spacer

EBI Dbfetch

ID   CH466635; SV 1; linear; genomic DNA; CON; MUS; 3006770 BP.
XX
AC   CH466635;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009837681 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3006770
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-3006770
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 72a914d7768c90d6743789d7fd74ff62.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000220.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3006770
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    6437..7894
FT                   /estimated_length=1458
FT                   /gap_type="unknown"
FT   assembly_gap    9363..9382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10513..10532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12927..12946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14617..31941
FT                   /estimated_length=17325
FT                   /gap_type="unknown"
FT   gene            36254..37350
FT                   /pseudo
FT                   /locus_tag="mCG_1039701"
FT                   /note="gene_id=mCG1039701.1"
FT   mRNA            36254..37350
FT                   /pseudo
FT                   /locus_tag="mCG_1039701"
FT                   /note="gene_id=mCG1039701.1 transcript_id=mCT157405.1
FT                   created on 26-NOV-2002"
FT   assembly_gap    67294..67807
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    70468..71739
FT                   /estimated_length=1272
FT                   /gap_type="unknown"
FT   assembly_gap    103591..103610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    108104..108123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    140230..140274
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    165329..165767
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    199658..199677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    253769..253788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    265086..265105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    275797..276082
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    285720..285853
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    330874..331223
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    358308..358627
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    368007..368512
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    369545..369661
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    390427..390446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(452331..453404)
FT                   /locus_tag="mCG_53609"
FT                   /note="gene_id=mCG53609.1"
FT   mRNA            complement(join(452331..453050,453238..453404))
FT                   /locus_tag="mCG_53609"
FT                   /product="mCG53609"
FT                   /note="gene_id=mCG53609.1 transcript_id=mCT53792.1 created
FT                   on 07-NOV-2002"
FT   CDS             complement(452564..453022)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53609"
FT                   /product="mCG53609"
FT                   /note="gene_id=mCG53609.1 transcript_id=mCT53792.1
FT                   protein_id=mCP35199.2"
FT                   /protein_id="EDL38693.1"
FT                   /translation="MEKGKKMMQSFPGFVKDTSDIEENALQSPLVLPAQNTRCSKSETL
FT                   CLSKEQSHCSEDGWVLEWEICVFESVNYLDFYHKFNCAMKKSTEVFQSECQRKSQVSPG
FT                   DVENDKDKDTEELDQPSPSLLREKGWKLRPVMVETALTRILLLTVPGT"
FT   gene            480818..682685
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /note="gene_id=mCG115650.1"
FT   mRNA            join(480818..481306,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624861,641592..641696,
FT                   642750..642819,646766..646910,656843..657065,
FT                   659639..659727,661993..662034,664678..664835,
FT                   667583..667647,671351..671490,678616..682685)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT116758"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT116758.1
FT                   created on 04-JUN-2003"
FT   mRNA            join(481152..481321,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624866,641582..641696,
FT                   642750..642819,646766..646910,653022..653432)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT185147"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT185147.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(<481200..481321,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624866,641582..641696,
FT                   642750..642819,646766..646910,656843..657065,
FT                   659639..659727,661993..662034,664678..664835,
FT                   667583..667647,671351..671490,678616..680797)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT193703"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT193703.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<545611..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624866,641582..641696,642750..642819,
FT                   646766..646910,656843..657065,659639..659727,
FT                   661993..662034,664678..664835,667583..667647,
FT                   671351..671490,678616..679041)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_c"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT193703.0
FT                   protein_id=mCP114676.0 isoform=CRA_c"
FT                   /protein_id="EDL38696.1"
FT                   /translation="QCLKNKIFIMNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTE
FT                   TSKQNIPRLKLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSL
FT                   VDLNKNFKKIYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPL
FT                   CGYIDLGANKEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDT
FT                   AFTRSLGLMQDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGS
FT                   TSDRSILSRVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLL
FT                   PTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRI
FT                   PYPRPGTCPSKTYDPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRL
FT                   TQIVVDHVVAEDGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFKHPTAILN
FT                   MELSLKQQQLYVGSWDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACSRYAPTSK
FT                   RRARRQDVKYGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQASVEWYI
FT                   QRSGDEHREELKPDERIIKTDYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIE
FT                   NEQMENTQRAEYQEGQVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWYKEKRRQRN
FT                   KGSPKWKHMQEMKKKRNRRHHRDLDELQRSVAT"
FT   CDS             join(545638..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624861,641592..641696,642750..642819,
FT                   646766..646910,656843..657065,659639..659727,
FT                   661993..662034,664678..664835,667583..667647,
FT                   671351..671490,678616..679041)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_a"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT116758.1
FT                   protein_id=mCP70710.1 isoform=CRA_a"
FT                   /protein_id="EDL38694.1"
FT                   /translation="MNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTETSKQNIPRL
FT                   KLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSLVDLNKNFKK
FT                   IYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPLCGYIDLGAN
FT                   KEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDTAFTRSLGLM
FT                   QDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDRSILSR
FT                   VGRVCGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPVVYGVF
FT                   TTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYD
FT                   PLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRLTQIVVDHVVAEDGQ
FT                   YDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFKHPTAILNMELSLKQQQLYVGS
FT                   WDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPI
FT                   TQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQASVEWYIQRSGDEHREELKPD
FT                   ERIIKTDYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEYQE
FT                   GQVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWYKEKRRQRNKGSPKWKHMQEMKK
FT                   KRNRRHHRDLDELQRSVAT"
FT   CDS             join(545638..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624866,641582..641696,642750..642819,
FT                   646766..646910,653022..653042)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_b"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT185147.0
FT                   protein_id=mCP106405.0 isoform=CRA_b"
FT                   /protein_id="EDL38695.1"
FT                   /translation="MNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTETSKQNIPRL
FT                   KLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSLVDLNKNFKK
FT                   IYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPLCGYIDLGAN
FT                   KEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDTAFTRSLGLM
FT                   QDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDRSILSR
FT                   VGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPV
FT                   VYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTAD
FT                   TAQL"
FT   assembly_gap    550044..550063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    551651..552458
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   assembly_gap    571369..571388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    572581..572600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    573910..573929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(579345..580152)
FT                   /pseudo
FT                   /locus_tag="mCG_18161"
FT                   /note="gene_id=mCG18161.0"
FT   mRNA            complement(579345..580152)
FT                   /pseudo
FT                   /locus_tag="mCG_18161"
FT                   /note="gene_id=mCG18161.0 transcript_id=mCT20591.0 created
FT                   on 06-NOV-2002"
FT   assembly_gap    584296..584449
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    601315..601809
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    604763..604974
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    611068..611087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    618597..619578
FT                   /estimated_length=982
FT                   /gap_type="unknown"
FT   assembly_gap    623286..623498
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    632337..632647
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    642133..642152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    643281..643300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    687598..687617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    808556..808575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    809847..809952
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    832859..835142
FT                   /estimated_length=2284
FT                   /gap_type="unknown"
FT   assembly_gap    837311..837330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    854289..854308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    862526..862545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    867437..871655
FT                   /estimated_length=4219
FT                   /gap_type="unknown"
FT   assembly_gap    873439..873485
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    875765..876786
FT                   /estimated_length=1022
FT                   /gap_type="unknown"
FT   assembly_gap    884148..884786
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    885744..885763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    905765..905953
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    906940..906959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    947769..947788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980997..981016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    987647..987670
