spacer

EBI Dbfetch

ID   CH466626; SV 1; linear; genomic DNA; CON; MUS; 3991890 BP.
XX
AC   CH466626;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009751568 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3991890
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-3991890
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; a124e56cd1b281a24f24842ba926e856.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000210.
DR   Ensembl-Gn; ENSMUSG00000000823; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016346; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027566; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027568; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027569; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027581; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038751; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038848; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039059; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039069; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049999; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074521; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078861; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078866; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078898; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089756; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090077; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015771; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029082; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029084; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048077; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099002; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108763; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108789; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108878; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116365; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132527; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179061; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3991890
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            11879..26816
FT                   /locus_tag="mCG_125499"
FT                   /note="gene_id=mCG125499.1"
FT   mRNA            join(11879..12022,19896..20022,20231..21327)
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, transcript variant mCT126760"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT126760.1
FT                   created on 10-APR-2002"
FT   mRNA            join(11880..12022,19896..20022,20231..20291,26124..26816)
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, transcript variant mCT167811"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167811.0
FT                   created on 10-APR-2002"
FT   mRNA            join(11880..12022,19896..20022,20231..20291,26282..26644)
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, transcript variant mCT167810"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167810.0
FT                   created on 10-APR-2002"
FT   mRNA            join(11881..12022,15136..15237,19896..20022,20231..20291,
FT                   25534..26644)
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, transcript variant mCT167812"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167812.0
FT                   created on 10-APR-2002"
FT   CDS             join(12020..12022,19896..20022,20231..20291,26282..26300)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, isoform CRA_b"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167810.0
FT                   protein_id=mCP90751.0 isoform=CRA_b"
FT                   /protein_id="EDL07275.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIGY
FT                   SWEEHTIEDHFQTSRSHGSPDILW"
FT   CDS             join(12020..12022,19896..20022,20231..20291,26124..26163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, isoform CRA_c"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167811.0
FT                   protein_id=mCP90750.0 isoform=CRA_c"
FT                   /protein_id="EDL07276.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIGY
FT                   SWEEHTIEDHFQTSRSHGRFSNIHHYERETL"
FT   CDS             join(12020..12022,19896..20022,20231..20295)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, isoform CRA_a"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT126760.1
FT                   protein_id=mCP66874.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V498"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="MGI:MGI:1261426"
FT                   /db_xref="MGI:MGI:3652188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V498"
FT                   /protein_id="EDL07274.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLDASQKSLYKGVMVETYRNLTAIGY
FT                   SWEEHTIEDHFQTSRSHGR"
FT   CDS             join(12020..12022,15136..15183)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125499"
FT                   /product="mCG125499, isoform CRA_d"
FT                   /note="gene_id=mCG125499.1 transcript_id=mCT167812.0
FT                   protein_id=mCP90748.0 isoform=CRA_d"
FT                   /protein_id="EDL07277.1"
FT                   /translation="MYTLTLSLVFTSLKTQ"
FT   gene            complement(57662..69643)
FT                   /locus_tag="mCG_125498"
FT                   /note="gene_id=mCG125498.1"
FT   mRNA            complement(join(57662..59056,59309..59523,60678..60738,
FT                   60946..61072,64686..64740,69481..69643))
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, transcript variant mCT167807"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167807.0
FT                   created on 10-APR-2002"
FT   mRNA            complement(join(57662..59523,60678..60738,60946..61072,
FT                   69481..69642))
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, transcript variant mCT126759"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT126759.1
FT                   created on 10-APR-2002"
FT   mRNA            complement(join(57662..59523,60678..60738,60946..61072,
FT                   61345..61381,64809..64919))
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, transcript variant mCT167809"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167809.0
FT                   created on 10-APR-2002"
FT   CDS             complement(join(58818..59523,60678..60738,60946..61072,
FT                   69481..69483))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, isoform CRA_a"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT126759.1
FT                   protein_id=mCP66873.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AHM2"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2441662"
FT                   /db_xref="UniProtKB/TrEMBL:A2AHM2"
FT                   /protein_id="EDL07278.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIGY
FT                   IWEEHTIEDHFQTSRRHGRHEISCSAEQPSEFIQCGKAFAYESHSQRHEIKHTGEKHHD
FT                   CNQCGKAFKRRRDLQIHKRTHTGEKPYECNQCGKAFARSGDLQKHKRTHTGEKPYKCNQ
FT                   CGKAFAQSTNLRIHKRTHTGEKPYECNQCGKAFARSDDLQNHKRTHTGEKPYKCNQCGK
FT                   AFARSSHLRIHKRTHTGEKPYECKHCGKAFAESSALQIHKRTHTGEKPYECNQCGKAFV
FT                   SSGDLRKHKRTHTGEKP"
FT   CDS             complement(join(58818..59523,60678..60738,60946..61072,
FT                   61345..61381,64809..64867))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, isoform CRA_e"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167809.0
FT                   protein_id=mCP90749.0 isoform=CRA_e"
FT                   /protein_id="EDL07282.1"
FT                   /translation="MANQNLHMELPGRIGGDSSRCHGQVRGNCSFKDLVTYDDVHVNFT
FT                   QEEWALLHPSQKSLYKGVMLETYRNLTAIGYIWEEHTIEDHFQTSRRHGRHEISCSAEQ
FT                   PSEFIQCGKAFAYESHSQRHEIKHTGEKHHDCNQCGKAFKRRRDLQIHKRTHTGEKPYE
FT                   CNQCGKAFARSGDLQKHKRTHTGEKPYKCNQCGKAFAQSTNLRIHKRTHTGEKPYECNQ
FT                   CGKAFARSDDLQNHKRTHTGEKPYKCNQCGKAFARSSHLRIHKRTHTGEKPYECKHCGK
FT                   AFAESSALQIHKRTHTGEKPYECNQCGKAFVSSGDLRKHKRTHTGEKP"
FT   CDS             complement(join(58818..59056,59309..59523,60678..60738,
FT                   60946..61072,64686..64688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, isoform CRA_c"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167807.0
FT                   protein_id=mCP90752.0 isoform=CRA_c"
FT                   /protein_id="EDL07280.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIGY
FT                   IWEEHTIEDHFQTSRRHGRHEISCSAEQPSEFIQCGKAFAYESHSQRHEIKHTGEKHHD
FT                   CNQCGKAFKRRRDLQIHKRTHTGEKPYECNQCGKAFARSSHLRIHKRTHTGEKPYECKH
FT                   CGKAFAESSALQIHKRTHTGEKPYECNQCGKAFVSSGDLRKHKRTHTGEKP"
FT   mRNA            complement(join(59615..60738,60946..61072,69481..69643))
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, transcript variant mCT167806"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167806.0
FT                   created on 10-APR-2002"
FT   mRNA            complement(join(59615..60738,60946..61072,64686..64740,
FT                   69481..69643))
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, transcript variant mCT167808"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167808.0
FT                   created on 10-APR-2002"
FT   CDS             complement(join(60674..60738,60946..61072,69481..69483))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, isoform CRA_b"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167806.0
FT                   protein_id=mCP90753.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2AHM3"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="MGI:MGI:2441662"
FT                   /db_xref="UniProtKB/TrEMBL:A2AHM3"
FT                   /protein_id="EDL07279.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIGY
FT                   IWEEHTIEDHFQTSRRHGR"
FT   CDS             complement(join(60674..60738,60946..61072,64686..64688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125498"
FT                   /product="mCG125498, isoform CRA_d"
FT                   /note="gene_id=mCG125498.1 transcript_id=mCT167808.0
FT                   protein_id=mCP90746.0 isoform=CRA_d"
FT                   /db_xref="GOA:A2AHM3"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="MGI:MGI:2441662"
FT                   /db_xref="UniProtKB/TrEMBL:A2AHM3"
FT                   /protein_id="EDL07281.1"
FT                   /translation="MDLVTYDDVHVNFTQEEWALLHPSQKSLYKGVMLETYRNLTAIGY
FT                   IWEEHTIEDHFQTSRRHGR"
FT   gene            168962..330843
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /note="gene_id=mCG15214.1"
FT   mRNA            join(168962..169094,250023..250184,254228..254305,
FT                   263367..263549,272947..273156,277060..277234,
FT                   277910..278157,296960..297113,322488..322543,
FT                   325932..325993,327174..327314,328403..328479,
FT                   329858..330843)
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, transcript
FT                   variant mCT14154"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT14154.1 created
FT                   on 23-APR-2002"
FT   CDS             join(168977..169094,250023..250184,254228..254305,
FT                   263367..263549,272947..273156,277060..277234,
FT                   277910..278157,296960..297113,322488..322543,
FT                   325932..325993,327174..327314,328403..328479,
FT                   329858..329873)
FT                   /codon_start=1
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, isoform CRA_a"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT14154.1
FT                   protein_id=mCP20881.2 isoform=CRA_a"
FT                   /protein_id="EDL07283.1"
FT                   /translation="MQTANQMLSLNFRRMKSGTAAVRTRARHRPPGSGPSRCGDEMDQT
FT                   PPARSEPLVSGIRTPPVRRNSKLATLGRIFKPWKWRKKKNEKLKQTTSALEKKMAGRQG
FT                   REELIKQGLLEMMEQDSENKACSPKEGSQPVQSEPPAGEQETLTSEGAQPGSPSASGTD
FT                   QVSQDELLSSDAHLDDTANIPSASTAEEADAGSLLPTTDEPSQALAGSDSLDSPPRSLE
FT                   RSVSQLPSPPLLPTPPPKASSKATKNVTGQAALFQGPSMKNNEPALRGQLATPTGSPHV
FT                   TTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRTSSMERGKERD
FT                   EAWSFDGASENKWTATKDSEENKENLMLSSELKDDMLLYQDEEALNDSIISGTLPRKCK
FT                   KELLAVKLRNRPSKQELEDRNIFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRN
FT                   ILKQRNDQTEQEERREIKQRLTRKLNQRPTVDELRDRKILIRFSDYVEVARAQDYDRRA
FT                   DKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP"
FT   mRNA            join(<186873..186950,250023..250184,254228..254305,
FT                   263367..263549,272947..273156,277060..277234,
FT                   277910..278157,296960..297113,322488..322543,
FT                   325932..325993,327174..327314,328403..328479,
FT                   329858..330380)
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, transcript
FT                   variant mCT189948"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT189948.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<186950..186950,250023..250184,254228..254305,
FT                   263367..263549,272947..273156,277060..277234,
FT                   277910..278157,296960..297113,322488..322543,
FT                   325932..325993,327174..327314,328403..328479,
FT                   329858..329873)
