spacer

EBI Dbfetch

ID   CH466635; SV 1; linear; genomic DNA; CON; MUS; 3006770 BP.
XX
AC   CH466635;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009837681 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3006770
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-3006770
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 72a914d7768c90d6743789d7fd74ff62.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000220.
DR   Ensembl-Gn; ENSMUSG00000062038; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078246; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3006770
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             6437..7894
FT                   /estimated_length=1458
FT   gap             9363..9382
FT                   /estimated_length=20
FT   gap             10513..10532
FT                   /estimated_length=20
FT   gap             12927..12946
FT                   /estimated_length=20
FT   gap             14617..31941
FT                   /estimated_length=17325
FT   gene            36254..37350
FT                   /pseudo
FT                   /locus_tag="mCG_1039701"
FT                   /note="gene_id=mCG1039701.1"
FT   mRNA            36254..37350
FT                   /pseudo
FT                   /locus_tag="mCG_1039701"
FT                   /note="gene_id=mCG1039701.1 transcript_id=mCT157405.1
FT                   created on 26-NOV-2002"
FT   gap             67294..67807
FT                   /estimated_length=514
FT   gap             70468..71739
FT                   /estimated_length=1272
FT   gap             103591..103610
FT                   /estimated_length=20
FT   gap             108104..108123
FT                   /estimated_length=20
FT   gap             140230..140274
FT                   /estimated_length=45
FT   gap             165329..165767
FT                   /estimated_length=439
FT   gap             199658..199677
FT                   /estimated_length=20
FT   gap             253769..253788
FT                   /estimated_length=20
FT   gap             265086..265105
FT                   /estimated_length=20
FT   gap             275797..276082
FT                   /estimated_length=286
FT   gap             285720..285853
FT                   /estimated_length=134
FT   gap             330874..331223
FT                   /estimated_length=350
FT   gap             358308..358627
FT                   /estimated_length=320
FT   gap             368007..368512
FT                   /estimated_length=506
FT   gap             369545..369661
FT                   /estimated_length=117
FT   gap             390427..390446
FT                   /estimated_length=20
FT   gene            complement(452331..453404)
FT                   /locus_tag="mCG_53609"
FT                   /note="gene_id=mCG53609.1"
FT   mRNA            complement(join(452331..453050,453238..453404))
FT                   /locus_tag="mCG_53609"
FT                   /product="mCG53609"
FT                   /note="gene_id=mCG53609.1 transcript_id=mCT53792.1 created
FT                   on 07-NOV-2002"
FT   CDS             complement(452564..453022)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53609"
FT                   /product="mCG53609"
FT                   /note="gene_id=mCG53609.1 transcript_id=mCT53792.1
FT                   protein_id=mCP35199.2"
FT                   /protein_id="EDL38693.1"
FT                   /translation="MEKGKKMMQSFPGFVKDTSDIEENALQSPLVLPAQNTRCSKSETL
FT                   CLSKEQSHCSEDGWVLEWEICVFESVNYLDFYHKFNCAMKKSTEVFQSECQRKSQVSPG
FT                   DVENDKDKDTEELDQPSPSLLREKGWKLRPVMVETALTRILLLTVPGT"
FT   gene            480818..682685
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /note="gene_id=mCG115650.1"
FT   mRNA            join(480818..481306,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624861,641592..641696,
FT                   642750..642819,646766..646910,656843..657065,
FT                   659639..659727,661993..662034,664678..664835,
FT                   667583..667647,671351..671490,678616..682685)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT116758"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT116758.1
FT                   created on 04-JUN-2003"
FT   mRNA            join(481152..481321,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624866,641582..641696,
FT                   642750..642819,646766..646910,653022..653432)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT185147"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT185147.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(<481200..481321,545601..545788,561859..562019,
FT                   585049..585111,597566..597685,605561..605654,
FT                   607850..607978,624724..624866,641582..641696,
FT                   642750..642819,646766..646910,656843..657065,
FT                   659639..659727,661993..662034,664678..664835,
FT                   667583..667647,671351..671490,678616..680797)
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, transcript variant
FT                   mCT193703"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT193703.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<545611..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624866,641582..641696,642750..642819,
FT                   646766..646910,656843..657065,659639..659727,
FT                   661993..662034,664678..664835,667583..667647,
FT                   671351..671490,678616..679041)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_c"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT193703.0
FT                   protein_id=mCP114676.0 isoform=CRA_c"
FT                   /protein_id="EDL38696.1"
FT                   /translation="QCLKNKIFIMNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTE
FT                   TSKQNIPRLKLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSL
FT                   VDLNKNFKKIYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPL
FT                   CGYIDLGANKEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDT
FT                   AFTRSLGLMQDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGS
FT                   TSDRSILSRVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLL
FT                   PTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRI
FT                   PYPRPGTCPSKTYDPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRL
FT                   TQIVVDHVVAEDGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFKHPTAILN
FT                   MELSLKQQQLYVGSWDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACSRYAPTSK
FT                   RRARRQDVKYGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQASVEWYI
FT                   QRSGDEHREELKPDERIIKTDYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIE
FT                   NEQMENTQRAEYQEGQVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWYKEKRRQRN
FT                   KGSPKWKHMQEMKKKRNRRHHRDLDELQRSVAT"
FT   CDS             join(545638..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624861,641592..641696,642750..642819,
FT                   646766..646910,656843..657065,659639..659727,
FT                   661993..662034,664678..664835,667583..667647,
FT                   671351..671490,678616..679041)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_a"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT116758.1
FT                   protein_id=mCP70710.1 isoform=CRA_a"
FT                   /protein_id="EDL38694.1"
FT                   /translation="MNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTETSKQNIPRL
FT                   KLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSLVDLNKNFKK
FT                   IYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPLCGYIDLGAN
FT                   KEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDTAFTRSLGLM
FT                   QDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDRSILSR
FT                   VGRVCGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPVVYGVF
FT                   TTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYD
FT                   PLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRLTQIVVDHVVAEDGQ
FT                   YDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQVFKHPTAILNMELSLKQQQLYVGS
FT                   WDGLVQLSLHRCDTYGKACADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPI
FT                   TQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQASVEWYIQRSGDEHREELKPD
FT                   ERIIKTDYGLLIRSLQKKDSGMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEYQE
FT                   GQVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWYKEKRRQRNKGSPKWKHMQEMKK
FT                   KRNRRHHRDLDELQRSVAT"
FT   CDS             join(545638..545788,561859..562019,585049..585111,
FT                   597566..597685,605561..605654,607850..607978,
FT                   624724..624866,641582..641696,642750..642819,
FT                   646766..646910,653022..653042)
FT                   /codon_start=1
FT                   /gene="Sema3d"
FT                   /locus_tag="mCG_115650"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3D, isoform CRA_b"
FT                   /note="gene_id=mCG115650.1 transcript_id=mCT185147.0
FT                   protein_id=mCP106405.0 isoform=CRA_b"
FT                   /protein_id="EDL38695.1"
FT                   /translation="MNVTKDENPRSRSQDLHLFHAWMMLIMTVLFLPVTETSKQNIPRL
FT                   KLTYKDLLLSNTCIPFLGSSEGLDFQTLLLDEERGILLLGAKDHVFLLSLVDLNKNFKK
FT                   IYWPAAKERVELCKLAGKDANAECANFIRVLQPYNKTHVYVCGTGAFHPLCGYIDLGAN
FT                   KEELIFKLDTHNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKDTAFTRSLGLM
FT                   QDHHSIRTDISEHHWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDRSILSR
FT                   VGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPV
FT                   VYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTAD
FT                   TAQL"
FT   gap             550044..550063
FT                   /estimated_length=20
FT   gap             551651..552458
FT                   /estimated_length=808
FT   gap             571369..571388
FT                   /estimated_length=20
FT   gap             572581..572600
FT                   /estimated_length=20
FT   gap             573910..573929
FT                   /estimated_length=20
FT   gene            complement(579345..580152)
FT                   /pseudo
FT                   /locus_tag="mCG_18161"
FT                   /note="gene_id=mCG18161.0"
FT   mRNA            complement(579345..580152)
FT                   /pseudo
FT                   /locus_tag="mCG_18161"
FT                   /note="gene_id=mCG18161.0 transcript_id=mCT20591.0 created
FT                   on 06-NOV-2002"
FT   gap             584296..584449
FT                   /estimated_length=154
FT   gap             601315..601809
FT                   /estimated_length=495
FT   gap             604763..604974
FT                   /estimated_length=212
FT   gap             611068..611087
FT                   /estimated_length=20
FT   gap             618597..619578
FT                   /estimated_length=982
FT   gap             623286..623498
FT                   /estimated_length=213
FT   gap             632337..632647
FT                   /estimated_length=311
FT   gap             642133..642152
FT                   /estimated_length=20
FT   gap             643281..643300
FT                   /estimated_length=20
FT   gap             687598..687617
FT                   /estimated_length=20
FT   gap             808556..808575
FT                   /estimated_length=20
FT   gap             809847..809952
FT                   /estimated_length=106
FT   gap             832859..835142
FT                   /estimated_length=2284
FT   gap             837311..837330
FT                   /estimated_length=20
FT   gap             854289..854308
FT                   /estimated_length=20
FT   gap             862526..862545
FT                   /estimated_length=20
FT   gap             867437..871655
FT                   /estimated_length=4219
FT   gap             873439..873485
FT                   /estimated_length=47
FT   gap             875765..876786
FT                   /estimated_length=1022
FT   gap             884148..884786
FT                   /estimated_length=639
FT   gap             885744..885763
FT                   /estimated_length=20
FT   gap             905765..905953
FT                   /estimated_length=189
FT   gap             906940..906959