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    989425..989445
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    990291..990443
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    999286..999305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1001490..1001509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1004045..1004606
FT                   /locus_tag="mCG_1039706"
FT                   /note="gene_id=mCG1039706.0"
FT   mRNA            join(<1004045..1004471,1004495..1004606)
FT                   /locus_tag="mCG_1039706"
FT                   /product="mCG1039706"
FT                   /note="gene_id=mCG1039706.0 transcript_id=mCT157410.0
FT                   created on 26-NOV-2002"
FT   CDS             1004045..1004230
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039706"
FT                   /product="mCG1039706"
FT                   /note="gene_id=mCG1039706.0 transcript_id=mCT157410.0
FT                   protein_id=mCP70723.0"
FT                   /protein_id="EDL38697.1"
FT                   /translation="MNSAADLLGPYVCVERGLSTRVGKAWMMTDRHTRRRVCVESECNF
FT                   TTEHQTFYAEDNKEVG"
FT   assembly_gap    1023164..1023183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1030474..1030493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1037571..1037994
FT                   /locus_tag="mCG_1039710"
FT                   /note="gene_id=mCG1039710.0"
FT   mRNA            join(<1037571..1037850,1037865..1037994)
FT                   /locus_tag="mCG_1039710"
FT                   /product="mCG1039710"
FT                   /note="gene_id=mCG1039710.0 transcript_id=mCT157414.0
FT                   created on 26-NOV-2002"
FT   CDS             join(<1037571..1037850,1037865..1037896)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039710"
FT                   /product="mCG1039710"
FT                   /note="gene_id=mCG1039710.0 transcript_id=mCT157414.0
FT                   protein_id=mCP70730.0"
FT                   /protein_id="EDL38698.1"
FT                   /translation="RYQPIKLSFIRLRCLLFKAYIAGNMGGVKGELYKEQRSGHLLTWG
FT                   PKSGARQRALWILSLEHRSSLTALGVRLGSGVTHVLGWHGNSGRDREEALQPQVPRKE"
FT   assembly_gap    1055556..1055575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1077606..1077625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1134141..1134469
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   gene            complement(1139490..1140746)
FT                   /pseudo
FT                   /locus_tag="mCG_115979"
FT                   /note="gene_id=mCG115979.1"
FT   mRNA            complement(1139490..1140746)
FT                   /pseudo
FT                   /locus_tag="mCG_115979"
FT                   /note="gene_id=mCG115979.1 transcript_id=mCT117094.1
FT                   created on 23-MAY-2003"
FT   assembly_gap    1145396..1145548
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    1147700..1147748
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            1178000..1180134
FT                   /pseudo
FT                   /locus_tag="mCG_50800"
FT                   /note="gene_id=mCG50800.1"
FT   mRNA            join(1178000..1178155,1178545..1180134)
FT                   /pseudo
FT                   /locus_tag="mCG_50800"
FT                   /note="gene_id=mCG50800.1 transcript_id=mCT50983.1 created
FT                   on 25-NOV-2002"
FT   assembly_gap    1187586..1188708
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    1191908..1191927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1218637..1219586)
FT                   /locus_tag="mCG_115977"
FT                   /note="gene_id=mCG115977.1"
FT   mRNA            complement(1218637..1219586)
FT                   /locus_tag="mCG_115977"
FT                   /product="mCG115977"
FT                   /note="gene_id=mCG115977.1 transcript_id=mCT117092.1
FT                   created on 25-NOV-2002"
FT   CDS             complement(1219199..1219516)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115977"
FT                   /product="mCG115977"
FT                   /note="gene_id=mCG115977.1 transcript_id=mCT117092.1
FT                   protein_id=mCP70711.0"
FT                   /db_xref="GOA:G3UWG1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="MGI:MGI:3642431"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWG1"
FT                   /protein_id="EDL38699.1"
FT                   /translation="MSDVEKGKKIFVQKYAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA
FT                   GFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN
FT                   E"
FT   gene            <1223235..1394506
FT                   /locus_tag="mCG_145594"
FT                   /note="gene_id=mCG145594.0"
FT   mRNA            join(<1223235..1223519,1331190..1331271,1392278..1394506)
FT                   /locus_tag="mCG_145594"
FT                   /product="mCG145594"
FT                   /note="gene_id=mCG145594.0 transcript_id=mCT185018.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1227965..1228062
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    1238251..1238270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1239944..1239963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1241116..1241135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1245718..1245745
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1261452..1261471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1266869..1267218
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    1293107..1294299
FT                   /estimated_length=1193
FT                   /gap_type="unknown"
FT   assembly_gap    1383394..1383413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <1392590..1392823
FT                   /codon_start=1
FT                   /locus_tag="mCG_145594"
FT                   /product="mCG145594"
FT                   /note="gene_id=mCG145594.0 transcript_id=mCT185018.0
FT                   protein_id=mCP106288.0"
FT                   /protein_id="EDL38700.1"
FT                   /translation="TSESILDFYCYYYCCCCYSSRLGISLGSPLFQGLLNSGSCNVGRL