FT                   /codon_start=1
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, isoform CRA_c"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT189948.0
FT                   protein_id=mCP110937.0 isoform=CRA_c"
FT                   /protein_id="EDL07285.1"
FT                   /translation="DEMDQTPPARSEPLVSGIRTPPVRRNSKLATLGRIFKPWKWRKKK
FT                   NEKLKQTTSALEKKMAGRQGREELIKQGLLEMMEQDSENKACSPKEGSQPVQSEPPAGE
FT                   QETLTSEGAQPGSPSASGTDQVSQDELLSSDAHLDDTANIPSASTAEEADAGSLLPTTD
FT                   EPSQALAGSDSLDSPPRSLERSVSQLPSPPLLPTPPPKASSKATKNVTGQAALFQGPSM
FT                   KNNEPALRGQLATPTGSPHVTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPK
FT                   KRMDVRLSRTSSMERGKERDEAWSFDGASENKWTATKDSEENKENLMLSSELKDDMLLY
FT                   QDEEALNDSIISGTLPRKCKKELLAVKLRNRPSKQELEDRNIFPRRTDEERQEIRQQIE
FT                   MKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRPTVDELRDRKI
FT                   LIRFSDYVEVARAQDYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRF
FT                   HRP"
FT   mRNA            join(321852..322543,325932..325993,327174..327314,
FT                   328403..328479,329858..330843)
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, transcript
FT                   variant mCT168254"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT168254.0 created
FT                   on 23-APR-2002"
FT   CDS             join(322453..322543,325932..325993,327174..327314,
FT                   328403..328479,329858..329873)
FT                   /codon_start=1
FT                   /gene="Phactr3"
FT                   /locus_tag="mCG_15214"
FT                   /product="phosphatase and actin regulator 3, isoform CRA_b"
FT                   /note="gene_id=mCG15214.1 transcript_id=mCT168254.0
FT                   protein_id=mCP91037.0 isoform=CRA_b"
FT                   /protein_id="EDL07284.1"
FT                   /translation="MVQNIILVFFRRRLSQRPAVEELERRNILKQRNDQTEQEERREIK
FT                   QRLTRKLNQRPTVDELRDRKILIRFSDYVEVARAQDYDRRADKPWTRLSAADKAAIRKE
FT                   LNEYKSNEMEVHASSKHLTRFHRP"
FT   gene            complement(339649..402045)
FT                   /locus_tag="mCG_15213"
FT                   /note="gene_id=mCG15213.1"
FT   mRNA            complement(join(339649..340759,341775..341831,
FT                   341925..342006,342128..342186,342574..342673,
FT                   342773..342867,344370..344479,345183..345338,
FT                   345934..346024,346804..346989,349271..349476,
FT                   350794..350992,352449..352625,354649..354822,
FT                   357294..357345,357770..357825,359052..359109,
FT                   359196..359260,362831..362867,363625..363752,
FT                   368712..369130,369271..369401,371996..372056,
FT                   372377..372446,373757..373905,375211..375310,
FT                   376196..376321,376690..376764,377823..377971,
FT                   383811..383871,386049..386144,386701..386746,
FT                   388334..388386,388474..388616,389307..389341,
FT                   389579..389664,390196..390281,395981..396005,
FT                   396270..396412,397070..397202,398018..398161,
FT                   399008..399066,401907..402045))
FT                   /locus_tag="mCG_15213"
FT                   /product="mCG15213"
FT                   /note="gene_id=mCG15213.1 transcript_id=mCT14153.2 created
FT                   on 10-APR-2002"
FT   CDS             complement(join(340685..340759,341775..341831,
FT                   341925..342006,342128..342186,342574..342673,
FT                   342773..342867,344370..344479,345183..345338,
FT                   345934..346024,346804..346989,349271..349476,
FT                   350794..350992,352449..352625,354649..354822,
FT                   357294..357345,357770..357825,359052..359109,
FT                   359196..359260,362831..362867,363625..363752,
FT                   368712..369130,369271..369401,371996..372056,
FT                   372377..372446,373757..373905,375211..375310,
FT                   376196..376321,376690..376764,377823..377971,
FT                   383811..383871,386049..386144,386701..386746,
FT                   388334..388386,388474..388616,389307..389341,
FT                   389579..389664,390196..390281,395981..396005,
FT                   396270..396412,397070..397202,398018..398161,
FT                   399008..399031))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15213"
FT                   /product="mCG15213"
FT                   /note="gene_id=mCG15213.1 transcript_id=mCT14153.2
FT                   protein_id=mCP20872.2"
FT                   /protein_id="EDL07286.1"
FT                   /translation="MPVRPDLQQLEKCIDDALRKNDFKPLLALLQIDICEDVKIKCSKQ
FT                   FLRKLDDLICRELNKKDIQTVSSILISIGRCSKNIFILGQAGLQTMIKQGLVQKIMDFK
FT                   LTNLCIHFYMVSWFENSKEIILNQQQSKDEAVMNMIEDLFDLLMVIYDISDEGKNQVLE
FT                   SFIPQICALVIDSRVNFCIQQEALKKMNLMLDRIPQDANKILSNQEMLTLMSNMGERIL
FT                   DVGDYELQVGIVEALCRMTTEKRRQELAYEWFSMDFIANAFKEIKDCEFETDCRIFLNL
FT                   VNGILGDKRRVYTFPCLSAFLGKYELQIPSDEKLEEFWIDFNLGSHTLSFYIAGDEEDH
FT                   QWEAVTVPEEKVQMYNIEVRESKKLLTLTLKNIVKISKKEGKELLFYFDESLEITNVTK
FT                   KVFGGNKYKEFTRKQGISVAKTSIHVLFDASGSQILVPESQPSPVKENLIHLKEKSDIQ
FT                   KKLVNPLELGNSSSQDEITTPSRKKMSEASMIVPDTDRYTVRSPILLINTSTPRRSREP
FT                   LQAINSVEKAVSKTSESGMDYAASPKSRQSDGRKRWNNRANHNKTTAVIQNKQYEDNES
FT                   PDQNFNEIEDTLSNVSSAVGKVDKPVLPGVLDISKNTTHSRWACWTPVTTIKLCNNQRS
FT                   RALPGDTCTQDTGVNKKCTKQKSVSDDDSEETQKGKYSKDVIKCNKSDEAEFCERNIQE
FT                   QNHPKYSQKKNTANAKKSDWHIESETTYKSVLLNKTTEESLIYKKTCVLSKDVNTTICD
FT                   KSPSRKSKRNHTKSRKELMSELTSCELEEIPVRENSKGKRFTGASESLINQISRRYNPS
FT                   DSMMSTRKLKEPQDGSGFSKKPDLQFNKVQRKSYRKLKATVVNVTSECPLDDVYNFSLN
FT                   GADEPVIKLGIQEFQATTREASMDNSLKLVKNHDEHDPFLKTKDKRMLSYEKKTLLSDT
FT                   ETECGCDDSKTDISWLKEPKTKRLMDYSRNKNTTKYKSRKSSKKLVLNKNSMKNDYEVV
FT                   VDGRTRLPRRATKTKKNYKDLSTSESESESEKECSYLFKDKLPTKEETIHSRAQTKKLP
FT                   EKQQKVFNSEALKGQPSEEQKNSSRLREGREDSLCLSSASVSRSSSSVEVMRCTEKITE
FT                   RDFTQDYDYITKSLSPYPKAPSPEFLNGNNSVVGRGQSPRISETSAMCVRKSYSPASGP
FT                   PFSPRHTPTKNNSVVNMKKANSVINNQRTQHCNSYSDVSSNSSEKLYMEPESPESCDNH
FT                   MQNKREGNHAASPLSLSSEKIEKMWFDMPSENTHVSGPSQRGSKRRMYLEDDELSNSNE
FT                   AEVEEAEEREHLLSKKRCQWENSDQHTFKTSLSTPDFSVPKDWQQELQGAGMFYDNISS
FT                   DYKRKTDSQHKIMDDFTTKTLKLTQQHLMAMTSQAQGRRDENVEKFQVTLLDELEKVEK
FT                   DSQTLRDLEKELVDIEEKLVQKMRAYHRCERERFRVLKTSLDKSFLVYNSVYEESVFTS
FT                   EMCLMKANMKMLQDKLLKEMHEEEVLNIRRGLQSLFKAHEGNDA"
FT   gene            <401624..403141
FT                   /locus_tag="mCG_140052"
FT                   /note="gene_id=mCG140052.0"
FT   mRNA            join(<401624..401851,402697..403141)
FT                   /locus_tag="mCG_140052"
FT                   /product="mCG140052"
FT                   /note="gene_id=mCG140052.0 transcript_id=mCT167813.0
FT                   created on 10-APR-2002"
FT   CDS             join(<401624..401851,402697..402834)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140052"
FT                   /product="mCG140052"
FT                   /note="gene_id=mCG140052.0 transcript_id=mCT167813.0
FT                   protein_id=mCP90747.0"
FT                   /protein_id="EDL07287.1"
FT                   /translation="QPRPPGPRASQTPHKLLPVWLPWIGVTSAAHTACPHHGHPADLPH
FT                   LQRSTPQPGNRLRPQGPSSNGASSPPGRQRKDASDIEAAVSPDNLSPAWMINDGFPIVV
FT                   PAEMLHSLRHPSTPYIP"
FT   gene            complement(405570..408823)
FT                   /locus_tag="mCG_51138"
FT                   /note="gene_id=mCG51138.1"
FT   mRNA            complement(405570..408823)
FT                   /locus_tag="mCG_51138"
FT                   /product="mCG51138"
FT                   /note="gene_id=mCG51138.1 transcript_id=mCT51321.1 created
FT                   on 10-APR-2002"
FT   CDS             complement(407728..408567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51138"
FT                   /product="mCG51138"
FT                   /note="gene_id=mCG51138.1 transcript_id=mCT51321.1
FT                   protein_id=mCP40891.0"
FT                   /db_xref="GOA:A2AJW4"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR017434"
FT                   /db_xref="MGI:MGI:1917664"
FT                   /db_xref="UniProtKB/TrEMBL:A2AJW4"
FT                   /protein_id="EDL07288.1"
FT                   /translation="MSKGSGSAPLPSTPGSRKLVPRSLSCLSDMDRRPCRPPGCDPRLR
FT                   PIIQRRSRSLPTSPERRAKAAGAPGAACGAGCNRQVRVRFADALGLELAQVKVFNAGDD
FT                   PSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFSPPIETPGFGERLARQLVCLERVT
FT                   CSDLGISGTVRVRNVAFEKQVTVRYTFSGWRSAHEAVARWRGPAGAEGTEDIFAFGFPV
FT                   PPFLLELGSQVHFALRYGVAGAEYWDNNDGRDYSLTCRSHALHMPRGECEESWIHFI"
FT   gene            <410871..>415770
FT                   /locus_tag="mCG_54925"
FT                   /note="gene_id=mCG54925.0"
FT   mRNA            join(<410871..411105,412121..412145,414633..>415770)
FT                   /locus_tag="mCG_54925"
FT                   /product="mCG54925"
FT                   /note="gene_id=mCG54925.0 transcript_id=mCT55108.0 created
FT                   on 10-APR-2002"
FT   CDS             join(410871..411105,412121..412145,414633..415770)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54925"
FT                   /product="mCG54925"
FT                   /note="gene_id=mCG54925.0 transcript_id=mCT55108.0
FT                   protein_id=mCP40898.0"
FT                   /protein_id="EDL07289.1"
FT                   /translation="MLSLRNHRHLRGFSVVVQRPKLDAVWAGCSQHLLSVFCCFQFRWR
FT                   FSLSEDKGNKEATSPAVIIWQQIEQEYSEYCREEARSAAKGCINAGSSWNQVQHSKTTS
FT                   GKRQSGSQGPHVSSQLRSSLLGISQPAAEKLMETVPTEGIQEQAALSSRYQAASGSKLF
FT                   LDFHSMEIMKGADEDSASDLSDSERVAIPPSPFTPPELNLRAEEIDPVSFSLHPELSQA
FT                   ESRQTYPDFLPPPFNSWDLRDMAVVMNSECRSEALPRATGFLGKYIDRLLQLEWLQVQT
FT                   VQCEKARAAKAKPPGASGVLKSPGRGKLLTSALSKPLPSPEGISKSGPSRKKGFRHEEA
FT                   HPSYYAFETLPNSVDGPGRPRLCSQKQAPELRMEKKKKSSKGPKLQPRAPPCAEGNPAM
FT                   EANGNIRIPRQSAVLLDPVDSHRASRTQAHVDLKKKGSANTCGYAPSSSEKKLKTNGAK
FT                   QSTYKLK"
FT   gene            416929..418774
FT                   /locus_tag="mCG_1030192"
FT                   /note="gene_id=mCG1030192.1"
FT   mRNA            416929..418774
FT                   /locus_tag="mCG_1030192"
FT                   /product="mCG1030192"
FT                   /note="gene_id=mCG1030192.1 transcript_id=mCT147896.1
FT                   created on 10-APR-2002"
FT   CDS             417402..417650
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030192"
FT                   /product="mCG1030192"
FT                   /note="gene_id=mCG1030192.1 transcript_id=mCT147896.1
FT                   protein_id=mCP66826.1"
FT                   /protein_id="EDL07290.1"
FT                   /translation="MQCPHLPEYAPCVGRTIPPCSLFPPEGGPGSTSLLLGAQTICSMT
FT                   GTSLILSLGFYADPLEASGPVNVSMTSYTRNTSSSAH"
FT   gene            <444058..>466518
FT                   /gene="Cdh26"
FT                   /locus_tag="mCG_15216"
FT                   /note="gene_id=mCG15216.2"
FT   mRNA            join(<444058..444114,451490..451637,454118..454254,
FT                   454737..454865,456648..456833,460625..460893,
FT                   462199..462341,464075..464320,465650..465865,
FT                   466388..>466518)
FT                   /gene="Cdh26"
FT                   /locus_tag="mCG_15216"
FT                   /product="cadherin-like 26"
FT                   /note="gene_id=mCG15216.2 transcript_id=mCT14157.2 created
FT                   on 11-APR-2002"
FT   CDS             join(444058..444114,451490..451637,454118..454254,
FT                   454737..454865,456648..456833,460625..460893,
FT                   462199..462341,464075..464320,465650..465865,
FT                   466388..>466518)
FT                   /codon_start=1
FT                   /gene="Cdh26"
FT                   /locus_tag="mCG_15216"
FT                   /product="cadherin-like 26"
FT                   /note="gene_id=mCG15216.2 transcript_id=mCT14157.2
FT                   protein_id=mCP20845.2"
FT                   /protein_id="EDL07291.1"
FT                   /translation="MGYGLSLCLVQSSCKVLNLVHFDAVDRSTGKVVDESLIFNIRIRD
FT                   VNDHAPQFPEKEFNISVKESQAAGQPIFQLLTVDLDQENTPNSQVLYFLVSQTPLLRES
FT                   GFRIDLISGETAPLFTLIVRASDCGEPSLTSTATIHVSVEDSNNHMPTFMEDRYEIRIS
FT                   EGQVEQGVLYLPVQDGDSPFTPAWRTQFNIWDGNEEGHFDIVTDPETNQGLLSIIKPLD
FT                   YESQVAHSLVVVVENQEQLFVCTEGQLQPLRKAMASTMVSVQVLDTNDPPAFHPQSFIV
FT                   SEEDGAWPAIQLGYFNATDPDRADSQIRYKLVHDPENWVTVDEKSGVVTTKKQIDRESP
FT                   HVNDSFYTIIVHAVDNGLPPLTGTGTLMLFLSDVNDNAPTLRPHSRHLEVCESAGSQPL
FT                   LIEAEDADLDPYADPFTFDLDNAQGDVEETWMLRTKQGEGHSAELTMLRSVPPGDYLVP
FT                   LFIADRQGLAQKQTVHVRICSCRSGSECEEPSDTWLLWWALSPVGAALMVLSAALLCLL
FT                   RCSCTFGPKRLRGFIPSDSGHQTLIVYNEESKVPSAQ"
FT   gene            <656430..659816
FT                   /locus_tag="mCG_1030200"
FT                   /note="gene_id=mCG1030200.0"
FT   mRNA            join(<656430..656591,657375..657498,659455..659816)