FT                   /estimated_length=20
FT   gap             947769..947788
FT                   /estimated_length=20
FT   gap             980997..981016
FT                   /estimated_length=20
FT   gap             987647..987670
FT                   /estimated_length=24
FT   gap             989425..989445
FT                   /estimated_length=21
FT   gap             990291..990443
FT                   /estimated_length=153
FT   gap             999286..999305
FT                   /estimated_length=20
FT   gap             1001490..1001509
FT                   /estimated_length=20
FT   gene            <1004045..1004606
FT                   /locus_tag="mCG_1039706"
FT                   /note="gene_id=mCG1039706.0"
FT   mRNA            join(<1004045..1004471,1004495..1004606)
FT                   /locus_tag="mCG_1039706"
FT                   /product="mCG1039706"
FT                   /note="gene_id=mCG1039706.0 transcript_id=mCT157410.0
FT                   created on 26-NOV-2002"
FT   CDS             1004045..1004230
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039706"
FT                   /product="mCG1039706"
FT                   /note="gene_id=mCG1039706.0 transcript_id=mCT157410.0
FT                   protein_id=mCP70723.0"
FT                   /protein_id="EDL38697.1"
FT                   /translation="MNSAADLLGPYVCVERGLSTRVGKAWMMTDRHTRRRVCVESECNF
FT                   TTEHQTFYAEDNKEVG"
FT   gap             1023164..1023183
FT                   /estimated_length=20
FT   gap             1030474..1030493
FT                   /estimated_length=20
FT   gene            <1037571..1037994
FT                   /locus_tag="mCG_1039710"
FT                   /note="gene_id=mCG1039710.0"
FT   mRNA            join(<1037571..1037850,1037865..1037994)
FT                   /locus_tag="mCG_1039710"
FT                   /product="mCG1039710"
FT                   /note="gene_id=mCG1039710.0 transcript_id=mCT157414.0
FT                   created on 26-NOV-2002"
FT   CDS             join(<1037571..1037850,1037865..1037896)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039710"
FT                   /product="mCG1039710"
FT                   /note="gene_id=mCG1039710.0 transcript_id=mCT157414.0
FT                   protein_id=mCP70730.0"
FT                   /protein_id="EDL38698.1"
FT                   /translation="RYQPIKLSFIRLRCLLFKAYIAGNMGGVKGELYKEQRSGHLLTWG
FT                   PKSGARQRALWILSLEHRSSLTALGVRLGSGVTHVLGWHGNSGRDREEALQPQVPRKE"
FT   gap             1055556..1055575
FT                   /estimated_length=20
FT   gap             1077606..1077625
FT                   /estimated_length=20
FT   gap             1134141..1134469
FT                   /estimated_length=329
FT   gene            complement(1139490..1140746)
FT                   /pseudo
FT                   /locus_tag="mCG_115979"
FT                   /note="gene_id=mCG115979.1"
FT   mRNA            complement(1139490..1140746)
FT                   /pseudo
FT                   /locus_tag="mCG_115979"
FT                   /note="gene_id=mCG115979.1 transcript_id=mCT117094.1
FT                   created on 23-MAY-2003"
FT   gap             1145396..1145548
FT                   /estimated_length=153
FT   gap             1147700..1147748
FT                   /estimated_length=49
FT   gene            1178000..1180134
FT                   /pseudo
FT                   /locus_tag="mCG_50800"
FT                   /note="gene_id=mCG50800.1"
FT   mRNA            join(1178000..1178155,1178545..1180134)
FT                   /pseudo
FT                   /locus_tag="mCG_50800"
FT                   /note="gene_id=mCG50800.1 transcript_id=mCT50983.1 created
FT                   on 25-NOV-2002"
FT   gap             1187586..1188708
FT                   /estimated_length=1123
FT   gap             1191908..1191927
FT                   /estimated_length=20
FT   gene            complement(1218637..1219586)
FT                   /locus_tag="mCG_115977"
FT                   /note="gene_id=mCG115977.1"
FT   mRNA            complement(1218637..1219586)
FT                   /locus_tag="mCG_115977"
FT                   /product="mCG115977"
FT                   /note="gene_id=mCG115977.1 transcript_id=mCT117092.1
FT                   created on 25-NOV-2002"
FT   CDS             complement(1219199..1219516)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115977"
FT                   /product="mCG115977"
FT                   /note="gene_id=mCG115977.1 transcript_id=mCT117092.1
FT                   protein_id=mCP70711.0"
FT                   /db_xref="GOA:G3UWG1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="MGI:MGI:3642431"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWG1"
FT                   /protein_id="EDL38699.1"
FT                   /translation="MSDVEKGKKIFVQKYAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA
FT                   GFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN
FT                   E"
FT   gene            <1223235..1394506
FT                   /locus_tag="mCG_145594"
FT                   /note="gene_id=mCG145594.0"
FT   mRNA            join(<1223235..1223519,1331190..1331271,1392278..1394506)
FT                   /locus_tag="mCG_145594"
FT                   /product="mCG145594"
FT                   /note="gene_id=mCG145594.0 transcript_id=mCT185018.0
FT                   created on 05-JUN-2003"
FT   gap             1227965..1228062
FT                   /estimated_length=98
FT   gap             1238251..1238270
FT                   /estimated_length=20
FT   gap             1239944..1239963
FT                   /estimated_length=20
FT   gap             1241116..1241135
FT                   /estimated_length=20
FT   gap             1245718..1245745
FT                   /estimated_length=28
FT   gap             1261452..1261471
FT                   /estimated_length=20
FT   gap             1266869..1267218
FT                   /estimated_length=350
FT   gap             1293107..1294299
FT                   /estimated_length=1193
FT   gap             1383394..1383413
FT                   /estimated_length=20
FT   CDS             <1392590..1392823
FT                   /codon_start=1
FT                   /locus_tag="mCG_145594"
FT                   /product="mCG145594"