FT                   PFRGILWLTFPFCISWGTYGYYQSGSIQRLRG"
FT   assembly_gap    1434369..1434658
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    1464403..1464422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1498413..1499852
FT                   /estimated_length=1440
FT                   /gap_type="unknown"
FT   gene            1500675..1709509
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /note="gene_id=mCG16225.2"
FT   mRNA            join(1500675..1501437,1552419..1552576,1556859..1556921,
FT                   1574601..1574720,1617415..1617508,1624263..1624382,
FT                   1655856..1655998,1656338..1656452,1656599..1656668,
FT                   1661098..1661242,1665085..1665304,1669481..1669572,
FT                   1684488..1684529,1687898..1688055,1692013..1692080,
FT                   1704445..1704587,1706093..1709509)
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3A"
FT                   /note="gene_id=mCG16225.2 transcript_id=mCT16413.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(1501326..1501437,1552419..1552576,1556859..1556921,
FT                   1574601..1574720,1617415..1617508,1624263..1624382,
FT                   1655856..1655998,1656338..1656452,1656599..1656668,
FT                   1661098..1661242,1665085..1665304,1669481..1669572,
FT                   1684488..1684529,1687898..1688055,1692013..1692080,
FT                   1704445..1704587,1706093..1706548)
FT                   /codon_start=1
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3A"
FT                   /note="gene_id=mCG16225.2 transcript_id=mCT16413.2
FT                   protein_id=mCP14037.1"
FT                   /protein_id="EDL38701.1"
FT                   /translation="MGWFTGIACLFWGVLLTARANYANGKNNVPRLKLSYKEMLESNNV
FT                   ITFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECK
FT                   WAGKDILKECANFIKVLEAYNQTHLYACGTGAFHPICTYIEVGHHPEDNIFKLQDSHFE
FT                   NGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLN
FT                   DPRFISAHLIPESDNPEDDKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVN
FT                   KWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAV
FT                   CMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDV
FT                   ITFARSHPAMYNPVFPINNRPIMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTV
FT                   LKVVSVPKETWHDLEEVLLEEMTVFREPTTISAMELSTKQQQLYIGSTAGVAQLPLHRC
FT                   DIYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNH
FT                   HGPSLEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEDRKEEIRMGDHIIRTEQGL
FT                   LLRSLQKKDSGNYLCHAVEHGFMQTLLKVTLEVIDTEHLEELLHKDDDGDGSKIKEMSS
FT                   SMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHSQGSSNKWKHMQE
FT                   SKKGRNRRTHEFERAPRSV"
FT   assembly_gap    1674012..1681702
FT                   /estimated_length=7691
FT                   /gap_type="unknown"
FT   assembly_gap    1784898..1784917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1786210..1786229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1788972..1788991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1790569..1790588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1816736..1816755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1817749..1817918
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    1826115..1826873
FT                   /estimated_length=759
FT                   /gap_type="unknown"
FT   assembly_gap    1833545..1834378
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   gene            complement(1851283..>1916160)
FT                   /locus_tag="mCG_145013"
FT                   /note="gene_id=mCG145013.0"
FT   mRNA            complement(join(1851283..1851984,1910809..1911021,
FT                   1916015..>1916160))
FT                   /locus_tag="mCG_145013"
FT                   /product="mCG145013"
FT                   /note="gene_id=mCG145013.0 transcript_id=mCT184437.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1855625..1855644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1861737..1866859
FT                   /estimated_length=5123
FT                   /gap_type="unknown"
FT   assembly_gap    1868570..1868589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1870340..1871527
FT                   /locus_tag="mCG_1039702"
FT                   /note="gene_id=mCG1039702.1"
FT   mRNA            1870340..1871527
FT                   /locus_tag="mCG_1039702"
FT                   /product="mCG1039702"
FT                   /note="gene_id=mCG1039702.1 transcript_id=mCT157406.1
FT                   created on 26-NOV-2002"
FT   CDS             1870375..1871088
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039702"
FT                   /product="mCG1039702"
FT                   /note="gene_id=mCG1039702.1 transcript_id=mCT157406.1
FT                   protein_id=mCP70728.0"
FT                   /protein_id="EDL38703.1"
FT                   /translation="MDALKDSDLLHWKHSLWELFDIRIAQKTAIWRLYGRSTMVLHHQA
FT                   QMLLSMNSLESLNAGVHQNNTESFTFALYHLAELHAEKVCFAAAGEVLKHLKDRFPPNS
FT                   QHAQKWMLCDQKIQFDRAMNDGKFHLADSLVTGITVLNGIEGVYRKAVVLQAQNQMTEA
FT                   HKLLQKLLTYCQKLKNTEIVISVLLSVAELYWRSFVPDYRHAWAPGSSGPLQRIPITVL
FT                   GLRNCAQLGLCPVHP"
FT   assembly_gap    1872029..1875521
FT                   /estimated_length=3493
FT                   /gap_type="unknown"
FT   gene            <1876138..>1877950
FT                   /locus_tag="mCG_68112"
FT                   /note="gene_id=mCG68112.2"
FT   mRNA            join(<1876138..1876289,1876920..1877097,1877789..>1877950)
FT                   /locus_tag="mCG_68112"
FT                   /product="mCG68112"
FT                   /note="gene_id=mCG68112.2 transcript_id=mCT68297.2 created
FT                   on 27-NOV-2002"
FT   CDS             join(<1876138..1876289,1876920..1877097,1877789..1877950)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68112"
FT                   /product="mCG68112"
FT                   /note="gene_id=mCG68112.2 transcript_id=mCT68297.2