FT                   /locus_tag="mCG_1030200"
FT                   /product="mCG1030200"
FT                   /note="gene_id=mCG1030200.0 transcript_id=mCT147904.0
FT                   created on 11-APR-2002"
FT   CDS             join(<656430..656591,657375..657498,659455..659468)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030200"
FT                   /product="mCG1030200"
FT                   /note="gene_id=mCG1030200.0 transcript_id=mCT147904.0
FT                   protein_id=mCP66830.0"
FT                   /protein_id="EDL07292.1"
FT                   /translation="KKLQRADSAAADTRPIINSEDGEWSHKTNMEDDSLAGGRPSSLSA
FT                   SKGKGPPCSHFCMSSNEGSKMELNSLAWGSWMVLSHHVTVGNPTWVLCENSSTI"
FT   gene            complement(<857760..907012)
FT                   /locus_tag="mCG_1030202"
FT                   /note="gene_id=mCG1030202.1"
FT   mRNA            complement(join(<857760..857983,906047..906234,
FT                   906680..907012))
FT                   /locus_tag="mCG_1030202"
FT                   /product="mCG1030202"
FT                   /note="gene_id=mCG1030202.1 transcript_id=mCT147906.1
FT                   created on 11-APR-2002"
FT   CDS             complement(join(<857760..857983,906047..906234,
FT                   906680..907007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030202"
FT                   /product="mCG1030202"
FT                   /note="gene_id=mCG1030202.1 transcript_id=mCT147906.1
FT                   protein_id=mCP66831.1"
FT                   /protein_id="EDL07293.1"
FT                   /translation="MCCLTHWKVGSTRSPSIGLVSLPPLPPLPPLPPLPPLPPLPPLPP
FT                   LPPLPPLPPLPLLPPSSLPSSSLFSPSPSFLSPSCLPPFSVLLIPLLLLWLHFLLLFTL
FT                   FFLLFSRLLLHPGSLPPHPVSRPLHPVSLPLHPVSLPLHTASPPLHPVSPPLHPRSPPL
FT                   HPMSPPLHPHALRLNTLPPDPHLFSHALPLPSILPHTHFFQPSPQSPNSPPSPTLSHPP
FT                   PPHPTVSTLPHHSPSLSTPPHTPH"
FT   gene            complement(1015940..1016955)
FT                   /pseudo
FT                   /locus_tag="mCG_50352"
FT                   /note="gene_id=mCG50352.2"
FT   mRNA            complement(1015940..1016955)
FT                   /pseudo
FT                   /locus_tag="mCG_50352"
FT                   /note="gene_id=mCG50352.2 transcript_id=mCT50535.2 created
FT                   on 15-JUL-2003"
FT   gene            1172965..1174628
FT                   /locus_tag="mCG_116035"
FT                   /note="gene_id=mCG116035.1"
FT   mRNA            1172965..1174628
FT                   /locus_tag="mCG_116035"
FT                   /product="mCG116035"
FT                   /note="gene_id=mCG116035.1 transcript_id=mCT117151.1
FT                   created on 11-APR-2002"
FT   CDS             1173152..1173607
FT                   /codon_start=1
FT                   /locus_tag="mCG_116035"
FT                   /product="mCG116035"
FT                   /note="gene_id=mCG116035.1 transcript_id=mCT117151.1
FT                   protein_id=mCP66825.1"
FT                   /protein_id="EDL07294.1"
FT                   /translation="MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYT
FT                   DLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPS
FT                   VAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR"
FT   gene            complement(1294782..>1295620)
FT                   /locus_tag="mCG_1030208"
FT                   /note="gene_id=mCG1030208.1"
FT   mRNA            complement(join(1294782..1295081,1295440..>1295620))
FT                   /locus_tag="mCG_1030208"
FT                   /product="mCG1030208"
FT                   /note="gene_id=mCG1030208.1 transcript_id=mCT147912.1
FT                   created on 11-APR-2002"
FT   CDS             complement(join(1294908..1295081,1295440..>1295457))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030208"
FT                   /product="mCG1030208"
FT                   /note="gene_id=mCG1030208.1 transcript_id=mCT147912.1
FT                   protein_id=mCP66835.0"
FT                   /protein_id="EDL07295.1"
FT                   /translation="LHSEDLVLPKLLGSQVSLTVNLPCRQPLTAESSELGGGVGSPYGP
FT                   PIVTPALDQQERCDHQSF"
FT   gene            1361224..1361909
FT                   /pseudo
FT                   /locus_tag="mCG_1030165"
FT                   /note="gene_id=mCG1030165.0"
FT   mRNA            1361224..1361909
FT                   /pseudo
FT                   /locus_tag="mCG_1030165"
FT                   /note="gene_id=mCG1030165.0 transcript_id=mCT147869.1
FT                   created on 11-APR-2002"
FT   gene            1411891..1413840
FT                   /gene="4930591A17Rik"
FT                   /locus_tag="mCG_17391"
FT                   /note="gene_id=mCG17391.1"
FT   mRNA            join(1411891..1412059,1412719..1412879,1413430..1413840)
FT                   /gene="4930591A17Rik"
FT                   /locus_tag="mCG_17391"
FT                   /product="RIKEN cDNA 4930591A17"
FT                   /note="gene_id=mCG17391.1 transcript_id=mCT13838.0 created
FT                   on 11-APR-2002"
FT   CDS             join(1412799..1412879,1413430..1413732)
FT                   /codon_start=1
FT                   /gene="4930591A17Rik"
FT                   /locus_tag="mCG_17391"
FT                   /product="RIKEN cDNA 4930591A17"
FT                   /note="gene_id=mCG17391.1 transcript_id=mCT13838.0
FT                   protein_id=mCP20257.0"
FT                   /db_xref="GOA:Q9CQH6"
FT                   /db_xref="MGI:MGI:1915425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQH6"
FT                   /protein_id="EDL07296.1"
FT                   /translation="MQMGDILSTHLNELPHPLGQPHWDTHRRLAKAQPRKASLTCSGEL
FT                   PACSFVLLMVTERTSEAASVPARLFPISEPQILQFFSLKSRVTHTAQGLLQRASLATRV
FT                   PGKVRPLQACALSSCHWTHKPSH"
FT   gene            <1772342..1887387
FT                   /gene="Cdh4"
FT                   /locus_tag="mCG_116031"
FT                   /note="gene_id=mCG116031.0"
FT   mRNA            join(<1772342..1772568,1789845..1790015,1833945..1834100,
FT                   1838198..1838342,1851079..1851251,1865000..1865137,
FT                   1872742..1872927,1876787..1877040,1877653..1877795,
FT                   1880057..1880290,1881714..1881947,1884174..1884313,
FT                   1885010..1885174,1886694..1887387)
FT                   /gene="Cdh4"
FT                   /locus_tag="mCG_116031"
FT                   /product="cadherin 4"
FT                   /note="gene_id=mCG116031.0 transcript_id=mCT117147.0
FT                   created on 16-APR-2002"
FT   CDS             join(<1772344..1772568,1789845..1790015,1833945..1834100,
FT                   1838198..1838342,1851079..1851251,1865000..1865137,
FT                   1872742..1872927,1876787..1877040,1877653..1877795,
FT                   1880057..1880290,1881714..1881947,1884174..1884313,
FT                   1885010..1885174,1886694..1886900)
FT                   /codon_start=1
FT                   /gene="Cdh4"
FT                   /locus_tag="mCG_116031"
FT                   /product="cadherin 4"
FT                   /note="gene_id=mCG116031.0 transcript_id=mCT117147.0
FT                   protein_id=mCP66818.0"
FT                   /protein_id="EDL07297.1"
FT                   /translation="EFSSCVGTKGMQYETNSLDFKVGADGTVFATRELKIPSEQVAFTV
FT                   TARERQSAEQWAAMVRLLVAQTSSAHSEHKKGQTVALDPSQPPNDTLLPWPQHQSSGGL
FT                   RRQKRDWVIPPINVPENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFNID
FT                   SMSGRMYVTRPMDREERASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQVY
FT                   NGSVDEGSKPGTYVMTVTANDADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIV
FT                   TVAAGLDREKVQQYTVIVQATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTTSTFAGE
FT                   VPENRIETVVANLTVMDRDQPHSPNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKA
FT                   VDYELNRAFMLTVMVSNQAPLASGIQMSFQSTAGVTISVTDVNEAPYFPSNHKLIRLEE
FT                   GVPAGTALTTFSAVDPDRFMQQAVRYSKLSDPANWLHINTSNGQITTAAILDRESLYTK
FT                   NNVYEATFLAADNGIPPASGTGTLQIYLIDINDNAPQLLPKEAQICERPGLNAINITAA
FT                   DADMDPNIGPYVFELPFIPTTVRKNWTITRLNGDYAQLSLRILYLEAGVYDVPIIVTDS
FT                   GNPPLSNTSVIKVKVCPCDENGDCTTVGAVAAAGLGTGAIVAILICIVILLIMVLLFVV
FT                   WMKRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMEHVLSKT
FT                   PGVRRVDERPVGAEPQYPVRPVVPHPGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEG
FT                   SGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGGGEED"
FT   gene            complement(1904333..>1967807)
FT                   /locus_tag="mCG_17392"
FT                   /note="gene_id=mCG17392.1"
FT   mRNA            complement(join(1904333..1905786,1913310..1913429,
FT                   1914071..1914127,1916140..1916270,1916578..1916747,
FT                   1918376..1918490,1921403..1921550,1924106..1924351,
FT                   1925089..1925178,1927162..1927284,1928025..1928144,
FT                   1930544..1930663,1931927..1932103,1967766..>1967807))
FT                   /locus_tag="mCG_17392"
FT                   /product="mCG17392, transcript variant mCT13839"
FT                   /note="gene_id=mCG17392.1 transcript_id=mCT13839.2 created
FT                   on 16-APR-2002"
FT   mRNA            complement(join(1905406..1905786,1913310..1913429,
FT                   1914071..1914127,1915114..1915239,1916140..1916270,
FT                   1916578..1916747,1918376..1918490,1921403..1921550,
FT                   1924106..1924351,1925089..1925178,1927162..1927284,
FT                   1928025..1928144,1930544..1930663,1931927..1932087,
FT                   1967766..>1967807))
FT                   /locus_tag="mCG_17392"
FT                   /product="mCG17392, transcript variant mCT189942"
FT                   /note="gene_id=mCG17392.1 transcript_id=mCT189942.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1905619..1905786,1913310..1913429,
FT                   1914071..1914127,1916140..1916270,1916578..1916747,
FT                   1918376..1918490,1921403..1921550,1924106..1924351,
FT                   1925089..1925178,1927162..1927284,1928025..1928144,
FT                   1930544..1930663,1931927..1932103,1967766..>1967807))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17392"
FT                   /product="mCG17392, isoform CRA_a"
FT                   /note="gene_id=mCG17392.1 transcript_id=mCT13839.2
FT                   protein_id=mCP20291.2 isoform=CRA_a"
FT                   /protein_id="EDL07298.1"
FT                   /translation="RRTRPTSRTSSCPQSPLSPGMVLVRSENGQLLMIPQQALAQMQAH
FT                   AQAQPQSTMAPRPATPTGAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPTT
FT                   TLQRSPGVQPQLVLGGSAQPASLGTATAVQTGTPQRTVPGASTTSTAATETMENVKKCK
FT                   SFLSTLIKLASSGKQSTETAANVKDLVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPF
FT                   LKRSLPALRQLTPDSAAFIQQSQQQQPPASQATTALTAVVLSSSVQRTAGKTAASVTSA
FT                   LQPPVISLTQPTQVGVGKQAPPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRI
FT                   MLTTPQQIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDI
FT                   NDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPLQRRILEIGKKHGITE
FT                   LHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKSRSRQEDPEQLRLKQKAKEMQQQ
FT                   ELAQMRQRDANLTALAAIGPRKKRKVDCTGPGSGAEGSGPGAAVPGGSGVGTPRQFTRQ
FT                   RITRVNLRDLIFCLENERETSHSLLLYKAFLK"
FT   CDS             complement(join(1905619..1905786,1913310..1913429,
FT                   1914071..1914127,1915114..1915239,1916140..1916270,
FT                   1916578..1916747,1918376..1918490,1921403..1921550,
FT                   1924106..1924351,1925089..1925178,1927162..1927284,
FT                   1928025..1928144,1930544..1930663,1931927..1932087,
FT                   1967766..>1967805))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17392"
FT                   /product="mCG17392, isoform CRA_b"
FT                   /note="gene_id=mCG17392.1 transcript_id=mCT189942.0
FT                   protein_id=mCP110938.0 isoform=CRA_b"
FT                   /protein_id="EDL07299.1"
FT                   /translation="QNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAHAQAQPQ
FT                   STMAPRPATPTGAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPTTTLQRSP
FT                   GVQPQLVLGGSAQPASLGTATAVQTGTPQRTVPGASTTSTAATETMENVKKCKSFLSTL
FT                   IKLASSGKQSTETAANVKDLVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLP
FT                   ALRQLTPDSAAFIQQSQQQQPPASQATTALTAVVLSSSVQRTAGKTAASVTSALQPPVI
FT                   SLTQPTQVGVGKQAPPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQ
FT                   QIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
FT                   AGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPLQRRILEIGKKHGITELHPDVV
FT                   SYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRK
FT                   DEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK
FT                   RKVDCTGPGSGAEGSGPGAAVPGGSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHS
FT                   LLLYKAFLK"
FT   gene            1969221..1971378
FT                   /locus_tag="mCG_140081"
FT                   /note="gene_id=mCG140081.0"