FT                   /note="gene_id=mCG145594.0 transcript_id=mCT185018.0
FT                   protein_id=mCP106288.0"
FT                   /protein_id="EDL38700.1"
FT                   /translation="TSESILDFYCYYYCCCCYSSRLGISLGSPLFQGLLNSGSCNVGRL
FT                   PFRGILWLTFPFCISWGTYGYYQSGSIQRLRG"
FT   gap             1434369..1434658
FT                   /estimated_length=290
FT   gap             1464403..1464422
FT                   /estimated_length=20
FT   gap             1498413..1499852
FT                   /estimated_length=1440
FT   gene            1500675..1709509
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /note="gene_id=mCG16225.2"
FT   mRNA            join(1500675..1501437,1552419..1552576,1556859..1556921,
FT                   1574601..1574720,1617415..1617508,1624263..1624382,
FT                   1655856..1655998,1656338..1656452,1656599..1656668,
FT                   1661098..1661242,1665085..1665304,1669481..1669572,
FT                   1684488..1684529,1687898..1688055,1692013..1692080,
FT                   1704445..1704587,1706093..1709509)
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3A"
FT                   /note="gene_id=mCG16225.2 transcript_id=mCT16413.2 created
FT                   on 30-OCT-2002"
FT   CDS             join(1501326..1501437,1552419..1552576,1556859..1556921,
FT                   1574601..1574720,1617415..1617508,1624263..1624382,
FT                   1655856..1655998,1656338..1656452,1656599..1656668,
FT                   1661098..1661242,1665085..1665304,1669481..1669572,
FT                   1684488..1684529,1687898..1688055,1692013..1692080,
FT                   1704445..1704587,1706093..1706548)
FT                   /codon_start=1
FT                   /gene="Sema3a"
FT                   /locus_tag="mCG_16225"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3A"
FT                   /note="gene_id=mCG16225.2 transcript_id=mCT16413.2
FT                   protein_id=mCP14037.1"
FT                   /protein_id="EDL38701.1"
FT                   /translation="MGWFTGIACLFWGVLLTARANYANGKNNVPRLKLSYKEMLESNNV
FT                   ITFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECK
FT                   WAGKDILKECANFIKVLEAYNQTHLYACGTGAFHPICTYIEVGHHPEDNIFKLQDSHFE
FT                   NGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLN
FT                   DPRFISAHLIPESDNPEDDKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVN
FT                   KWTTFLKARLICSVPGPNGIDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAV
FT                   CMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDV
FT                   ITFARSHPAMYNPVFPINNRPIMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTV
FT                   LKVVSVPKETWHDLEEVLLEEMTVFREPTTISAMELSTKQQQLYIGSTAGVAQLPLHRC
FT                   DIYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNH
FT                   HGPSLEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEDRKEEIRMGDHIIRTEQGL
FT                   LLRSLQKKDSGNYLCHAVEHGFMQTLLKVTLEVIDTEHLEELLHKDDDGDGSKIKEMSS
FT                   SMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHSQGSSNKWKHMQE
FT                   SKKGRNRRTHEFERAPRSV"
FT   gap             1674012..1681702
FT                   /estimated_length=7691
FT   gap             1784898..1784917
FT                   /estimated_length=20
FT   gap             1786210..1786229
FT                   /estimated_length=20
FT   gap             1788972..1788991
FT                   /estimated_length=20
FT   gap             1790569..1790588
FT                   /estimated_length=20
FT   gap             1816736..1816755
FT                   /estimated_length=20
FT   gap             1817749..1817918
FT                   /estimated_length=170
FT   gap             1826115..1826873
FT                   /estimated_length=759
FT   gap             1833545..1834378
FT                   /estimated_length=834
FT   gene            complement(1851283..>1916160)
FT                   /locus_tag="mCG_145013"
FT                   /note="gene_id=mCG145013.0"
FT   mRNA            complement(join(1851283..1851984,1910809..1911021,
FT                   1916015..>1916160))
FT                   /locus_tag="mCG_145013"
FT                   /product="mCG145013"
FT                   /note="gene_id=mCG145013.0 transcript_id=mCT184437.0
FT                   created on 05-JUN-2003"
FT   gap             1855625..1855644
FT                   /estimated_length=20
FT   gap             1861737..1866859
FT                   /estimated_length=5123
FT   gap             1868570..1868589
FT                   /estimated_length=20
FT   gene            1870340..1871527
FT                   /locus_tag="mCG_1039702"
FT                   /note="gene_id=mCG1039702.1"
FT   mRNA            1870340..1871527
FT                   /locus_tag="mCG_1039702"
FT                   /product="mCG1039702"
FT                   /note="gene_id=mCG1039702.1 transcript_id=mCT157406.1
FT                   created on 26-NOV-2002"
FT   CDS             1870375..1871088
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039702"
FT                   /product="mCG1039702"
FT                   /note="gene_id=mCG1039702.1 transcript_id=mCT157406.1
FT                   protein_id=mCP70728.0"
FT                   /protein_id="EDL38703.1"
FT                   /translation="MDALKDSDLLHWKHSLWELFDIRIAQKTAIWRLYGRSTMVLHHQA
FT                   QMLLSMNSLESLNAGVHQNNTESFTFALYHLAELHAEKVCFAAAGEVLKHLKDRFPPNS
FT                   QHAQKWMLCDQKIQFDRAMNDGKFHLADSLVTGITVLNGIEGVYRKAVVLQAQNQMTEA
FT                   HKLLQKLLTYCQKLKNTEIVISVLLSVAELYWRSFVPDYRHAWAPGSSGPLQRIPITVL
FT                   GLRNCAQLGLCPVHP"
FT   gap             1872029..1875521
FT                   /estimated_length=3493
FT   gene            <1876138..>1877950
FT                   /locus_tag="mCG_68112"
FT                   /note="gene_id=mCG68112.2"
FT   mRNA            join(<1876138..1876289,1876920..1877097,1877789..>1877950)
FT                   /locus_tag="mCG_68112"
FT                   /product="mCG68112"
FT                   /note="gene_id=mCG68112.2 transcript_id=mCT68297.2 created
FT                   on 27-NOV-2002"
FT   CDS             join(<1876138..1876289,1876920..1877097,1877789..1877950)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68112"