FT                   protein_id=mCP43395.2"
FT                   /protein_id="EDL38704.1"
FT                   /translation="RTRPLEKLNPLYELLKLKNMKVRSSVYKSLSKLIEAQENMDKLNQ
FT                   EINFYSNLHSQLMVEKNLNMSITQKRESEEVQIALALIEKYLVDLNLNGKDEQEQTSNH
FT                   ETQQLQDSETPARAEISTSQEESLLHNEFPLQEPPAELHPQHPQSILNESSYIQYIYAV
FT                   "
FT   assembly_gap    1882714..1883816
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   gene            1898453..1903622
FT                   /locus_tag="mCG_16226"
FT                   /note="gene_id=mCG16226.1"
FT   mRNA            join(1898453..1898612,1900002..1900161,1901421..1901570,
FT                   1902200..1902380,1903094..1903622)
FT                   /locus_tag="mCG_16226"
FT                   /product="mCG16226"
FT                   /note="gene_id=mCG16226.1 transcript_id=mCT16412.1 created
FT                   on 25-NOV-2002"
FT   CDS             join(1898606..1898612,1900002..1900161,1901421..1901570,
FT                   1902200..1902380,1903094..1903222)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16226"
FT                   /product="mCG16226"
FT                   /note="gene_id=mCG16226.1 transcript_id=mCT16412.1
FT                   protein_id=mCP14038.2"
FT                   /protein_id="EDL38705.1"
FT                   /translation="MWSARRHTSSIAPELSEKEFKMEMERLTTELHLITQKRNEQRDRL
FT                   ISFQEGSMKKRTKPIQKKNPFYEQLSLKKNQLMSSVNNLELEIIELQENIQELKKEINF
FT                   YSNLHSQLMVEKNLTKMSVTQKGESKEVQIDWALIEKYLVDVNLSGKDKQEQTSNQETQ
FT                   QLQDSATPARAEMSTSQEESLLHNEFLPQEPPAALHPQHPQSTLD"
FT   assembly_gap    1906651..1907117
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    1908552..1908571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1910923..1911021,1916015..>1916158))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145013"
FT                   /product="mCG145013"
FT                   /note="gene_id=mCG145013.0 transcript_id=mCT184437.0
FT                   protein_id=mCP106287.0"
FT                   /protein_id="EDL38702.1"
FT                   /translation="ELRLMVGSNCQLLATPPKELSLEIPVHKCLLTTGTVSGLATADRM
FT                   DPQGEWCYLDLWPFWNRCITVAAGFNILALAPWRL"
FT   gene            <1919022..1922618
FT                   /locus_tag="mCG_22198"
FT                   /note="gene_id=mCG22198.1"
FT   mRNA            join(<1919022..1919181,1920438..1920587,1921216..1921396,
FT                   1922109..1922618)
FT                   /locus_tag="mCG_22198"
FT                   /product="mCG22198"
FT                   /note="gene_id=mCG22198.1 transcript_id=mCT20762.1 created
FT                   on 25-NOV-2002"
FT   CDS             join(<1919024..1919181,1920438..1920587,1921216..1921396,
FT                   1922109..1922237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22198"
FT                   /product="mCG22198"
FT                   /note="gene_id=mCG22198.1 transcript_id=mCT20762.1
FT                   protein_id=mCP8664.1"
FT                   /protein_id="EDL38706.1"
FT                   /translation="ARRHTSSSAPDLSKKEFKKEKERLTTELHLITQKRNEQRDRLISF
FT                   QEGSMKKRTKPTQKKNPFCEQLSLKKNQLMSSVNNLELEIIELQENIQELKKETNFYSN
FT                   LHSQLMVEKNLTKMSVTQKGESEKVQIDWALIEKYLVDVNLSGKDKQEQTSNHETQQLQ
FT                   DSETPARAEMSTSHEESLLHNEFPPQEPPAELHAQYPQSTLD"
FT   assembly_gap    1940429..1940448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1946117..>1947786)
FT                   /locus_tag="mCG_60047"
FT                   /note="gene_id=mCG60047.1"
FT   mRNA            complement(join(1946117..1946845,1947089..1947389,
FT                   1947427..>1947786))
FT                   /locus_tag="mCG_60047"
FT                   /product="mCG60047"
FT                   /note="gene_id=mCG60047.1 transcript_id=mCT60230.2 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1946445..1946845,1947089..1947389,
FT                   1947427..1947786))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60047"
FT                   /product="mCG60047"
FT                   /note="gene_id=mCG60047.1 transcript_id=mCT60230.2
FT                   protein_id=mCP30959.2"
FT                   /protein_id="EDL38707.1"
FT                   /translation="MAILIAGESVFQLSIAIFTYLLSNKLEKRTVQLEIVSKKAEELAV
FT                   QQQEIGVLREEVAKILQRLERQAAEEERERKELNCKPEMPDKIEDQERQPIGPTEPTFK
FT                   ETEASPPARLCSPAPLKLLIQIIRKPDCEKHSWYCKSPQLKQKDPQVSPPLLPCFLTSD
FT                   NDARLAGSSDHTYSSVTKVERFQEIRKIPYELDLKNEPGRDDLKHTVIDGSNVAITHDK
FT                   TGGIIVTNDNLREFVTESVSWREISKTRLLPYTFVGDIFMVPNDPLGRNLWDGPRLDEF
FT                   LQKETFLRDIHPRIIAQPSMDTSGLGFRSHNTQGVNTSHEAPPWIHRAASNPSSAAPFH
FT                   IHGHPSKNAAEPF"
FT   assembly_gap    1949264..1949283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1968070..1968089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1974712..>1975523
FT                   /locus_tag="mCG_1039705"
FT                   /note="gene_id=mCG1039705.1"
FT   mRNA            join(<1974712..1974808,1975028..>1975523)
FT                   /locus_tag="mCG_1039705"
FT                   /product="mCG1039705"
FT                   /note="gene_id=mCG1039705.1 transcript_id=mCT157409.1
FT                   created on 25-NOV-2002"
FT   CDS             <1975089..>1975523
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039705"
FT                   /product="mCG1039705"
FT                   /note="gene_id=mCG1039705.1 transcript_id=mCT157409.1
FT                   protein_id=mCP70722.1"
FT                   /protein_id="EDL38708.1"
FT                   /translation="EFVTESVSWREISKTRLLPYTFMGDIFMVPDDPLGRNGPRHDEFF
FT                   QKETFLRDMHPRINAQPSVDTSGPGFRSHNTQGVNTSHEAPPWTHRAASNPWLPQQPHS
FT                   TSMATFPRMQQNLSELAQRSSAETSELREVLLNIFPDSEQK"
FT   gene            1976966..>1977647
FT                   /locus_tag="mCG_22199"
FT                   /note="gene_id=mCG22199.2"
FT   mRNA            join(1976966..1977154,1977216..>1977647)
FT                   /locus_tag="mCG_22199"
FT                   /product="mCG22199"