FT   mRNA            join(1969221..1969560,1969815..1971378)
FT                   /locus_tag="mCG_140081"
FT                   /product="mCG140081"
FT                   /note="gene_id=mCG140081.0 transcript_id=mCT167931.0
FT                   created on 16-APR-2002"
FT   CDS             1970208..1970363
FT                   /codon_start=1
FT                   /locus_tag="mCG_140081"
FT                   /product="mCG140081"
FT                   /note="gene_id=mCG140081.0 transcript_id=mCT167931.0
FT                   protein_id=mCP90885.0"
FT                   /protein_id="EDL07300.1"
FT                   /translation="MSYITTIQTPPYPSCPLSNSLPKELCALKPKNKTNKQTPQCPHLQ
FT                   SVLGNP"
FT   gene            2017456..2027977
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /note="gene_id=mCG140087.0"
FT   mRNA            join(2017456..2017594,2017734..2017860,2019183..2019346,
FT                   2020448..2020583,2021506..2021622,2023893..2024060,
FT                   2024326..2024403,2024593..2024754,2025033..2025183,
FT                   2026219..2026403,2026831..2027977)
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), transcript
FT                   variant mCT167948"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167948.0
FT                   created on 16-APR-2002"
FT   mRNA            join(2017456..2017594,2017734..2017860,2019183..2019346,
FT                   2020448..2020583,2023845..2024060,2024293..2024403,
FT                   2024593..2024754,2025033..2025183,2026219..2026403,
FT                   2026831..2027977)
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), transcript
FT                   variant mCT167950"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167950.0
FT                   created on 16-APR-2002"
FT   mRNA            join(2017456..2017594,2017734..2017860,2019183..2019346,
FT                   2020448..2020583,2023893..2024060,2024326..2024403,
FT                   2024593..2024754,2025033..2025183,2026219..2026403,
FT                   2026831..2027977)
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), transcript
FT                   variant mCT167949"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167949.0
FT                   created on 16-APR-2002"
FT   CDS             join(2017734..2017860,2019183..2019346,2020448..2020583,
FT                   2021506..2021622,2023893..2024060,2024326..2024403,
FT                   2024593..2024754,2025033..2025183,2026219..2026390)
FT                   /codon_start=1
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167948.0
FT                   protein_id=mCP90862.0 isoform=CRA_a"
FT                   /protein_id="EDL07301.1"
FT                   /translation="MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRS
FT                   FGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSAS
FT                   ASPFQPHVPYSPFRGMPPYGQLAASSLLSQQYAASLGLEKLVSPPASAAASSPSSSPSP
FT                   QPVSELDMSSEPPQLTCKGAGFPSTPVGKSPMVEQAVQTSSVDNLNAKKLLPSKVTSAT
FT                   QLNGRQAQPSSKPASDVVQPAPVHTQGQVNDENRRPPRRRSGNRRTRNRSRGQNRPTNV
FT                   KENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDDKADKGEEKDPAVMTQSEETAA
FT                   EEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSGRFLRGRSSRG
FT                   GFRGGRGNGTTRRNPTSHRAGTGRV"
FT   CDS             join(2017734..2017860,2019183..2019346,2020448..2020583,
FT                   2023845..2024060,2024293..2024403,2024593..2024754,
FT                   2025033..2025183,2026219..2026390)
FT                   /codon_start=1
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167950.0
FT                   protein_id=mCP90841.0 isoform=CRA_c"
FT                   /protein_id="EDL07303.1"
FT                   /translation="MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRS
FT                   FGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSAS
FT                   ASPFQPHVPYSPFRGMPPYGQLAASSLLSQQYAASLGLAFLAQLFLNFPSLSTSGAGFP
FT                   STPVGKSPMVEQAVQTSSVDNLNAKKLLPSKVTSATQLNGRQAQPSSKPASGAFPHFSL
FT                   CTLDVVQPAPVHTQGQVNDENRRPPRRRSGNRRTRNRSRGQNRPTNVKENTIKFEGDFD
FT                   FESANAQFNREELDKEFKKKLNFKDDKADKGEEKDPAVMTQSEETAAEEDLLGPNCYYD
FT                   KSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSGRFLRGRSSRGGFRGGRGNGTTR
FT                   RNPTSHRAGTGRV"
FT   CDS             join(2017734..2017860,2019183..2019346,2020448..2020583,
FT                   2023893..2024060,2024326..2024403,2024593..2024754,
FT                   2025033..2025183,2026219..2026390)
FT                   /codon_start=1
FT                   /gene="Lsm14b"
FT                   /locus_tag="mCG_140087"
FT                   /product="LSM14 homolog B (SCD6, S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140087.0 transcript_id=mCT167949.0
FT                   protein_id=mCP90881.0 isoform=CRA_b"
FT                   /protein_id="EDL07302.1"
FT                   /translation="MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRS
FT                   FGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSAS
FT                   ASPFQPHVPYSPFRGMPPYGQLAASSLLSQQYAASLGLGAGFPSTPVGKSPMVEQAVQT
FT                   SSVDNLNAKKLLPSKVTSATQLNGRQAQPSSKPASDVVQPAPVHTQGQVNDENRRPPRR
FT                   RSGNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDDK
FT                   ADKGEEKDPAVMTQSEETAAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERK
FT                   LNTETFGVSGRFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV"
FT   gene            complement(2028915..2035005)
FT                   /gene="Psma7"
FT                   /locus_tag="mCG_6735"
FT                   /note="gene_id=mCG6735.2"
FT   mRNA            complement(join(2028915..2029112,2029477..2029539,
FT                   2029922..2030041,2030606..2030728,2031266..2031390,
FT                   2031894..2032020,2034836..2035005))
FT                   /gene="Psma7"
FT                   /locus_tag="mCG_6735"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 7, transcript variant mCT5496"
FT                   /note="gene_id=mCG6735.2 transcript_id=mCT5496.1 created on
FT                   16-APR-2002"
FT   mRNA            complement(join(2028915..2029112,2029477..2029539,
FT                   2029922..2030041,2030606..2030728,2031266..2031390,
FT                   2031894..2032020,2034180..>2034953))
FT                   /gene="Psma7"
FT                   /locus_tag="mCG_6735"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 7, transcript variant mCT189970"
FT                   /note="gene_id=mCG6735.2 transcript_id=mCT189970.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2029020..2029112,2029477..2029539,
FT                   2029922..2030041,2030606..2030728,2031266..2031390,
FT                   2031894..2032020,2034836..2034931))
FT                   /codon_start=1
FT                   /gene="Psma7"
FT                   /locus_tag="mCG_6735"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 7, isoform CRA_b"
FT                   /note="gene_id=mCG6735.2 transcript_id=mCT5496.1
FT                   protein_id=mCP20293.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q542H2"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:1347070"
FT                   /db_xref="UniProtKB/TrEMBL:Q542H2"
FT                   /protein_id="EDL07305.1"
FT                   /translation="MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGV
FT                   EKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTV
FT                   EYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGR
FT                   GAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNP
FT                   EEIEKYVAEIEKEKEENEKKKQKKAS"
FT   CDS             complement(join(2029020..2029112,2029477..2029539,
FT                   2029922..2030041,2030606..2030728,2031266..2031390,
FT                   2031894..2032020,2034180..>2034197))
FT                   /codon_start=1
FT                   /gene="Psma7"
FT                   /locus_tag="mCG_6735"
FT                   /product="proteasome (prosome, macropain) subunit, alpha
FT                   type 7, isoform CRA_a"
FT                   /note="gene_id=mCG6735.2 transcript_id=mCT189970.0
FT                   protein_id=mCP110963.0 isoform=CRA_a"
FT                   /protein_id="EDL07304.1"
FT                   /translation="NAYISQVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCM
FT                   AFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGIS
FT                   ALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIK
FT                   LVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
FT                   "
FT   gene            2035307..>2055996
FT                   /gene="Ss18l1"
FT                   /locus_tag="mCG_140085"
FT                   /note="gene_id=mCG140085.0"
FT   mRNA            join(2035307..2035426,2045034..2045110,2045878..2045962,
FT                   2047574..2047718,2048256..2048453,2050140..2050304,
FT                   2050643..2050744,2051891..2051983,2054476..2054595,
FT                   2055865..>2055996)
FT                   /gene="Ss18l1"
FT                   /locus_tag="mCG_140085"
FT                   /product="synovial sarcoma translocation gene on chromosome
FT                   18-like 1, transcript variant mCT167941"
FT                   /note="gene_id=mCG140085.0 transcript_id=mCT167941.0
FT                   created on 16-APR-2002"
FT   mRNA            join(2035307..2035426,2045034..2045110,2045878..2045962,
FT                   2047574..2047718,2048256..2048453,2050140..2050304,
FT                   2050643..2050744,2054476..2054595,2055865..>2055996)
FT                   /gene="Ss18l1"
FT                   /locus_tag="mCG_140085"
FT                   /product="synovial sarcoma translocation gene on chromosome
FT                   18-like 1, transcript variant mCT167940"
FT                   /note="gene_id=mCG140085.0 transcript_id=mCT167940.0
FT                   created on 16-APR-2002"
FT   CDS             join(2035358..2035426,2045034..2045110,2045878..2045962,
FT                   2047574..2047718,2048256..2048453,2050140..2050304,
FT                   2050643..2050744,2051891..2051983,2054476..2054595,
FT                   2055865..>2055996)
FT                   /codon_start=1
FT                   /gene="Ss18l1"
FT                   /locus_tag="mCG_140085"
FT                   /product="synovial sarcoma translocation gene on chromosome
FT                   18-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG140085.0 transcript_id=mCT167941.0
FT                   protein_id=mCP90865.0 isoform=CRA_b"
FT                   /protein_id="EDL07307.1"
FT                   /translation="MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILDYQSKGKTA
FT                   ECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALSQSGSSQGLHPQGS
FT                   LSDTVSTGLPPASLMQGQIGNGPNHVSMQQTAQSTLPTTSMSLSGSGHGTGPGYSHSGP
FT                   TSQSVPMQGQGAISNYVSRTNINMQSNPVSMMHQQAATSHYNSAQGGSQHYQGQAPIAM
FT                   MGQGGQGGSMMGQRPMAPYRPSQQGSSQQYLGQEEYYSEQYSHSQGSAEPMSQQYYPDG
FT                   HGDYAYQQSSYTEQSYDRSFEDPTQHYYEGGNSQYSQQQAGYQQGTAQQQTYSQQQYPN
FT                   QQSYPGQQQGYGPAQGAPSQYSSYQQGQGQQYGSYRTSQTGPSAQQQRPYGYEQA"
FT   CDS             join(2035358..2035426,2045034..2045110,2045878..2045962,
FT                   2047574..2047718,2048256..2048453,2050140..2050304,
FT                   2050643..2050744,2054476..2054595,2055865..>2055996)
FT                   /codon_start=1
FT                   /gene="Ss18l1"
FT                   /locus_tag="mCG_140085"
FT                   /product="synovial sarcoma translocation gene on chromosome
FT                   18-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG140085.0 transcript_id=mCT167940.0
FT                   protein_id=mCP90850.0 isoform=CRA_a"
FT                   /protein_id="EDL07306.1"
FT                   /translation="MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILDYQSKGKTA
FT                   ECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALSQSGSSQGLHPQGS
FT                   LSDTVSTGLPPASLMQGQIGNGPNHVSMQQTAQSTLPTTSMSLSGSGHGTGPGYSHSGP
FT                   TSQSVPMQGQGAISNYVSRTNINMQSNPVSMMHQQAATSHYNSAQGGSQHYQGQAPIAM
FT                   MGQGGQGGSMMGQRPMAPYRPSQQGSSQQYLGQEEYYSEQYSHSQGSAEPMSQQYYPDG
FT                   NSQYSQQQAGYQQGTAQQQTYSQQQYPNQQSYPGQQQGYGPAQGAPSQYSSYQQGQGQQ
FT                   YGSYRTSQTGPSAQQQRPYGYEQA"
FT   gene            2060848..2076323
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /note="gene_id=mCG6724.1"
FT   mRNA            join(2060848..2060896,2062055..2062147,2063398..2063491,
FT                   2068418..2068556,2069033..2069237,2072492..2072639,
FT                   2073771..2073886,2074490..2074708,2074877..2075015,
FT                   2075804..2076323)
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, transcript variant
FT                   mCT5505"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT5505.2 created on
FT                   17-APR-2002"
FT   mRNA            join(2060849..2060876,2062055..2062147,2063398..2063491,
FT                   2069033..2069237,2072492..2072639,2073771..2073886,
FT                   2074490..2074708,2074877..2075015,2075804..2076323)
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, transcript variant