FT                   /product="mCG68112"
FT                   /note="gene_id=mCG68112.2 transcript_id=mCT68297.2
FT                   protein_id=mCP43395.2"
FT                   /protein_id="EDL38704.1"
FT                   /translation="RTRPLEKLNPLYELLKLKNMKVRSSVYKSLSKLIEAQENMDKLNQ
FT                   EINFYSNLHSQLMVEKNLNMSITQKRESEEVQIALALIEKYLVDLNLNGKDEQEQTSNH
FT                   ETQQLQDSETPARAEISTSQEESLLHNEFPLQEPPAELHPQHPQSILNESSYIQYIYAV
FT                   "
FT   gap             1882714..1883816
FT                   /estimated_length=1103
FT   gene            1898453..1903622
FT                   /locus_tag="mCG_16226"
FT                   /note="gene_id=mCG16226.1"
FT   mRNA            join(1898453..1898612,1900002..1900161,1901421..1901570,
FT                   1902200..1902380,1903094..1903622)
FT                   /locus_tag="mCG_16226"
FT                   /product="mCG16226"
FT                   /note="gene_id=mCG16226.1 transcript_id=mCT16412.1 created
FT                   on 25-NOV-2002"
FT   CDS             join(1898606..1898612,1900002..1900161,1901421..1901570,
FT                   1902200..1902380,1903094..1903222)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16226"
FT                   /product="mCG16226"
FT                   /note="gene_id=mCG16226.1 transcript_id=mCT16412.1
FT                   protein_id=mCP14038.2"
FT                   /protein_id="EDL38705.1"
FT                   /translation="MWSARRHTSSIAPELSEKEFKMEMERLTTELHLITQKRNEQRDRL
FT                   ISFQEGSMKKRTKPIQKKNPFYEQLSLKKNQLMSSVNNLELEIIELQENIQELKKEINF
FT                   YSNLHSQLMVEKNLTKMSVTQKGESKEVQIDWALIEKYLVDVNLSGKDKQEQTSNQETQ
FT                   QLQDSATPARAEMSTSQEESLLHNEFLPQEPPAALHPQHPQSTLD"
FT   gap             1906651..1907117
FT                   /estimated_length=467
FT   gap             1908552..1908571
FT                   /estimated_length=20
FT   CDS             complement(join(1910923..1911021,1916015..>1916158))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145013"
FT                   /product="mCG145013"
FT                   /note="gene_id=mCG145013.0 transcript_id=mCT184437.0
FT                   protein_id=mCP106287.0"
FT                   /protein_id="EDL38702.1"
FT                   /translation="ELRLMVGSNCQLLATPPKELSLEIPVHKCLLTTGTVSGLATADRM
FT                   DPQGEWCYLDLWPFWNRCITVAAGFNILALAPWRL"
FT   gene            <1919022..1922618
FT                   /locus_tag="mCG_22198"
FT                   /note="gene_id=mCG22198.1"
FT   mRNA            join(<1919022..1919181,1920438..1920587,1921216..1921396,
FT                   1922109..1922618)
FT                   /locus_tag="mCG_22198"
FT                   /product="mCG22198"
FT                   /note="gene_id=mCG22198.1 transcript_id=mCT20762.1 created
FT                   on 25-NOV-2002"
FT   CDS             join(<1919024..1919181,1920438..1920587,1921216..1921396,
FT                   1922109..1922237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22198"
FT                   /product="mCG22198"
FT                   /note="gene_id=mCG22198.1 transcript_id=mCT20762.1
FT                   protein_id=mCP8664.1"
FT                   /protein_id="EDL38706.1"
FT                   /translation="ARRHTSSSAPDLSKKEFKKEKERLTTELHLITQKRNEQRDRLISF
FT                   QEGSMKKRTKPTQKKNPFCEQLSLKKNQLMSSVNNLELEIIELQENIQELKKETNFYSN
FT                   LHSQLMVEKNLTKMSVTQKGESEKVQIDWALIEKYLVDVNLSGKDKQEQTSNHETQQLQ
FT                   DSETPARAEMSTSHEESLLHNEFPPQEPPAELHAQYPQSTLD"
FT   gap             1940429..1940448
FT                   /estimated_length=20
FT   gene            complement(1946117..>1947786)
FT                   /locus_tag="mCG_60047"
FT                   /note="gene_id=mCG60047.1"
FT   mRNA            complement(join(1946117..1946845,1947089..1947389,
FT                   1947427..>1947786))
FT                   /locus_tag="mCG_60047"
FT                   /product="mCG60047"
FT                   /note="gene_id=mCG60047.1 transcript_id=mCT60230.2 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1946445..1946845,1947089..1947389,
FT                   1947427..1947786))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60047"
FT                   /product="mCG60047"
FT                   /note="gene_id=mCG60047.1 transcript_id=mCT60230.2
FT                   protein_id=mCP30959.2"
FT                   /protein_id="EDL38707.1"
FT                   /translation="MAILIAGESVFQLSIAIFTYLLSNKLEKRTVQLEIVSKKAEELAV
FT                   QQQEIGVLREEVAKILQRLERQAAEEERERKELNCKPEMPDKIEDQERQPIGPTEPTFK
FT                   ETEASPPARLCSPAPLKLLIQIIRKPDCEKHSWYCKSPQLKQKDPQVSPPLLPCFLTSD
FT                   NDARLAGSSDHTYSSVTKVERFQEIRKIPYELDLKNEPGRDDLKHTVIDGSNVAITHDK
FT                   TGGIIVTNDNLREFVTESVSWREISKTRLLPYTFVGDIFMVPNDPLGRNLWDGPRLDEF
FT                   LQKETFLRDIHPRIIAQPSMDTSGLGFRSHNTQGVNTSHEAPPWIHRAASNPSSAAPFH
FT                   IHGHPSKNAAEPF"
FT   gap             1949264..1949283
FT                   /estimated_length=20
FT   gap             1968070..1968089
FT                   /estimated_length=20
FT   gene            <1974712..>1975523
FT                   /locus_tag="mCG_1039705"
FT                   /note="gene_id=mCG1039705.1"
FT   mRNA            join(<1974712..1974808,1975028..>1975523)
FT                   /locus_tag="mCG_1039705"
FT                   /product="mCG1039705"
FT                   /note="gene_id=mCG1039705.1 transcript_id=mCT157409.1
FT                   created on 25-NOV-2002"
FT   CDS             <1975089..>1975523
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039705"
FT                   /product="mCG1039705"
FT                   /note="gene_id=mCG1039705.1 transcript_id=mCT157409.1
FT                   protein_id=mCP70722.1"
FT                   /protein_id="EDL38708.1"
FT                   /translation="EFVTESVSWREISKTRLLPYTFMGDIFMVPDDPLGRNGPRHDEFF
FT                   QKETFLRDMHPRINAQPSVDTSGPGFRSHNTQGVNTSHEAPPWTHRAASNPWLPQQPHS
FT                   TSMATFPRMQQNLSELAQRSSAETSELREVLLNIFPDSEQK"
FT   gene            1976966..>1977647
FT                   /locus_tag="mCG_22199"
FT                   /note="gene_id=mCG22199.2"
FT   mRNA            join(1976966..1977154,1977216..>1977647)