FT                   /note="gene_id=mCG22199.2 transcript_id=mCT20763.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(1977032..1977154,1977216..>1977647)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22199"
FT                   /product="mCG22199"
FT                   /note="gene_id=mCG22199.2 transcript_id=mCT20763.2
FT                   protein_id=mCP8665.2"
FT                   /protein_id="EDL38709.1"
FT                   /translation="MMTFSGLNRGFPYACYSSQRGAQATIATLHNHQLRPSCQLLLKLL
FT                   SLLLALKPFGPCLQEMLLLLPSPGSVPSLIALLKFSTYRAAAMAKRAVVEGQSRLCGEQ
FT                   VAVEWLKTDLKQHFRQQLAGPSLWFLRPDVSQLTQTRKKLGSQGARAALQLLCQRMKLG
FT                   SPVFLTKYLGTGPAGWHHFWYQ"
FT   assembly_gap    1990376..1990911
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    2011337..2012636
FT                   /estimated_length=1300
FT                   /gap_type="unknown"
FT   assembly_gap    2028508..2028671
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2045013..2045160
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    2061625..2061644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2106342..2106361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2111483..2111660
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            <2126817..2356068
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /note="gene_id=mCG141425.0"
FT   mRNA            join(<2126817..2126931,2245768..2245928,2264062..2264121,
FT                   2265933..2266052,2312062..2312155,2326050..2326169,
FT                   2327316..2327458,2328179..2328293,2328398..2328467,
FT                   2331852..2331996,2333741..2333963,2335371..2335462,
FT                   2337788..2337829,2338013..2338179,2342324..2342391,
FT                   2342717..2342856,2354092..2356068)
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3E"
FT                   /note="gene_id=mCG141425.0 transcript_id=mCT175269.0
FT                   created on 30-OCT-2002"
FT   CDS             join(2126817..2126931,2245768..2245928,2264062..2264121,
FT                   2265933..2266052,2312062..2312155,2326050..2326169,
FT                   2327316..2327458,2328179..2328293,2328398..2328467,
FT                   2331852..2331996,2333741..2333963,2335371..2335462,
FT                   2337788..2337829,2338013..2338179,2342324..2342391,
FT                   2342717..2342856,2354092..2354544)
FT                   /codon_start=1
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3E"
FT                   /note="gene_id=mCG141425.0 transcript_id=mCT175269.0
FT                   protein_id=mCP98188.0"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="EDL38710.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
FT   assembly_gap    2200213..2200271
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    2228341..2228428
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2242370..2242389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2249978..2249997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2276025..2276177
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    2277083..2281058
FT                   /estimated_length=3976
FT                   /gap_type="unknown"
FT   assembly_gap    2304576..2304666
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    2306793..2306812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2356111..2358449
FT                   /locus_tag="mCG_148351"
FT                   /note="gene_id=mCG148351.0"
FT   mRNA            2356111..2358449
FT                   /locus_tag="mCG_148351"
FT                   /product="mCG148351"
FT                   /note="gene_id=mCG148351.0 transcript_id=mCT188614.0
FT                   created on 13-JAN-2004"
FT   CDS             2356765..2357160
FT                   /codon_start=1
FT                   /locus_tag="mCG_148351"
FT                   /product="mCG148351"
FT                   /note="gene_id=mCG148351.0 transcript_id=mCT188614.0
FT                   protein_id=mCP108783.0"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CCK6"
FT                   /protein_id="EDL38711.1"
FT                   /translation="MIKFQGLGYNSRESSKLYINMYLYIHIVMYYTSSCTPISGKKTGN
FT                   RHRQAARETDRLGVREKERERERERASTGSQGITDVPLSLSLFPLTILACRSPRSIRCI
FT                   TKPFQSSCQQNTNLQKQKCFENLNPAT"
FT   assembly_gap    2365703..2365827
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    2371361..2376447
FT                   /estimated_length=5087
FT                   /gap_type="unknown"
FT   assembly_gap    2387857..2387876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2389108..2389127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2390515..2390534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2392230..2392249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2393374..2393393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2410178..2410197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2411779..2411829
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    2422308..2422327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2423497..2423516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2484215..2486256
FT                   /estimated_length=2042
FT                   /gap_type="unknown"
FT   assembly_gap    2488641..2488660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2492700..2493349
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    2494549..2494905
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    2501269..2506954
FT                   /estimated_length=5686
FT                   /gap_type="unknown"
FT   assembly_gap    2522002..2522023
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    2543603..2543622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2558154..2558173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2596950..2597025
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    2610401..2610420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2620754..2902833
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /note="gene_id=mCG141424.0"