FT                   mCT167939"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT167939.0 created
FT                   on 17-APR-2002"
FT   mRNA            join(<2060855..2060876,2062055..2062147,2063398..2063491,
FT                   2068418..2068556,2069033..2069237,2072492..2072639,
FT                   2073771..2073886,2074490..2074738,2074877..2075015,
FT                   2075804..2076319)
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, transcript variant
FT                   mCT189966"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189966.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2062054..2062147,2069033..2069237,2072492..2072639,
FT                   2073771..2073886,2075804..2076319)
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, transcript variant
FT                   mCT189968"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189968.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2062055..2062147,2063398..2063491,2069033..2069237,
FT                   2072492..2073166,2073771..2073886,2074490..2074708,
FT                   2074877..2075015,2075804..2076319)
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, transcript variant
FT                   mCT189967"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189967.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2062098..2062147,2069033..2069237,2072492..2072639,
FT                   2073771..2073886,2075804..2075908)
FT                   /codon_start=1
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, isoform CRA_d"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189968.0
FT                   protein_id=mCP110958.0 isoform=CRA_d"
FT                   /protein_id="EDL07311.1"
FT                   /translation="VVEDDLELLTFLPPPPETMVSTRLVLARTCTVFEGVLKWAPSTRA
FT                   VLRPSHLLLQASCRLLSVGIVDHAKHREPSGKKVLSEKKLKRHFVDHRRVLVRGGSGGS
FT                   GMSCFHSEPRKEFGGPDGGDGGNGGHIILRVDQQVKSLSSVLSQYQGFSGEDGGSKNCS
FT                   GRGGATLYIQWQTSQASSEVHTRTRAWASASSGTSSVVASSCLW"
FT   CDS             join(<2068426..2068556,2069033..2069237,2072492..2072639,
FT                   2073771..2073886,2074490..2074720)
FT                   /codon_start=1
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189966.0
FT                   protein_id=mCP110956.0 isoform=CRA_b"
FT                   /protein_id="EDL07309.1"
FT                   /translation="KDGSCVRNRVLRPHRHCSLCSQKDRRHGAPVWAGLALPGLSTFRT
FT                   MVSTRLVLARTCTVFEGVLKWAPSTRAVLRPSHLLLQASCRLLSVGIVDHAKHREPSGK
FT                   KVLSEKKLKRHFVDHRRVLVRGGSGGSGMSCFHSEPRKEFGGPDGGDGGNGGHIILRVD
FT                   QQVKSLSSVLSQYQGFSGEDGGSKNCSGRGGATLYIQVPVGTLVKEGDKIVADLSNLGD
FT                   EYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLELKTMAHAGMVCP"
FT   CDS             join(2069037..2069237,2072492..2072639,2073771..2073886,
FT                   2074490..2074708,2074877..2075015,2075804..2076198)
FT                   /codon_start=1
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT167939.0
FT                   protein_id=mCP90834.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AFK4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:106565"
FT                   /db_xref="UniProtKB/TrEMBL:A2AFK4"
FT                   /protein_id="EDL07308.1"
FT                   /translation="MVSTRLVLARTCTVFEGVLKWAPSTRAVLRPSHLLLQASCRLLSV
FT                   GIVDHAKHREPSGKKVLSEKKLKRHFVDHRRVLVRGGSGGSGMSCFHSEPRKEFGGPDG
FT                   GDGGNGGHIILRVDQQVKSLSSVLSQYQGFSGEDGGSKNCSGRGGATLYIQVPVGTLVK
FT                   EGDKIVADLSNLGDEYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLELKT
FT                   MAHAGMVGFPNAGKSSLLRAISNAKPAVASYPFTTLNPHVGIVHYEGHQQVAVADIPGI
FT                   IRGAHQNKGLGLSFLRHIERCRFFLFVVDLTLPEPWTQVDDLKYELEKFEEGLSERSHV
FT                   IIANKIDLPQARARLPQLQARLGQEAIGLSALTGENLEQLLLHLKELHDAHIEAELEQG
FT                   RQPLRW"
FT   CDS             join(2069037..2069237,2072492..2072639,2073771..2073886,
FT                   2074490..2074708,2074877..2075015,2075804..2076198)
FT                   /codon_start=1
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT5505.2
FT                   protein_id=mCP20292.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2AFK4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:106565"
FT                   /db_xref="UniProtKB/TrEMBL:A2AFK4"
FT                   /protein_id="EDL07312.1"
FT                   /translation="MVSTRLVLARTCTVFEGVLKWAPSTRAVLRPSHLLLQASCRLLSV
FT                   GIVDHAKHREPSGKKVLSEKKLKRHFVDHRRVLVRGGSGGSGMSCFHSEPRKEFGGPDG
FT                   GDGGNGGHIILRVDQQVKSLSSVLSQYQGFSGEDGGSKNCSGRGGATLYIQVPVGTLVK
FT                   EGDKIVADLSNLGDEYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLELKT
FT                   MAHAGMVGFPNAGKSSLLRAISNAKPAVASYPFTTLNPHVGIVHYEGHQQVAVADIPGI
FT                   IRGAHQNKGLGLSFLRHIERCRFFLFVVDLTLPEPWTQVDDLKYELEKFEEGLSERSHV
FT                   IIANKIDLPQARARLPQLQARLGQEAIGLSALTGENLEQLLLHLKELHDAHIEAELEQG
FT                   RQPLRW"
FT   CDS             join(<2073163..2073166,2073771..2073886,2074490..2074708,
FT                   2074877..2075015,2075804..2076198)
FT                   /codon_start=1
FT                   /gene="Gtpbp5"
FT                   /locus_tag="mCG_6724"
FT                   /product="GTP binding protein 5, isoform CRA_c"
FT                   /note="gene_id=mCG6724.1 transcript_id=mCT189967.0
FT                   protein_id=mCP110957.0 isoform=CRA_c"
FT                   /protein_id="EDL07310.1"
FT                   /translation="LLDQQVKSLSSVLSQYQGFSGEDGGSKNCSGRGGATLYIQVPVGT
FT                   LVKEGDKIVADLSNLGDEYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLE
FT                   LKTMAHAGMVGFPNAGKSSLLRAISNAKPAVASYPFTTLNPHVGIVHYEGHQQVAVADI
FT                   PGIIRGAHQNKGLGLSFLRHIERCRFFLFVVDLTLPEPWTQVDDLKYELEKFEEGLSER
FT                   SHVIIANKIDLPQARARLPQLQARLGQEAIGLSALTGENLEQLLLHLKELHDAHIEAEL
FT                   EQGRQPLRW"
FT   gene            complement(2089527..2094276)
FT                   /gene="Hrh3"
FT                   /locus_tag="mCG_6736"
FT                   /note="gene_id=mCG6736.3"
FT   mRNA            complement(join(2089527..2091470,2092783..2092949,
FT                   2093956..2094276))
FT                   /gene="Hrh3"
FT                   /locus_tag="mCG_6736"
FT                   /product="histamine receptor H 3, transcript variant
FT                   mCT189972"
FT                   /note="gene_id=mCG6736.3 transcript_id=mCT189972.1 created
FT                   on 29-SEP-2004"
FT   mRNA            complement(join(2089527..2091470,2092783..2093389))
FT                   /gene="Hrh3"
FT                   /locus_tag="mCG_6736"
FT                   /product="histamine receptor H 3, transcript variant
FT                   mCT5493"
FT                   /note="gene_id=mCG6736.3 transcript_id=mCT5493.2 created on
FT                   29-SEP-2004"
FT   CDS             complement(join(2090550..2091470,2092783..2092949,
FT                   2093956..2094205))
FT                   /codon_start=1
FT                   /gene="Hrh3"
FT                   /locus_tag="mCG_6736"
FT                   /product="histamine receptor H 3, isoform CRA_a"
FT                   /note="gene_id=mCG6736.3 transcript_id=mCT189972.1
FT                   protein_id=mCP110964.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q540P3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003980"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2139279"
FT                   /db_xref="UniProtKB/TrEMBL:Q540P3"
FT                   /protein_id="EDL07313.1"
FT                   /translation="MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLI
FT                   VATVLGNALVMLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGR
FT                   GLCKLWLVVDYLLCASSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLA
FT                   FLLYGPAILSWEYLSGGSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIY
FT                   LNIQRRTRLRLDGGREAGPEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAG
FT                   PGVETGEAGLGGGSGGGAAASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMV
FT                   SQSITQRFRLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFW
FT                   LLWANSAVNPVLYPLCHYSFRRAFTKLLCPQKLKVQPHGSLEQCWK"
FT   CDS             complement(2090550..2091422)
FT                   /codon_start=1
FT                   /gene="Hrh3"
FT                   /locus_tag="mCG_6736"
FT                   /product="histamine receptor H 3, isoform CRA_b"
FT                   /note="gene_id=mCG6736.3 transcript_id=mCT5493.2
FT                   protein_id=mCP20278.2 isoform=CRA_b"
FT                   /protein_id="EDL07314.1"
FT                   /translation="MALVWVLAFLLYGPAILSWEYLSGGSSIPEGHCYAEFFYNWYFLI
FT                   TASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAGPEPPPDAQPSPPPAPPSCW
FT                   GCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAAASPTSSSGSSSRGTERPR
FT                   SLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSLAIIVSIFGLCWAPYTLL
FT                   MIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFRRAFTKLLCPQKLKVQP
FT                   HGSLEQCWK"
FT   gene            2109508..2152833
FT                   /gene="Osbpl2"
FT                   /locus_tag="mCG_120599"
FT                   /note="gene_id=mCG120599.1"
FT   mRNA            join(2109508..2109606,2127121..2127254,2128355..2128499,
FT                   2131233..2131308,2134961..2135095,2135218..2135315,
FT                   2138555..2138737,2140308..2140415,2141145..2141234,
FT                   2143359..2143482,2145427..2145567,2147993..2148116,
FT                   2149220..2149310,2151641..2152833)
FT                   /gene="Osbpl2"
FT                   /locus_tag="mCG_120599"
FT                   /product="oxysterol binding protein-like 2"
FT                   /note="gene_id=mCG120599.1 transcript_id=mCT121795.1
FT                   created on 17-APR-2002"
FT   CDS             join(2127218..2127254,2128355..2128499,2131233..2131308,
FT                   2134961..2135095,2135218..2135315,2138555..2138737,
FT                   2140308..2140415,2141145..2141234,2143359..2143482,
FT                   2145427..2145567,2147993..2148116,2149220..2149310,
FT                   2151641..2151743)
FT                   /codon_start=1
FT                   /gene="Osbpl2"
FT                   /locus_tag="mCG_120599"
FT                   /product="oxysterol binding protein-like 2"
FT                   /note="gene_id=mCG120599.1 transcript_id=mCT121795.1
FT                   protein_id=mCP66860.1"
FT                   /protein_id="EDL07315.1"
FT                   /translation="MNGEEEFFDAVTGFDSDNSSIGEFSEANKISGMIDLDTSKSTRSG
FT                   KNGEKPQQENGIQKHRTALPAPMFTRSDFSVWSILKKCIGLELSKITMPIAFNEPLSFL
FT                   QRITEYMEHVYLIHKASSQSQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELI
FT                   REDLGFRFISEQVSHHPPISAFYSEGLNQDFRFHGSIYPKLKFWGKSVEAEPRGTITLE
FT                   LLKHNEAYTWTNPTCCVHNVILGQLWIEQYGIVEIVNHRTGDKCILHFKPCGLFGKELH
FT                   RVEGYIQDKNRKKLFIMYGKWTECLWGIDPASYESFKKQEKRGDQARKAKMDDGPEKAN
FT                   SDVPGDVADDVPVAQETVQVIPGSKLLWRINSRPPNSAQMYNFTSFTVSLNELESGMEK
FT                   TLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARKERAKEDAEWRTRWFSPGNN
FT                   PYTGAPDWLYAGHYFERNFSDCPDIY"
FT   gene            2161699..2166447
FT                   /locus_tag="mCG_6731"
FT                   /note="gene_id=mCG6731.3"
FT   mRNA            join(2161699..2161850,2162196..2162409,2163018..2163134,
FT                   2164072..2164195,2164471..2164557,2165027..2165108,
FT                   2165322..2165554,2165760..2165917,2166016..2166118,
FT                   2166236..2166445)
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, transcript variant mCT5501"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT5501.2 created on
FT                   17-APR-2002"
FT   mRNA            join(<2161767..2161850,2162196..2162409,2163018..2163134,
FT                   2164072..2165108,2165322..2166446)
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, transcript variant mCT189965"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT189965.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2161768..2161850,2162196..2162409,2163018..2163134,
FT                   2164072..2164269)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, isoform CRA_b"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT189965.0
FT                   protein_id=mCP110961.0 isoform=CRA_b"
FT                   /protein_id="EDL07317.1"
FT                   /translation="GLPARPGRRRGGRASPDGAPRPSVSTARMTTSGALFPSLVPGSRG
FT                   SSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIF
FT                   PDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPG
FT                   SLGASGSSGHELSALGGNYHLDLRGALSFSDWGHCEAEPA"
FT   mRNA            join(<2161821..2161850,2162196..2162409,2163018..2163134,
FT                   2165027..2165108,2165405..2165554,2165760..2165917,
FT                   2166016..2166118,2166236..2166447)
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, transcript variant mCT189964"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT189964.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2161822..2161850,2162196..2162409,2163018..2163134,
FT                   2165027..2165108,2165405..2165554,2165760..2165917,
