..6715,gap(6436),AAHY01030432.1:1..13066,gap(1720),
CO   AAHY01030433.1:1..1022,gap(617),complement(AAHY01030434.1:1..2796),gap(20),
CO   AAHY01030435.1:1..1535,gap(20),AAHY01030436.1:1..3584,gap(647),
CO   AAHY01030437.1:1..2948)
//