FT                   /locus_tag="mCG_22199"
FT                   /product="mCG22199"
FT                   /note="gene_id=mCG22199.2 transcript_id=mCT20763.2 created
FT                   on 25-NOV-2002"
FT   CDS             join(1977032..1977154,1977216..>1977647)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22199"
FT                   /product="mCG22199"
FT                   /note="gene_id=mCG22199.2 transcript_id=mCT20763.2
FT                   protein_id=mCP8665.2"
FT                   /protein_id="EDL38709.1"
FT                   /translation="MMTFSGLNRGFPYACYSSQRGAQATIATLHNHQLRPSCQLLLKLL
FT                   SLLLALKPFGPCLQEMLLLLPSPGSVPSLIALLKFSTYRAAAMAKRAVVEGQSRLCGEQ
FT                   VAVEWLKTDLKQHFRQQLAGPSLWFLRPDVSQLTQTRKKLGSQGARAALQLLCQRMKLG
FT                   SPVFLTKYLGTGPAGWHHFWYQ"
FT   gap             1990376..1990911
FT                   /estimated_length=536
FT   gap             2011337..2012636
FT                   /estimated_length=1300
FT   gap             2028508..2028671
FT                   /estimated_length=164
FT   gap             2045013..2045160
FT                   /estimated_length=148
FT   gap             2061625..2061644
FT                   /estimated_length=20
FT   gap             2106342..2106361
FT                   /estimated_length=20
FT   gap             2111483..2111660
FT                   /estimated_length=178
FT   gene            <2126817..2356068
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /note="gene_id=mCG141425.0"
FT   mRNA            join(<2126817..2126931,2245768..2245928,2264062..2264121,
FT                   2265933..2266052,2312062..2312155,2326050..2326169,
FT                   2327316..2327458,2328179..2328293,2328398..2328467,
FT                   2331852..2331996,2333741..2333963,2335371..2335462,
FT                   2337788..2337829,2338013..2338179,2342324..2342391,
FT                   2342717..2342856,2354092..2356068)
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3E"
FT                   /note="gene_id=mCG141425.0 transcript_id=mCT175269.0
FT                   created on 30-OCT-2002"
FT   CDS             join(2126817..2126931,2245768..2245928,2264062..2264121,
FT                   2265933..2266052,2312062..2312155,2326050..2326169,
FT                   2327316..2327458,2328179..2328293,2328398..2328467,
FT                   2331852..2331996,2333741..2333963,2335371..2335462,
FT                   2337788..2337829,2338013..2338179,2342324..2342391,
FT                   2342717..2342856,2354092..2354544)
FT                   /codon_start=1
FT                   /gene="Sema3e"
FT                   /locus_tag="mCG_141425"
FT                   /product="sema domain, immunoglobulin domain (Ig), short
FT                   basic domain, secreted, (semaphorin) 3E"
FT                   /note="gene_id=mCG141425.0 transcript_id=mCT175269.0
FT                   protein_id=mCP98188.0"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="EDL38710.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
FT   gap             2200213..2200271
FT                   /estimated_length=59
FT   gap             2228341..2228428
FT                   /estimated_length=88
FT   gap             2242370..2242389
FT                   /estimated_length=20
FT   gap             2249978..2249997
FT                   /estimated_length=20
FT   gap             2276025..2276177
FT                   /estimated_length=153
FT   gap             2277083..2281058
FT                   /estimated_length=3976
FT   gap             2304576..2304666
FT                   /estimated_length=91
FT   gap             2306793..2306812
FT                   /estimated_length=20
FT   gene            2356111..2358449
FT                   /locus_tag="mCG_148351"
FT                   /note="gene_id=mCG148351.0"
FT   mRNA            2356111..2358449
FT                   /locus_tag="mCG_148351"
FT                   /product="mCG148351"
FT                   /note="gene_id=mCG148351.0 transcript_id=mCT188614.0
FT                   created on 13-JAN-2004"
FT   CDS             2356765..2357160
FT                   /codon_start=1
FT                   /locus_tag="mCG_148351"
FT                   /product="mCG148351"
FT                   /note="gene_id=mCG148351.0 transcript_id=mCT188614.0
FT                   protein_id=mCP108783.0"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CCK6"
FT                   /protein_id="EDL38711.1"
FT                   /translation="MIKFQGLGYNSRESSKLYINMYLYIHIVMYYTSSCTPISGKKTGN
FT                   RHRQAARETDRLGVREKERERERERASTGSQGITDVPLSLSLFPLTILACRSPRSIRCI
FT                   TKPFQSSCQQNTNLQKQKCFENLNPAT"
FT   gap             2365703..2365827
FT                   /estimated_length=125
FT   gap             2371361..2376447
FT                   /estimated_length=5087
FT   gap             2387857..2387876
FT                   /estimated_length=20
FT   gap             2389108..2389127
FT                   /estimated_length=20
FT   gap             2390515..2390534
FT                   /estimated_length=20
FT   gap             2392230..2392249
FT                   /estimated_length=20
FT   gap             2393374..2393393
FT                   /estimated_length=20
FT   gap             2410178..2410197
FT                   /estimated_length=20
FT   gap             2411779..2411829
FT                   /estimated_length=51
FT   gap             2422308..2422327
FT                   /estimated_length=20
FT   gap             2423497..2423516
FT                   /estimated_length=20
FT   gap             2484215..2486256
FT                   /estimated_length=2042
FT   gap             2488641..2488660
FT                   /estimated_length=20
FT   gap             2492700..2493349
FT                   /estimated_length=650
FT   gap             2494549..2494905
FT                   /estimated_length=357
FT   gap             2501269..2506954
FT                   /estimated_length=5686
FT   gap             2522002..2522023
FT                   /estimated_length=22
FT   gap             2543603..2543622
FT                   /estimated_length=20
FT   gap             2558154..2558173
FT                   /estimated_length=20
FT   gap             2596950..2597025
FT                   /estimated_length=76
FT   gap             2610401..2610420