FT                   2166016..2166118,2166236..2166342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, isoform CRA_a"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT189964.0
FT                   protein_id=mCP110960.0 isoform=CRA_a"
FT                   /protein_id="EDL07316.1"
FT                   /translation="APRPSVSTARMTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKG
FT                   TTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVY
FT                   VLKFKAGSKRLFFWMQVDLGPSLGQAWPACWGAVDLQPAALHPAASATSPSPAPSSGNG
FT                   TSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERL
FT                   LPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAA
FT                   NKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD"
FT   CDS             join(2162197..2162409,2163018..2163134,2164072..2164195,
FT                   2164471..2164557,2165027..2165108,2165322..2165554,
FT                   2165760..2165917,2166016..2166118,2166236..2166342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6731"
FT                   /product="mCG6731, isoform CRA_c"
FT                   /note="gene_id=mCG6731.3 transcript_id=mCT5501.2
FT                   protein_id=mCP20288.2 isoform=CRA_c"
FT                   /protein_id="EDL07318.1"
FT                   /translation="MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKG
FT                   LVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKR
FT                   LFFWMQEPKTDQDEEHCRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNM
FT                   SHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSST
FT                   SSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPG
FT                   GSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQAL
FT                   GMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKD
FT                   EEEDMSLD"
FT   gene            complement(2166536..2215963)
FT                   /locus_tag="mCG_6728"
FT                   /note="gene_id=mCG6728.2"
FT   mRNA            complement(join(2166536..2166926,2167050..2167169,
FT                   2167265..2167355,2167436..2167569,2167653..2167806,
FT                   2167897..2168061,2168171..2168366,2168439..2168584,
FT                   2168677..2168791,2168883..2169053,2169172..2169302,
FT                   2169414..2169690,2169768..2169916,2169998..2170120,
FT                   2170236..2170398,2170472..2170605,2170771..2170924,
FT                   2171004..2171140,2171257..2171433,2171514..2171662,
FT                   2171736..2171915,2172522..2172632,2172926..2173028,
FT                   2173123..2173264,2173479..2173633,2173777..2173893,
FT                   2174177..2174373,2174560..2174730,2175488..2175592,
FT                   2175787..2175892,2175973..2176124,2176721..2176870,
FT                   2176960..2177140,2177335..2177435,2177705..2177919,
FT                   2178018..2178098,2178424..2178551,2178726..2178839,
FT                   2179492..2179722,2180319..2180402,2180489..2180590,
FT                   2180799..2180960,2181064..2181204,2181387..2181531,
FT                   2181710..2181914,2182253..2182464,2182548..2182663,
FT                   2183022..2183161,2183563..2183689,2183851..2184052,
FT                   2184134..2184231,2184648..2184756,2184833..2184993,
FT                   2185304..2185457,2185530..2185636,2185713..2185855,
FT                   2186039..2186177,2186326..2186482,2186642..2186741,
FT                   2187130..2187235,2187320..2187369,2187467..2187572,
FT                   2187811..2187863,2188355..2188492,2188569..2188703,
FT                   2188790..2188924,2189024..2189161,2189244..2189384,
FT                   2191550..2191612,2191813..2191947,2192071..2192161,
FT                   2192253..2192371,2192484..2192599,2196835..2196932,
FT                   2197043..2197213,2197297..2197415,2198364..2198481,
FT                   2211336..2211488,2215601..2215963))
FT                   /locus_tag="mCG_6728"
FT                   /product="mCG6728, transcript variant mCT5499"
FT                   /note="gene_id=mCG6728.2 transcript_id=mCT5499.2 created on
FT                   17-APR-2002"
FT   mRNA            complement(join(2166607..2166926,2167050..2167169,
FT                   2167265..2167355,2167436..2167569,2167653..2167806,
FT                   2167897..2168061,2168171..2168366,2168439..2168584,
FT                   2168677..2168791,2168883..2169053,2169172..2169302,
FT                   2169414..2169690,2169768..2169916,2169998..2170120,
FT                   2170236..2170398,2170472..2170605,2170771..2170924,
FT                   2171004..2171140,2171257..2171433,2171514..2171662,
FT                   2171736..2171915,2172522..2172632,2172926..2173028,
FT                   2173123..2173264,2173479..2173633,2173777..2173893,
FT                   2174177..2174373,2174560..2174730,2175488..2175599,
FT                   2175782..2175892,2175973..2176124,2176721..2176870,
FT                   2176960..2177140,2177335..2177435,2177705..2177919,
FT                   2178018..2178098,2178424..2178551,2178726..2178839,
FT                   2179492..2179722,2180319..2180402,2180489..2180590,
FT                   2180799..2180960,2181064..2181204,2181387..2181531,
FT                   2181710..2181914,2182253..2182464,2182548..2182663,
FT                   2183022..2183161,2183563..2183689,2183851..2184052,
FT                   2184134..2184231,2184648..2184756,2184833..2184993,
FT                   2185304..2185457,2185530..2185636,2185713..2185855,
FT                   2186039..2186177,2186326..2186482,2186642..2186741,
FT                   2187130..2187235,2187320..2187369,2187467..2187572,
FT                   2187811..2187863,2188355..2188492,2188569..2188703,
FT                   2188790..2188924,2189024..2189161,2189244..2189384,
FT                   2191550..2191612,2191813..2191947,2192071..2192161,
FT                   2192253..2192371,2192484..2192599,2196835..2196932,
FT                   2197043..2197213,2197297..2197415,2198364..2198481,
FT                   2211336..2211488,2215601..>2215663))
FT                   /locus_tag="mCG_6728"
FT                   /product="mCG6728, transcript variant mCT189971"
FT                   /note="gene_id=mCG6728.2 transcript_id=mCT189971.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2166709..2166926,2167050..2167169,
FT                   2167265..2167355,2167436..2167569,2167653..2167806,
FT                   2167897..2168061,2168171..2168366,2168439..2168584,
FT                   2168677..2168791,2168883..2169053,2169172..2169302,
FT                   2169414..2169690,2169768..2169916,2169998..2170120,
FT                   2170236..2170398,2170472..2170605,2170771..2170924,
FT                   2171004..2171140,2171257..2171433,2171514..2171662,
FT                   2171736..2171915,2172522..2172632,2172926..2173028,
FT                   2173123..2173264,2173479..2173633,2173777..2173893,
FT                   2174177..2174373,2174560..2174730,2175488..2175592,
FT                   2175787..2175892,2175973..2176124,2176721..2176870,
FT                   2176960..2177140,2177335..2177435,2177705..2177919,
FT                   2178018..2178098,2178424..2178551,2178726..2178839,
FT                   2179492..2179722,2180319..2180402,2180489..2180590,
FT                   2180799..2180960,2181064..2181204,2181387..2181531,
FT                   2181710..2181914,2182253..2182464,2182548..2182663,
FT                   2183022..2183161,2183563..2183689,2183851..2184052,
FT                   2184134..2184231,2184648..2184756,2184833..2184993,
FT                   2185304..2185457,2185530..2185636,2185713..2185855,
FT                   2186039..2186177,2186326..2186482,2186642..2186741,
FT                   2187130..2187235,2187320..2187369,2187467..2187572,
FT                   2187811..2187863,2188355..2188492,2188569..2188703,
FT                   2188790..2188924,2189024..2189161,2189244..2189384,
FT                   2191550..2191612,2191813..2191947,2192071..2192161,
FT                   2192253..2192371,2192484..2192599,2196835..2196932,
FT                   2197043..2197213,2197297..2197415,2198364..2198481,
FT                   2211336..2211488,2215601..2215912))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6728"
FT                   /product="mCG6728, isoform CRA_b"
FT                   /note="gene_id=mCG6728.2 transcript_id=mCT5499.2
FT                   protein_id=mCP20297.2 isoform=CRA_b"
FT                   /protein_id="EDL07320.1"
FT                   /translation="MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGG
FT                   DGFSLHPPYFNLAEGARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQ
FT                   GQYCDICTAANSNKAHPVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVL
FT                   IKFANSPRPDLWVLERSTDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTT
FT                   EYSRIVPLENGEIVVSLVNGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGK
FT                   ALRDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDR
FT                   CCPGFNQQPWKPATTDSANECQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCL
FT                   DCQHHTTGINCERCLPGFFRAPDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNF
FT                   TGELCAACAEGYTDFPHCYPLPSFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPR
FT                   LGRCVCKPNFRGAHCELCAPGFHGPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDR
FT                   CDHCALGYFHFPLCQLCGCSPAGTLPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDC
FT                   HACACDPRGALDQQCGVGGLCHCRPGYTGATCQECSPGFYGFPSCIPCHCSADGSLHTT
FT                   CDPTTGQCRCRPRVTGLHCDMCVPGAYNFPYCEAGSCHPAGLAPANPALPETQAPCMCR
FT                   AHVEGPSCDRCKPGYWGLSASNPEGCTRCSCDPRGTLGGVTECQGNGQCFCKAHVCGKT
FT                   CAACKDGFFGLDYADYFGCRSCRCDVGGALGQGCEPKTGACRCRPNTQGPTCSEPAKDH
FT                   YLPDLHHMRLELEEAATPEGHAVRFGFNPLEFENFSWRGYAHMMAIQPRIVARLNVTSP
FT                   DLFRLVFRYVNRGSTSVNGQISVREEGKLSSCTNCTEQSQPVAFPPSTEPAFVTVPQRG
FT                   FGEPFVLNPGIWALLVEAEGVLLDYVVLLPSTYYEAALLQHRVTEACTYRPSALHSTEN
FT                   CLVYAHLPLDGFPSAAGTEALCRHDNSLPRPCPTEQLSPSHPPLATCFGSDVDIQLEMA
FT                   VPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAPQQGVLNLHPCPYSSLCRSPARDTQHH
FT                   LAIFHLDSEASIRLTAEQAHFFLHSVTLVPVEEFSTEFVEPRVFCVSSHGTFNPSSAAC
FT                   LASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELSPGAPPEGPQPRPPTAVDPNAEPTL
FT                   LRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPVEVLINGGRIWQGHANASFCPHGY
FT                   GCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDYVLIVPEDAYSSSYLQEEPLDKS
FT                   YDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGALPCGCHEVGAVSPTCEPFGGQ
FT                   CPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCICPPRTVPPDCLVCQPQ
FT                   SFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPNVAGRRCDTCAPGFYGYPSC
FT                   RPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTFSLDAANPKGCTRCFCFGA
FT                   TERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLHADLRSVADTFSELYWQA
FT                   PPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQGNQMSIAFLELAYPPPG
FT                   QVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALFSQTSSSVSLRRVVLE
FT                   VASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLGRCVPCQCHGHSDRC
FT                   LPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLAVPSNNFADGCVLR
FT                   NGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNMIFSDCDPLTGA
FT                   CRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSGRCLCKAGVTGQ
FT                   RCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQCLECAPGYWG
FT                   LPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPGGHGIHCEVC
FT                   DHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSKLRSPPGPR
FT                   YQAAQQLQTLEQQSISLQQDTERLGRVQGQAGQLLDTTESTLGRAQKLLESVRAVGRAL
FT                   NELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVAEAELAEAQRL
FT                   MARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREAEELNSRNQE
FT                   RLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLAASLDGAWT
FT                   PLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRAVEASNAY
FT                   SSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILGHQGRLG
FT                   LAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAEALSTA
FT                   THVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLSRLEN
FT                   RGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAAYTA
FT                   LKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPTTL
FT                   SIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVFY
FT                   VGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
FT                   DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQE
FT                   GTLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQD
FT                   NMLEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISF
FT                   GCTADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPY
FT                   QVSLREGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTT
FT                   PMLQLQPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSV
FT                   GCTPAQLIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGI
FT                   SPSHRNRLHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQV
FT                   QSRQHSRAGQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLP
FT                   ASSYSSKLPVSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVT
FT                   LELPKAKMPYVSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFS
FT                   TWVTYPKLCDGRWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKS
FT                   STARPELPAYRGCLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQ
FT                   AKPSVSPLLWH"
FT   CDS             complement(join(2166709..2166926,2167050..2167169,
FT                   2167265..2167355,2167436..2167569,2167653..2167806,
FT                   2167897..2168061,2168171..2168366,2168439..2168584,
FT                   2168677..2168791,2168883..2169053,2169172..2169302,
FT                   2169414..2169690,2169768..2169916,2169998..2170120,
FT                   2170236..2170398,2170472..2170605,2170771..2170924,
FT                   2171004..2171140,2171257..2171433,2171514..2171662,
FT                   2171736..2171915,2172522..2172632,2172926..2173028,
FT                   2173123..2173264,2173479..2173633,2173777..2173893,
FT                   2174177..2174373,2174560..2174730,2175488..2175599,
FT                   2175782..2175892,2175973..2176124,2176721..2176870,
FT                   2176960..2177140,2177335..2177435,2177705..2177919,
FT                   2178018..2178098,2178424..2178551,2178726..2178839,
FT                   2179492..2179722,2180319..2180402,2180489..2180590,
FT                   2180799..2180960,2181064..2181204,2181387..2181531,
FT                   2181710..2181914,2182253..2182464,2182548..2182663,
FT                   2183022..2183161,2183563..2183689,2183851..2184052,
FT                   2184134..2184231,2184648..2184756,2184833..2184993,
FT                   2185304..2185457,2185530..2185636,2185713..2185855,
FT                   2186039..2186177,2186326..2186482,2186642..2186741,
FT                   2187130..2187235,2187320..2187369,2187467..2187572,
FT                   2187811..2187863,2188355..2188492,2188569..2188703,
FT                   2188790..2188924,2189024..2189161,2189244..2189384,
FT                   2191550..2191612,2191813..2191947,2192071..2192161,
FT                   2192253..2192371,2192484..2192599,2196835..2196932,
FT                   2197043..2197213,2197297..2197415,2198364..2198481,
FT                   2211336..2211488,2215601..>2215663))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6728"
FT                   /product="mCG6728, isoform CRA_a"
FT                   /note="gene_id=mCG6728.2 transcript_id=mCT189971.0
FT                   protein_id=mCP110959.0 isoform=CRA_a"
FT                   /protein_id="EDL07319.1"
FT                   /translation="DLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAHPVSNAIDG
FT                   TERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFGHTY
FT                   QPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLVNGRPGA
FT                   LNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
FT                   VCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANECQSC
FT                   NCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRAPDQ
FT                   PLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLPSF
FT                   PHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFHG
FT                   PSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
FT                   LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCR
FT                   PGYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVP
FT                   GAYNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPE
FT                   GCTRCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRC
FT                   DVGGALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVR
FT                   FGFNPLEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVR
FT                   EEGKLSSCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLD
FT                   YVVLLPSTYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRH
FT                   DNSLPRPCPTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGV
FT                   AVHTPQRAPQQGVLNLHPCPYSSLCRSPARDTQHHLAIFHLDSEASIRLTAEQAHFFLH
FT                   SVTLVPVEEFSTEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPP
FT                   DLPLTQSQELSPGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLL
FT                   HGYQPVHPSFPVEVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVT
FT                   VRVPEGRWLWLDYVLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCR
FT                   NAATSLSLFYNNGALPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPN
FT                   CRPCDCGARLCDELTGQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELT
FT                   DPTCDMDSGQCRCRPNVAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHC
FT                   KENVQGSRCDQCRVGTFSLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLS
FT                   SDRQVVPHEHRPEIELLHADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSET
FT                   QRGDIFIPYESRPDVVLQGNQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVS
FT                   REELMMVLAGLEQLQIRALFSQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYR
FT                   GDSCQECAPGYYRDTKGLFLGRCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRP
FT                   GFVSSDPSNPASPCVSCPCPLAVPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGF
FT                   FGNPLVLGSSCQPCDCSGNGDPNMIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNA
FT                   LLPGNCTRCDCSPCGTETCDPQSGRCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACG
FT                   PAAKGSECHPQSGQCHCQPGTTGPQCLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCT
FT                   CPPGLSGERCDTCSQQHQVPVPGKPGGHGIHCEVCDHCVVLLLDDLERAGALLPAIREQ
FT                   LQGINASSAAWARLHRLNASIADLQSKLRSPPGPRYQAAQQLQTLEQQSISLQQDTERL
FT                   GSQATGVQGQAGQLLDTTESTLGRAQKLLESVRAVGRALNELASRMGQGSPGDALVPSG
FT                   EQLRWALAEVERLLWDMRTRDLGAQGAVAEAELAEAQRLMARVQEQLTSFWEENQSLAT
FT                   HIRDQLAQYESGLMDLREALNQAVNTTREAEELNSRNQERLKEALQWKQELSQDNATLK
FT                   ATLQAASLILGHVSELLQGIDQAKEDLEHLAASLDGAWTPLLKRMQAFSPASSKVDLVE
FT                   AAEAHAQKLNQLAINLSGIILGINQDRFIQRAVEASNAYSSILQAVQAAEDAAGQALRQ
FT                   ASRTWEMVVQRGLAAGARQLLANSSALEETILGHQGRLGLAQGRLQAAGIQLHNVWARK
FT                   NQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAEALSTATHVQSQLQGMQKNVERWQSQ
FT                   LGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLSRLENRGVHNASLALSANIGRVRKL
FT                   IAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAAYTALKFHIQSPVPAPEPGKNTGD
FT                   HFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPTTLSIDENIGEQFAAVSIDRTLQ
FT                   FGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVFYVGGYPSNFTPPEPLRFPGYL
FT                   GCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATGDPWLTDGSYLDGSGFARISF
FT                   EKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEGTLVLFYDFGSGLKKADPLQ
FT                   PPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNMLEMADAYYLGGVPPEQLP
FT                   LSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCTADLLVGRTMTFHGHGFL
FT                   PLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSLREGHVTLRFMNQEVET
FT                   QRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQLQPEEPSRLLLGGLPV
FT                   SGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQLIETSRATAQKVSR
FT                   RSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNRLHLSMLVRPHAAS
FT                   QGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRAGQWHRVSVRWGM
FT                   QQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLPVSVGFSGCLKK
FT                   LQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPYVSLELEMRPL
FT                   AAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDGRWHRVAVIM
FT                   GRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRGCLRKLLIN
FT                   GAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH"
FT   gene            2248451..2249528
FT                   /locus_tag="mCG_6739"
FT                   /note="gene_id=mCG6739.2"
FT   mRNA            join(2248451..2248533,2248707..2248769,2248874..2248937,
FT                   2249072..2249143,2249316..2249528)
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, transcript variant mCT5489"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT5489.2 created on
FT                   17-APR-2002"
FT   mRNA            join(2248451..2248533,2248656..2248769,2248874..2248937,
FT                   2249072..2249143,2249316..2249371,2249464..2249522)
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, transcript variant mCT167954"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167954.0 created
FT                   on 17-APR-2002"
FT   mRNA            join(2248463..2248533,2248707..2248769,2248874..2248937,
FT                   2249072..2249143,2249316..2249371,2249464..2249525)
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, transcript variant mCT167953"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167953.0 created
FT                   on 17-APR-2002"
FT   mRNA            join(2248549..2248769,2248874..2248937,2249072..2249143,
FT                   2249316..2249371,2249464..2249522)
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, transcript variant mCT167955"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167955.0 created
FT                   on 17-APR-2002"
FT   CDS             join(2248720..2248769,2248874..2248937,2249072..2249143,
FT                   2249316..2249371,2249464..2249473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, isoform CRA_a"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167953.0
FT                   protein_id=mCP90864.0 isoform=CRA_a"
FT                   /protein_id="EDL07321.1"
FT                   /translation="MQNDAGEFVDLYVPRKCSASNRIIAAKDHASIQMNVAEVDRTTGR
FT                   FNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSKNF"
FT   CDS             join(2248720..2248769,2248874..2248937,2249072..2249143,
FT                   2249316..2249371,2249464..2249473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, isoform CRA_a"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167954.0
FT                   protein_id=mCP90877.0 isoform=CRA_a"
FT                   /protein_id="EDL07322.1"
FT                   /translation="MQNDAGEFVDLYVPRKCSASNRIIAAKDHASIQMNVAEVDRTTGR
FT                   FNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSKNF"
FT   CDS             join(2248720..2248769,2248874..2248937,2249072..2249143,
FT                   2249316..2249371,2249464..2249473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, isoform CRA_a"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT167955.0
FT                   protein_id=mCP90853.0 isoform=CRA_a"
FT                   /protein_id="EDL07323.1"
FT                   /translation="MQNDAGEFVDLYVPRKCSASNRIIAAKDHASIQMNVAEVDRTTGR
FT                   FNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSKNF"
FT   CDS             join(2248720..2248769,2248874..2248937,2249072..2249143,
FT                   2249316..2249375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6739"
FT                   /product="mCG6739, isoform CRA_b"
FT                   /note="gene_id=mCG6739.2 transcript_id=mCT5489.2
FT                   protein_id=mCP20281.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C1L7"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C1L7"
FT                   /protein_id="EDL07324.1"
FT                   /translation="MQNDAGEFVDLYVPRKCSASNRIIAAKDHASIQMNVAEVDRTTGR
FT                   FNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSK"
FT   gene            complement(2249630..>2264637)
FT                   /gene="Cables2"
FT                   /locus_tag="mCG_6732"
FT                   /note="gene_id=mCG6732.2"
FT   mRNA            complement(join(2249630..2251269,2251361..2251565,
FT                   2251730..2251836,2252163..2252266,2252602..2252767,
FT                   2253203..2253311,2255300..2255392,2255489..2255560,
FT                   2264423..>2264637))
FT                   /gene="Cables2"
FT                   /locus_tag="mCG_6732"
FT                   /product="Cdk5 and Abl enzyme substrate 2, transcript
FT                   variant mCT167947"
FT                   /note="gene_id=mCG6732.2 transcript_id=mCT167947.0 created
FT                   on 17-APR-2002"
FT   mRNA            complement(join(2249630..2250460,2251241..2251269,
FT                   2251361..2251565,2251730..2251836,2252163..2252266,
FT                   2252602..2252767,2253203..2253311,2254164..2254241,
FT                   2255300..2255392,2255489..>2255560))
FT                   /gene="Cables2"
FT                   /locus_tag="mCG_6732"