FT   mRNA            join(<2620754..2621297,2626679..2627792,2627884..2628161,
FT                   2645248..2646639,2772189..2772900,2778154..2781356,
FT                   2781468..2783250,2783607..2785624,2815606..2817787,
FT                   2822047..2822183,2827249..2827339,2854630..2854755,
FT                   2872044..2872152,2872689..2872756,2873617..2873831,
FT                   2877186..2877236,2882210..2882334,2885367..2885393,
FT                   2895211..2895304,2897201..2897272,2898753..2898933,
FT                   2900673..2902833)
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /product="piccolo (presynaptic cytomatrix protein)"
FT                   /note="gene_id=mCG141424.0 transcript_id=mCT175268.0
FT                   created on 30-OCT-2002"
FT   assembly_gap    2652413..2654342
FT                   /estimated_length=1930
FT                   /gap_type="unknown"
FT   assembly_gap    2692999..2693426
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    2711576..2711595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2712763..2712782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2750704..2750804
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2781357..2781467
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   CDS             join(<2781468..2783250,2783607..2785624,2815606..2817787,
FT                   2822047..2822183,2827249..2827339,2854630..2854755,
FT                   2872044..2872152,2872689..2872756,2873617..2873831,
FT                   2877186..2877236,2882210..2882334,2885367..2885393,
FT                   2895211..2895304,2897201..2897272,2898753..2898933,
FT                   2900673..2900884)
FT                   /codon_start=1
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /product="piccolo (presynaptic cytomatrix protein)"
FT                   /note="gene_id=mCG141424.0 transcript_id=mCT175268.0
FT                   protein_id=mCP98187.0"
FT                   /protein_id="EDL38712.1"
FT                   /translation="YPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKIC
FT                   AAAPPPVPPKPSSIPTGLVFTHRPEASKPPIAPKPAVPEIPVTTQKTTDTCPKPTGLPL
FT                   TSNMSLNLVTSADYKLPSPTSPLSPHSNKSSPRYSKSLMETYVVITLPSEPGTPTDSSA
FT                   AQAITSWPLGSPPKDLVSLETVFSVVPPMTSTEIPSASQPTLYTSGALGTFSVTPAVTA
FT                   SLFQTVPTSLTQFLPAEASKPEVSAVSSAVPSVAPRSVSIPIPPEPLALDRHQYKENGK
FT                   LPLIGDAIDLRTIPKSEVKVTEKCMDLSASAMDVKRQTTANEVYRRQISAVQPSIINLS
FT                   AASSLGTPVTMDSKTVAVVTCTDTTIYTTGTESQVGIEHAVTSPLQLTTSKHTELQYRK
FT                   PSSQAFPMIRDEAPINLSLGPSTQAVTLAVTKPVTVPPVGVTNGWTDSTISQGITDGEV
FT                   VDLSTSKSHRTVVTMDESTSNVVTKIIEDEEKPVDLTAGRRAVCCDMVYKLPFGRSCTA
FT                   QQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFD
FT                   YSGGTEAAVDLTSGRVSTGEVMDYSSKTTGPYPETRQVISGVGISTPQYSTARMTPPPG
FT                   PQYGVGSVLRSSNGVVYSSVATPIPSTFAITTQPGSIFSTTVRDLSGIHTTDAITSLSA
FT                   LHQSQPMPRSYFITTGASETDISVTSIDINASLQTITMETLPAETMDSVPTLTTASEVF
FT                   SEVVGEESTLLIVPDEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEK
FT                   IMVQKKLEELQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEE
FT                   QKLRQIYQYNYEPSGTASPQTTTEQAILEGQYVATEGSQFWATEDATTTASTVVAIEIP
FT                   QSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVRGQYDEMG
FT                   ESMADDPRNLKKIVDSGVQTDDEETADRTYASRRRRTKKSVDTSVQTDDEDQDEWDMPS
FT                   RSRRKARTGKYGDSTAEGDKTKPPSKVSSVAVQTVAEISVQTEPLGTIRTPSIRARVDA
FT                   KVEIIKHISAPEKTYKGGSLGCQTETDPDTQSPPYMGATSPPKDKKRPTPLEIGYSSSH
FT                   LRADPTVQLAPSPPKSPKVLYSPISPLSPGHALEPAFVPYEKPLPDDISPQKVLHPDMD
FT                   KVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYSEGFTAKGSQTTSGTQKKVKRT
FT                   LPNPPPEEASTGTQSTYSTMGTASRRRMCRTNTMARAKILQDIDRELDLVERESAKLRK
FT                   KQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSS
FT                   TRPSRVESQHGIERPRTAPQTEFSQFIPPQTQTEAQLVPPTSPYTQYQYSSPALPTQAP
FT                   TPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVI
FT                   QQKPRQTTLYLEPKITSTYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEER
FT                   SSMASSPISSISADSFYADIDHHTSRNYVLIDDIGDITKGTAALSSAFSLHEKDLSKTD
FT                   RLLRTTETRRSQEVTDFLAPLQTSSRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGT
FT                   ESLDHLAGLSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKAL
FT                   IDPKMSKFSPIQESRDLEPDYPTYLSSSTSSIGGISSRARLLQDDITFGLRKNITDQQK
FT                   FMGSSLGSGLGTLGNTIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSS
FT                   LRLKAQEAEALDVSFGHSSSSARTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMG
FT                   MARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSD
FT                   SEAYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQILQMNGKTMHY
FT                   IFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEHSGKL
FT                   IEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRLDLNMLSDSENPQHLELHEPP
FT                   KVVDKAKSPGVDPKQLAAELQKVSLQQSPLVMSSVVEKGAHAHSGPTSAGSSSVPSPGQ
FT                   PGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNG
FT                   YSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKK
FT                   TLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTESIEHGKSHSSQNSQ
FT                   QSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTS
FT                   VAQTHLEDAGAAIAAAEAAVQQLRIQPSKRRK"
FT   assembly_gap    2810513..2810584
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2811593..2811736
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    2825323..2825342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2844081..2844351