FT                   /estimated_length=20
FT   gene            <2620754..2902833
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /note="gene_id=mCG141424.0"
FT   mRNA            join(<2620754..2621297,2626679..2627792,2627884..2628161,
FT                   2645248..2646639,2772189..2772900,2778154..2781356,
FT                   2781468..2783250,2783607..2785624,2815606..2817787,
FT                   2822047..2822183,2827249..2827339,2854630..2854755,
FT                   2872044..2872152,2872689..2872756,2873617..2873831,
FT                   2877186..2877236,2882210..2882334,2885367..2885393,
FT                   2895211..2895304,2897201..2897272,2898753..2898933,
FT                   2900673..2902833)
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /product="piccolo (presynaptic cytomatrix protein)"
FT                   /note="gene_id=mCG141424.0 transcript_id=mCT175268.0
FT                   created on 30-OCT-2002"
FT   gap             2652413..2654342
FT                   /estimated_length=1930
FT   gap             2692999..2693426
FT                   /estimated_length=428
FT   gap             2711576..2711595
FT                   /estimated_length=20
FT   gap             2712763..2712782
FT                   /estimated_length=20
FT   gap             2750704..2750804
FT                   /estimated_length=101
FT   gap             2781357..2781467
FT                   /estimated_length=111
FT   CDS             join(<2781468..2783250,2783607..2785624,2815606..2817787,
FT                   2822047..2822183,2827249..2827339,2854630..2854755,
FT                   2872044..2872152,2872689..2872756,2873617..2873831,
FT                   2877186..2877236,2882210..2882334,2885367..2885393,
FT                   2895211..2895304,2897201..2897272,2898753..2898933,
FT                   2900673..2900884)
FT                   /codon_start=1
FT                   /gene="Pclo"
FT                   /locus_tag="mCG_141424"
FT                   /product="piccolo (presynaptic cytomatrix protein)"
FT                   /note="gene_id=mCG141424.0 transcript_id=mCT175268.0
FT                   protein_id=mCP98187.0"
FT                   /protein_id="EDL38712.1"
FT                   /translation="YPKRKLAAAAPVAPTAIVTAHADAIPTVEATAARRSNGLPATKIC
FT                   AAAPPPVPPKPSSIPTGLVFTHRPEASKPPIAPKPAVPEIPVTTQKTTDTCPKPTGLPL
FT                   TSNMSLNLVTSADYKLPSPTSPLSPHSNKSSPRYSKSLMETYVVITLPSEPGTPTDSSA
FT                   AQAITSWPLGSPPKDLVSLETVFSVVPPMTSTEIPSASQPTLYTSGALGTFSVTPAVTA
FT                   SLFQTVPTSLTQFLPAEASKPEVSAVSSAVPSVAPRSVSIPIPPEPLALDRHQYKENGK
FT                   LPLIGDAIDLRTIPKSEVKVTEKCMDLSASAMDVKRQTTANEVYRRQISAVQPSIINLS
FT                   AASSLGTPVTMDSKTVAVVTCTDTTIYTTGTESQVGIEHAVTSPLQLTTSKHTELQYRK
FT                   PSSQAFPMIRDEAPINLSLGPSTQAVTLAVTKPVTVPPVGVTNGWTDSTISQGITDGEV
FT                   VDLSTSKSHRTVVTMDESTSNVVTKIIEDEEKPVDLTAGRRAVCCDMVYKLPFGRSCTA
FT                   QQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFD
FT                   YSGGTEAAVDLTSGRVSTGEVMDYSSKTTGPYPETRQVISGVGISTPQYSTARMTPPPG
FT                   PQYGVGSVLRSSNGVVYSSVATPIPSTFAITTQPGSIFSTTVRDLSGIHTTDAITSLSA
FT                   LHQSQPMPRSYFITTGASETDISVTSIDINASLQTITMETLPAETMDSVPTLTTASEVF
FT                   SEVVGEESTLLIVPDEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEK
FT                   IMVQKKLEELQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEE
FT                   QKLRQIYQYNYEPSGTASPQTTTEQAILEGQYVATEGSQFWATEDATTTASTVVAIEIP
FT                   QSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVRGQYDEMG
FT                   ESMADDPRNLKKIVDSGVQTDDEETADRTYASRRRRTKKSVDTSVQTDDEDQDEWDMPS
FT                   RSRRKARTGKYGDSTAEGDKTKPPSKVSSVAVQTVAEISVQTEPLGTIRTPSIRARVDA
FT                   KVEIIKHISAPEKTYKGGSLGCQTETDPDTQSPPYMGATSPPKDKKRPTPLEIGYSSSH
FT                   LRADPTVQLAPSPPKSPKVLYSPISPLSPGHALEPAFVPYEKPLPDDISPQKVLHPDMD
FT                   KVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYSEGFTAKGSQTTSGTQKKVKRT
FT                   LPNPPPEEASTGTQSTYSTMGTASRRRMCRTNTMARAKILQDIDRELDLVERESAKLRK
FT                   KQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSS
FT                   TRPSRVESQHGIERPRTAPQTEFSQFIPPQTQTEAQLVPPTSPYTQYQYSSPALPTQAP
FT                   TPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVI
FT                   QQKPRQTTLYLEPKITSTYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEER
FT                   SSMASSPISSISADSFYADIDHHTSRNYVLIDDIGDITKGTAALSSAFSLHEKDLSKTD
FT                   RLLRTTETRRSQEVTDFLAPLQTSSRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGT
FT                   ESLDHLAGLSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKAL
FT                   IDPKMSKFSPIQESRDLEPDYPTYLSSSTSSIGGISSRARLLQDDITFGLRKNITDQQK
FT                   FMGSSLGSGLGTLGNTIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSS
FT                   LRLKAQEAEALDVSFGHSSSSARTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMG
FT                   MARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSD
FT                   SEAYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQILQMNGKTMHY
FT                   IFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEHSGKL
FT                   IEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRLDLNMLSDSENPQHLELHEPP
FT                   KVVDKAKSPGVDPKQLAAELQKVSLQQSPLVMSSVVEKGAHAHSGPTSAGSSSVPSPGQ
FT                   PGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNG
FT                   YSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKK
FT                   TLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTESIEHGKSHSSQNSQ
FT                   QSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTS
FT                   VAQTHLEDAGAAIAAAEAAVQQLRIQPSKRRK"
FT   gap             2810513..2810584
FT                   /estimated_length=72
FT   gap             2811593..2811736
FT                   /estimated_length=144
FT   gap             2825323..2825342
FT                   /estimated_length=20
FT   gap             2844081..2844351
FT                   /estimated_length=271
FT   gap             2862911..2862930
FT                   /estimated_length=20
FT   gap             2864767..2864786
FT                   /estimated_length=20