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    2862911..2862930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2864767..2864786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2882898..2882917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2890756..2890775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2895636..2895655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2915032..2915051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2943364..2943383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2949351..2949370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(AAHY01098208.1:1..6436,gap(1458),AAHY01098209.1:1..1468,gap(20),
CO   AAHY01098210.1:1..1130,gap(20),complement(AAHY01098211.1:1..2394),gap(20),
CO   AAHY01098212.1:1..1670,gap(17325),AAHY01098213.1:1..35352,gap(514),
CO   AAHY01098214.1:1..2660,gap(1272),AAHY01098215.1:1..31851,gap(20),
CO   AAHY01098216.1:1..4493,gap(20),AAHY01098217.1:1..32106,gap(45),
CO   complement(AAHY01098218.1:1..25054),gap(439),
CO   complement(AAHY01098219.1:1..33890),gap(20),AAHY01098220.1:1..54091,
CO   gap(20),complement(AAHY01098221.1:1..11297),gap(20),
CO   AAHY01098222.1:1..10691,gap(286),AAHY01098223.1:1..9637,gap(134),
CO   complement(AAHY01098224.1:1..45020),gap(350),AAHY01098225.1:1..27084,
CO   gap(320),AAHY01098226.1:1..9379,gap(506),AAHY01098227.1:1..1032,gap(117),
CO   AAHY01098228.1:1..20765,gap(20),AAHY01098229.1:1..159597,gap(20),
CO   AAHY01098230.1:1..1587,gap(808),AAHY01098231.1:1..18910,gap(20),
CO   complement(AAHY01098232.1:1..1192),gap(20),
CO   complement(AAHY01098233.1:1..1309),gap(20),AAHY01098234.1:1..10366,
CO   gap(154),AAHY01098235.1:1..16865,gap(495),
CO   complement(AAHY01098236.1:1..2953),gap(212),
CO   complement(AAHY01098237.1:1..6093),gap(20),AAHY01098238.1:1..7509,gap(982),
CO   AAHY01098239.1:1..3707,gap(213),complement(AAHY01098240.1:1..8838),
CO   gap(311),AAHY01098241.1:1..9485,gap(20),AAHY01098242.1:1..1128,gap(20),
CO   AAHY01098243.1:1..44297,gap(20),complement(AAHY01098244.1:1..120938),
CO   gap(20),complement(AAHY01098245.1:1..1271),gap(106),
CO   complement(AAHY01098246.1:1..22906),gap(2284),AAHY01098247.1:1..2168,
CO   gap(20),AAHY01098248.1:1..16958,gap(20),complement(AAHY01098249.1:1..8217),
CO   gap(20),AAHY01098250.1:1..4891,gap(4219),AAHY01098251.1:1..1783,gap(47),
CO   complement(AAHY01098252.1:1..2279),gap(1022),AAHY01098253.1:1..7361,
CO   gap(639),AAHY01098254.1:1..957,gap(20),AAHY01098255.1:1..20001,gap(189),
CO   AAHY01098256.1:1..986,gap(20),AAHY01098257.1:1..40809,gap(20),
CO   AAHY01098258.1:1..33208,gap(20),AAHY01098259.1:1..6630,gap(24),
CO   complement(AAHY01098260.1:1..1754),gap(21),
CO   complement(AAHY01098261.1:1..845),gap(153),AAHY01098262.1:1..8842,gap(20),
CO   AAHY01098263.1:1..2184,gap(20),AAHY01098264.1:1..21654,gap(20),
CO   AAHY01098265.1:1..7290,gap(20),AAHY01098266.1:1..25062,gap(20),
CO   AAHY01098267.1:1..22030,gap(20),AAHY01098268.1:1..56515,gap(329),
CO   AAHY01098269.1:1..10926,gap(153),AAHY01098270.1:1..2151,gap(49),
CO   AAHY01098271.1:1..39837,gap(1123),AAHY01098272.1:1..3199,gap(20),
CO   AAHY01098273.1:1..36037,gap(98),AAHY01098274.1:1..10188,gap(20),
CO   AAHY01098275.1:1..1673,gap(20),AAHY01098276.1:1..1152,gap(20),
CO   AAHY01098277.1:1..4582,gap(28),AAHY01098278.1:1..15706,gap(20),
CO   AAHY01098279.1:1..5397,gap(350),AAHY01098280.1:1..25888,gap(1193),
CO   AAHY01098281.1:1..89094,gap(20),AAHY01098282.1:1..50955,gap(290),
CO   AAHY01098283.1:1..29744,gap(20),AAHY01098284.1:1..33990,gap(1440),
CO   AAHY01098285.1:1..174159,gap(7691),AAHY01098286.1:1..103195,gap(20),
CO   complement(AAHY01098287.1:1..1292),gap(20),AAHY01098288.1:1..2742,gap(20),
CO   AAHY01098289.1:1..1577,gap(20),AAHY01098290.1:1..26147,gap(20),
CO   AAHY01098291.1:1..993,gap(170),AAHY01098292.1:1..8196,gap(759),
CO   AAHY01098293.1:1..6671,gap(834),AAHY01098294.1:1..21246,gap(20),
CO   AAHY01098295.1:1..6092,gap(5123),AAHY01098296.1:1..1710,gap(20),
CO   complement(AAHY01098297.1:1..3439),gap(3493),AAHY01098298.1:1..7192,
CO   gap(1103),AAHY01098299.1:1..22834,gap(467),
CO   complement(AAHY01098300.1:1..1434),gap(20),AAHY01098301.1:1..31857,gap(20),
CO   AAHY01098302.1:1..8815,gap(20),AAHY01098303.1:1..18786,gap(20),
CO   AAHY01098304.1:1..22286,gap(536),AAHY01098305.1:1..20425,gap(1300),
CO   AAHY01098306.1:1..15871,gap(164),AAHY01098307.1:1..16341,gap(148),
CO   AAHY01098308.1:1..16464,gap(20),AAHY01098309.1:1..44697,gap(20),
CO   AAHY01098310.1:1..5121,gap(178),AAHY01098311.1:1..88552,gap(59),
CO   AAHY01098312.1:1..28069,gap(88),complement(AAHY01098313.1:1..13941),
CO   gap(20),AAHY01098314.1:1..7588,gap(20),AAHY01098315.1:1..26027,gap(153),
CO   AAHY01098316.1:1..905,gap(3976),AAHY01098317.1:1..23517,gap(91),
CO   AAHY01098318.1:1..2126,gap(20),complement(AAHY01098319.1:1..58890),
CO   gap(125),complement(AAHY01098320.1:1..5533),gap(5087),
CO   AAHY01098321.1:1..11409,gap(20),complement(AAHY01098322.1:1..1231),gap(20),
CO   AAHY01098323.1:1..1387,gap(20),AAHY01098324.1:1..1695,gap(20),
CO   AAHY01098325.1:1..1124,gap(20),AAHY01098326.1:1..16784,gap(20),
CO   AAHY01098327.1:1..1581,gap(51),AAHY01098328.1:1..10478,gap(20),
CO   AAHY01098329.1:1..1169,gap(20),AAHY01098330.1:1..60698,gap(2042),
CO   AAHY01098331.1:1..2384,gap(20),complement(AAHY01098332.1:1..4039),gap(650),
CO   AAHY01098333.1:1..1199,gap(357),AAHY01098334.1:1..6363,gap(5686),
CO   AAHY01098335.1:1..15047,gap(22),complement(AAHY01098336.1:1..21579),
CO   gap(20),AAHY01098337.1:1..14531,gap(20),AAHY01098338.1:1..38776,gap(76),
CO   complement(AAHY01098339.1:1..13375),gap(20),
CO   complement(AAHY01098340.1:1..41992),gap(1930),AAHY01098341.1:1..38656,
CO   gap(428),complement(AAHY01098342.1:1..18149),gap(20),
CO   complement(AAHY01098343.1:1..1167),gap(20),AAHY01098344.1:1..37921,
CO   gap(101),AAHY01098345.1:1..30552,gap(111),AAHY01098346.1:1..29045,gap(72),
CO   complement(AAHY01098347.1:1..1008),gap(144),
CO   complement(AAHY01098348.1:1..13586),gap(20),AAHY01098349.1:1..18738,
CO   gap(271),complement(AAHY01098350.1:1..18559),gap(20),
CO   complement(AAHY01098351.1:1..1836),gap(20),AAHY01098352.1:1..18111,gap(20),
CO   complement(AAHY01098353.1:1..7838),gap(20),AAHY01098354.1:1..4860,gap(20),
CO   AAHY01098355.1:1..19376,gap(20),complement(AAHY01098356.1:1..28312),
CO   gap(20),complement(AAHY01098357.1:1..5967),gap(20),AAHY01098358.1:1..57400)
//


spacer
spacer