FT   gap             2882898..2882917
FT                   /estimated_length=20
FT   gap             2890756..2890775
FT                   /estimated_length=20
FT   gap             2895636..2895655
FT                   /estimated_length=20
FT   gap             2915032..2915051
FT                   /estimated_length=20
FT   gap             2943364..2943383
FT                   /estimated_length=20
FT   gap             2949351..2949370
FT                   /estimated_length=20
XX
CO   join(AAHY01098208.1:1..6436,gap(1458),AAHY01098209.1:1..1468,gap(20),
CO   AAHY01098210.1:1..1130,gap(20),complement(AAHY01098211.1:1..2394),gap(20),
CO   AAHY01098212.1:1..1670,gap(17325),AAHY01098213.1:1..35352,gap(514),
CO   AAHY01098214.1:1..2660,gap(1272),AAHY01098215.1:1..31851,gap(20),
CO   AAHY01098216.1:1..4493,gap(20),AAHY01098217.1:1..32106,gap(45),
CO   complement(AAHY01098218.1:1..25054),gap(439),
CO   complement(AAHY01098219.1:1..33890),gap(20),AAHY01098220.1:1..54091,
CO   gap(20),complement(AAHY01098221.1:1..11297),gap(20),
CO   AAHY01098222.1:1..10691,gap(286),AAHY01098223.1:1..9637,gap(134),
CO   complement(AAHY01098224.1:1..45020),gap(350),AAHY01098225.1:1..27084,
CO   gap(320),AAHY01098226.1:1..9379,gap(506),AAHY01098227.1:1..1032,gap(117),
CO   AAHY01098228.1:1..20765,gap(20),AAHY01098229.1:1..159597,gap(20),
CO   AAHY01098230.1:1..1587,gap(808),AAHY01098231.1:1..18910,gap(20),
CO   complement(AAHY01098232.1:1..1192),gap(20),
CO   complement(AAHY01098233.1:1..1309),gap(20),AAHY01098234.1:1..10366,
CO   gap(154),AAHY01098235.1:1..16865,gap(495),
CO   complement(AAHY01098236.1:1..2953),gap(212),
CO   complement(AAHY01098237.1:1..6093),gap(20),AAHY01098238.1:1..7509,gap(982),
CO   AAHY01098239.1:1..3707,gap(213),complement(AAHY01098240.1:1..8838),
CO   gap(311),AAHY01098241.1:1..9485,gap(20),AAHY01098242.1:1..1128,gap(20),
CO   AAHY01098243.1:1..44297,gap(20),complement(AAHY01098244.1:1..120938),
CO   gap(20),complement(AAHY01098245.1:1..1271),gap(106),
CO   complement(AAHY01098246.1:1..22906),gap(2284),AAHY01098247.1:1..2168,
CO   gap(20),AAHY01098248.1:1..16958,gap(20),complement(AAHY01098249.1:1..8217),
CO   gap(20),AAHY01098250.1:1..4891,gap(4219),AAHY01098251.1:1..1783,gap(47),
CO   complement(AAHY01098252.1:1..2279),gap(1022),AAHY01098253.1:1..7361,
CO   gap(639),AAHY01098254.1:1..957,gap(20),AAHY01098255.1:1..20001,gap(189),
CO   AAHY01098256.1:1..986,gap(20),AAHY01098257.1:1..40809,gap(20),
CO   AAHY01098258.1:1..33208,gap(20),AAHY01098259.1:1..6630,gap(24),
CO   complement(AAHY01098260.1:1..1754),gap(21),
CO   complement(AAHY01098261.1:1..845),gap(153),AAHY01098262.1:1..8842,gap(20),
CO   AAHY01098263.1:1..2184,gap(20),AAHY01098264.1:1..21654,gap(20),
CO   AAHY01098265.1:1..7290,gap(20),AAHY01098266.1:1..25062,gap(20),
CO   AAHY01098267.1:1..22030,gap(20),AAHY01098268.1:1..56515,gap(329),
CO   AAHY01098269.1:1..10926,gap(153),AAHY01098270.1:1..2151,gap(49),
CO   AAHY01098271.1:1..39837,gap(1123),AAHY01098272.1:1..3199,gap(20),
CO   AAHY01098273.1:1..36037,gap(98),AAHY01098274.1:1..10188,gap(20),
CO   AAHY01098275.1:1..1673,gap(20),AAHY01098276.1:1..1152,gap(20),
CO   AAHY01098277.1:1..4582,gap(28),AAHY01098278.1:1..15706,gap(20),
CO   AAHY01098279.1:1..5397,gap(350),AAHY01098280.1:1..25888,gap(1193),
CO   AAHY01098281.1:1..89094,gap(20),AAHY01098282.1:1..50955,gap(290),
CO   AAHY01098283.1:1..29744,gap(20),AAHY01098284.1:1..33990,gap(1440),
CO   AAHY01098285.1:1..174159,gap(7691),AAHY01098286.1:1..103195,gap(20),
CO   complement(AAHY01098287.1:1..1292),gap(20),AAHY01098288.1:1..2742,gap(20),
CO   AAHY01098289.1:1..1577,gap(20),AAHY01098290.1:1..26147,gap(20),
CO   AAHY01098291.1:1..993,gap(170),AAHY01098292.1:1..8196,gap(759),
CO   AAHY01098293.1:1..6671,gap(834),AAHY01098294.1:1..21246,gap(20),
CO   AAHY01098295.1:1..6092,gap(5123),AAHY01098296.1:1..1710,gap(20),
CO   complement(AAHY01098297.1:1..3439),gap(3493),AAHY01098298.1:1..7192,
CO   gap(1103),AAHY01098299.1:1..22834,gap(467),
CO   complement(AAHY01098300.1:1..1434),gap(20),AAHY01098301.1:1..31857,gap(20),
CO   AAHY01098302.1:1..8815,gap(20),AAHY01098303.1:1..18786,gap(20),
CO   AAHY01098304.1:1..22286,gap(536),AAHY01098305.1:1..20425,gap(1300),
CO   AAHY01098306.1:1..15871,gap(164),AAHY01098307.1:1..16341,gap(148),
CO   AAHY01098308.1:1..16464,gap(20),AAHY01098309.1:1..44697,gap(20),
CO   AAHY01098310.1:1..5121,gap(178),AAHY01098311.1:1..88552,gap(59),
CO   AAHY01098312.1:1..28069,gap(88),complement(AAHY01098313.1:1..13941),
CO   gap(20),AAHY01098314.1:1..7588,gap(20),AAHY01098315.1:1..26027,gap(153),
CO   AAHY01098316.1:1..905,gap(3976),AAHY01098317.1:1..23517,gap(91),
CO   AAHY01098318.1:1..2126,gap(20),complement(AAHY01098319.1:1..58890),
CO   gap(125),complement(AAHY01098320.1:1..5533),gap(5087),
CO   AAHY01098321.1:1..11409,gap(20),complement(AAHY01098322.1:1..1231),gap(20),
CO   AAHY01098323.1:1..1387,gap(20),AAHY01098324.1:1..1695,gap(20),
CO   AAHY01098325.1:1..1124,gap(20),AAHY01098326.1:1..16784,gap(20),
CO   AAHY01098327.1:1..1581,gap(51),AAHY01098328.1:1..10478,gap(20),
CO   AAHY01098329.1:1..1169,gap(20),AAHY01098330.1:1..60698,gap(2042),
CO   AAHY01098331.1:1..2384,gap(20),complement(AAHY01098332.1:1..4039),gap(650),
CO   AAHY01098333.1:1..1199,gap(357),AAHY01098334.1:1..6363,gap(5686),
CO   AAHY01098335.1:1..15047,gap(22),complement(AAHY01098336.1:1..21579),
CO   gap(20),AAHY01098337.1:1..14531,gap(20),AAHY01098338.1:1..38776,gap(76),
CO   complement(AAHY01098339.1:1..13375),gap(20),
CO   complement(AAHY01098340.1:1..41992),gap(1930),AAHY01098341.1:1..38656,
CO   gap(428),complement(AAHY01098342.1:1..18149),gap(20),
CO   complement(AAHY01098343.1:1..1167),gap(20),AAHY01098344.1:1..37921,
CO   gap(101),AAHY01098345.1:1..30552,gap(111),AAHY01098346.1:1..29045,gap(72),
CO   complement(AAHY01098347.1:1..1008),gap(144),
CO   complement(AAHY01098348.1:1..13586),gap(20),AAHY01098349.1:1..18738,
CO   gap(271),complement(AAHY01098350.1:1..18559),gap(20),
CO   complement(AAHY01098351.1:1..1836),gap(20),AAHY01098352.1:1..18111,gap(20),
CO   complement(AAHY01098353.1:1..7838),gap(20),AAHY01098354.1:1..4860,gap(20),
CO   AAHY01098355.1:1..19376,gap(20),complement(AAHY01098356.1:1..28312),
CO   gap(20),complement(AAHY01098357.1:1..5967),gap(20),AAHY01098358.1:1..57400)
//


spacer
spacer