FT                   /product="Cdk5 and Abl enzyme substrate 2, transcript
FT                   variant mCT5494"
FT                   /note="gene_id=mCG6732.2 transcript_id=mCT5494.2 created on
FT                   17-APR-2002"
FT   CDS             complement(join(2250433..2250460,2251241..2251269,
FT                   2251361..2251565,2251730..2251836,2252163..2252266,
FT                   2252602..2252767,2253203..2253311,2254164..2254241,
FT                   2255300..2255392,2255489..>2255559))
FT                   /codon_start=1
FT                   /gene="Cables2"
FT                   /locus_tag="mCG_6732"
FT                   /product="Cdk5 and Abl enzyme substrate 2, isoform CRA_a"
FT                   /note="gene_id=mCG6732.2 transcript_id=mCT5494.2
FT                   protein_id=mCP20308.2 isoform=CRA_a"
FT                   /protein_id="EDL07325.1"
FT                   /translation="RRVTSQRCSLEFLEDTVGCASVQRTKHASGSPRHKGLKKTHFIKN
FT                   MRQYDTKNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMV
FT                   FELEGVELGADGKVVSYAKFLYPTNALVIHKNDSHGLLPQPRPSIPRAPPGSRHKPVPT
FT                   KSTPAGTELGSDGGDAVEYNPNLLDDPQWPCGKHKRVLIFASYMTTVIEYVKPADLKKD
FT                   MNETFREKFPHIKLTLSKIRSLKREMRNLSEECSLEPVTVSMAYVYFEKLVLQGKLNKQ
FT                   NRKLCAGACVLLAAKISSDLRKSEVKQLIDKLEERFRFNRQWPIQACC"
FT   CDS             complement(join(2251129..2251269,2251361..2251565,
FT                   2251730..2251836,2252163..2252266,2252602..2252767,
FT                   2253203..2253311,2255300..2255392,2255489..2255560,
FT                   2264423..>2264637))
FT                   /codon_start=1
FT                   /gene="Cables2"
FT                   /locus_tag="mCG_6732"
FT                   /product="Cdk5 and Abl enzyme substrate 2, isoform CRA_b"
FT                   /note="gene_id=mCG6732.2 transcript_id=mCT167947.0
FT                   protein_id=mCP90838.0 isoform=CRA_b"
FT                   /protein_id="EDL07326.1"
FT                   /translation="AAARRRGAAAHSSMAAAAAGGAPGPAPGPSRPAPAARNPSDVPRR
FT                   RGDSRRRQAALFFLNNISLDGPPPSLGRRVTSQRCSLEFLEDTVGCASVQRTKHASGSP
FT                   RHKGLKKTHFIKNMRQYDTKNSSDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGK
FT                   VVSYAKFLYPTNALVIHKNDSHGLLPQPRPSIPRAPPGSRHKPVPTKSTPAGTELGSDG
FT                   GDAVEYNPNLLDDPQWPCGKHKRVLIFASYMTTVIEYVKPADLKKDMNETFREKFPHIK
FT                   LTLSKIRSLKREMRNLSEECSLEPVTVSMAYVYFEKLVLQGKLNKQNRKLCAGACVLLA
FT                   AKISSDLRKSEVKQLIDKLEERFRFNRKDLIGFEFTVLVALELALYLPENQVLPHYRRL
FT                   TQQF"
FT   gene            complement(2268787..>2281023)
FT                   /gene="BC066135"
FT                   /locus_tag="mCG_140076"
FT                   /note="gene_id=mCG140076.1"
FT   mRNA            complement(join(2268787..2269242,2269335..2269405,
FT                   2269737..2269863,2270243..2270954,2271964..2272127,
FT                   2272328..2272410,2272515..2272657,2272797..2272869,
FT                   2273234..2273346,2273612..2273707,2274448..2274490,
FT                   2275928..2276062,2280918..>2281023))
FT                   /gene="BC066135"
FT                   /locus_tag="mCG_140076"
FT                   /product="cDNA sequence BC066135, transcript variant
FT                   mCT189956"
FT                   /note="gene_id=mCG140076.1 transcript_id=mCT189956.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2269084..2269242,2269335..2269405,
FT                   2269737..2269863,2270243..2270954,2271964..2272127,
FT                   2272328..2272410,2272515..2272657,2272797..2272869,
FT                   2273234..2273346,2273612..2273707,2274448..2274490,
FT                   2275928..2276062,2280918..>2281023))
FT                   /codon_start=1
FT                   /gene="BC066135"
FT                   /locus_tag="mCG_140076"
FT                   /product="cDNA sequence BC066135, isoform CRA_b"
FT                   /note="gene_id=mCG140076.1 transcript_id=mCT189956.0
FT                   protein_id=mCP110932.0 isoform=CRA_b"
FT                   /protein_id="EDL07328.1"
FT                   /translation="VKILSCKFILLAPISPGWGSLRTEAPGGPRLAKWPCWTQKGSRGP
FT                   RPPHSQCSVAIVQGVMDSFMESLNRLKEAHEKEVLGLQNKLLELNSERCRDAQRVEELF
FT                   AKNHQLREQQKALKENLRVLENRLRAGLCDRCMVTQELARKKQLELENAHLQSLQHLCI
FT                   LTNEMNGLREENKILKEEVKRLRSLGDKTAPQAWEGTSEPPSPLPLPSPSSWKGTTENP
FT                   PGAPEEAEEEQSGTDKISSHKTSPVSRVSPAANLPEPRALDMTPQCISNQLHSTVAVVR
FT                   PGSRACPPDSGSADGTPPPSTRSTPPSPTYEHGLPVDSFLRASRPSAIAYETLKHSLQT
FT                   DRLCLLNRQLSLRLQSPHSSPLASAVAPHSPLPRGLKAREAEAWEEPGALVGMQDPRLE
FT                   GALHLLLVQQHLRARARASTARLQVPSAPEEMPSSPPAGSDSEGSDSEAPKPALSTEAQ
FT                   PDGWHPQTTGQGSSQRKETHVATQDCPPDKPLDLSDRGRCRDISKSTGQPLPLSPKIVY
FT                   TPSPQLPTLSRPLVPSSHTLSNVSTETRAQESEEYSTPKDTSHPLPGVCMGLTSPGRTA
FT                   EEAGGRPQPGPHLQRPDTGGTTEPKKVRAQRLALEQLEESDTSDTKAGLISEASAEPSM
FT                   PGVGHAEDHQQSQQQKRKRASDLQDKGTYLREGKAGPGM"
FT   mRNA            complement(join(<2269699..2269863,2270243..2270954,
FT                   2271964..2272127,2272328..2272410,2272575..2272657,
FT                   2272797..2272869,2273234..2273346,2273612..2273707,
FT                   2274448..2274490,2275928..2276062,2280918..2281023))
FT                   /gene="BC066135"
FT                   /locus_tag="mCG_140076"
FT                   /product="cDNA sequence BC066135, transcript variant
FT                   mCT167906"
FT                   /note="gene_id=mCG140076.1 transcript_id=mCT167906.0
FT                   created on 17-APR-2002"
FT   CDS             complement(join(2269699..2269863,2270243..2270954,
FT                   2271964..2272127,2272328..2272410,2272575..2272657,
FT                   2272797..2272869,2273234..2273346,2273612..2273707,
FT                   2274448..2274490,2275928..2275988))
FT                   /codon_start=1
FT                   /gene="BC066135"
FT                   /locus_tag="mCG_140076"
FT                   /product="cDNA sequence BC066135, isoform CRA_a"
FT                   /note="gene_id=mCG140076.1 transcript_id=mCT167906.0
FT                   protein_id=mCP90854.0 isoform=CRA_a"
FT                   /protein_id="EDL07327.1"
FT                   /translation="MDSFMESLNRLKEAHEKEVLGLQNKLLELNSERCRDAQRVEELFA
FT                   KNHQLREQQKALKENLRVLENRLRAGLCDRCMVTQELARKKQLELENAHLQSLQHLCIL
FT                   TNEMNGLREENKILKEEVKRLRSLGDKTAPQAWEGTSEPPSPLPLPSPSSWKDKISSHK
FT                   TSPVSRVSPAANLPEPRALDMTPQCISNQLHSTVAVVRPGSRACPPDSGSADGTPPPST
FT                   RSTPPSPTYEHGLPVDSFLRASRPSAIAYETLKHSLQTDRLCLLNRQLSLRLQSPHSSP
FT                   LASAVAPHSPLPRGLKAREAEAWEEPGALVGMQDPRLEGALHLLLVQQHLRARARASTA
FT                   RLQVPSAPEEMPSSPPAGSDSEGSDSEAPKPALSTEAQPDGWHPQTTGQGSSQRKETHV
FT                   ATQDCPPDKPLDLSDRGRCRDISKSTGQPLPLSPKIVYTPSPQLPTLSRPLVPSSHTLS
FT                   NVSTETRAQESEEYSTPKDTSHPLPGVCMGLTSPGRTAEEAGGRPQPGPHLQRPDTGGT
FT                   TGNVSTQSTSSQK"
FT   gene            2301324..2305160
FT                   /locus_tag="mCG_140074"
FT                   /note="gene_id=mCG140074.0"
FT   mRNA            join(2301324..2301442,2304729..2305160)
FT                   /locus_tag="mCG_140074"
FT                   /product="mCG140074"
FT                   /note="gene_id=mCG140074.0 transcript_id=mCT167904.0
FT                   created on 17-APR-2002"
FT   CDS             join(2301415..2301442,2304729..2304955)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140074"
FT                   /product="mCG140074"
FT                   /note="gene_id=mCG140074.0 transcript_id=mCT167904.0
FT                   protein_id=mCP90848.0"
FT                   /protein_id="EDL07329.1"
FT                   /translation="MKSLWSLIKYSCRIEPGPFPVCHDLVFPYCVCNDPVFRGHTEVLG
FT                   IWIPTCFPLGEHCSLGRALFPWESTVPLGEHCSPAGGAA"
FT   gene            complement(2318034..2327572)
FT                   /gene="Gata5"
FT                   /locus_tag="mCG_120582"
FT                   /note="gene_id=mCG120582.0"
FT   mRNA            complement(join(2318034..2319921,2320256..2320380,
FT                   2320661..2320748,2321208..2321333,2325195..2325370,
FT                   2326725..2327572))
FT                   /gene="Gata5"
FT                   /locus_tag="mCG_120582"
FT                   /product="GATA binding protein 5"
FT                   /note="gene_id=mCG120582.0 transcript_id=mCT121773.0
FT                   created on 17-APR-2002"
FT   CDS             complement(join(2319766..2319921,2320256..2320380,
FT                   2320661..2320748,2321208..2321333,2325195..2325370,
FT                   2326725..2327268))
FT                   /codon_start=1
FT                   /gene="Gata5"
FT                   /locus_tag="mCG_120582"
FT                   /product="GATA binding protein 5"
FT                   /note="gene_id=mCG120582.0 transcript_id=mCT121773.0
FT                   protein_id=mCP66768.1"
FT                   /db_xref="GOA:P97489"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR008013"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR016375"
FT                   /db_xref="InterPro:IPR028372"
FT                   /db_xref="MGI:MGI:109497"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97489"
FT                   /protein_id="EDL07330.1"
FT                   /translation="MYQSLALAQSPGQGTYADSGAFLHSSGTGSPVFVAPTRMPSMLPY
FT                   LPSCEPGSQAPALAAHSSWTQAVAADSSAFGSGSPHPPAAHPPGATTFPFAHSPPGSGS
FT                   GGSAGVRDGGAFQGALLAREQYPTPLGRPMGASYPTTYPAYMSSDVAPSWTSGAFDSSI
FT                   LHGLQARPGGLPGRRTSFVPDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGL
FT                   YHKMNGVNRPLVRPQKRLSSSRRSGLCCSNCHTATTTLWRRNSEGEPVCNACGLYMKLH
FT                   GVPRPLAMKKESIQTRKRKPKNPAKIKGSSGSTANTTASSPTLLNSESSATTLKAESSL
FT                   ASPVCAGPTITSQASSPADESLASSHLEFKFEPEDFAFTSSSMSPQAGLSGVLRQETWC
FT                   ALALA"
FT   gene            2325756..2333631
FT                   /locus_tag="mCG_140075"
FT                   /note="gene_id=mCG140075.0"
FT   mRNA            join(2325756..2325927,2326567..2326842,2327081..2327220,
FT                   2332101..2332265,2332707..2333631)
FT                   /locus_tag="mCG_140075"
FT                   /product="mCG140075"
FT                   /note="gene_id=mCG140075.0 transcript_id=mCT167905.0
FT                   created on 17-APR-2002"
FT   CDS             join(2325870..2325927,2326567..2326842,2327081..2327220,
FT                   2332101..2332130)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140075"
FT                   /product="mCG140075"
FT                   /note="gene_id=mCG140075.0 transcript_id=mCT167905.0
FT                   protein_id=mCP90872.0"
FT                   /db_xref="GOA:Q8CEM4"
FT                   /db_xref="MGI:MGI:3650386"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CEM4"
FT                   /protein_id="EDL07331.1"
FT                   /translation="MQAVRRWLRAGRISHLLAGAILGGNLRGRTRQKSPDCRRTHLGFL
FT                   HFVARGFIAARLSFRARSTGQPQPGTHRSWSCGQGGHQGELADRAGCCCRRLRRSTKGL
FT                   RRNSCMLAGVRGERGSLRARLTRRQVRQHGGHASGCHEHRGAGSRRVQKGSGVGVNCGV
FT                   SAAP"
FT   gene            complement(2363389..>2379327)
FT                   /locus_tag="mCG_140080"
FT                   /note="gene_id=mCG140080.1"
FT   mRNA            complement(join(2363389..2364128,2364570..2364690,
FT                   2375006..2375165,2376180..2376281,2379044..>2379327))
FT                   /locus_tag="mCG_140080"
FT                   /product="mCG140080, transcript variant mCT185269"
FT                   /note="gene_id=mCG140080.1 transcript_id=mCT185269.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(2363389..2364128,2364570..2364690,
FT                   2373689..2373732,2375006..2375165,2375532..2375954,
FT                   2376180..2376281,2378675..>2378787))
FT                   /locus_tag="mCG_140080"
FT                   /product="mCG140080, transcript variant mCT167930"
FT                   /note="gene_id=mCG140080.1 transcript_id=mCT167930.1
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(2363990..2364128,2364570..2364690,
FT                   2373689..2373732,2375006..>2375088))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140080"
FT                   /product="mCG140080, isoform CRA_a"
FT                   /note="gene_id=mCG140080.1 transcript_id=mCT167930.1
FT                   protein_id=mCP90860.1 isoform=CRA_a"
FT                   /protein_id="EDL07332.1"
FT                   /translation="NQLPYVLGPSPAIPSVHHAESQGSQVERMTLQAMRDTRPRIAGYR
FT                   KWILEGVICGYPLAADGPCSLGWCTWRLLSWSLLTLFGLIFSRLLDFGIPSPQIQPPRR
FT                   PQPSPALVTLAFGSRQLSPPSCSC"
FT   CDS             complement(join(2364012..2364128,2364570..2364690,
FT                   2375006..>2375088))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140080"
FT                   /product="mCG140080, isoform CRA_b"
FT                   /note="gene_id=mCG140080.1 transcript_id=mCT185269.0
FT                   protein_id=mCP106527.0 isoform=CRA_b"
FT                   /protein_id="EDL07333.1"
FT                   /translation="NQLPYVLGPSPAIPSVHHAESQGSQVERLQEMDPRRSHLWISPCS
FT                   RWSLFSWLVHLAPPQLVPFDTVWTDFQQAPGLWHPFSTNTATKKATAIPSPGDAGLWQQ
FT                   TA"
FT   gene            2454136..2468031
FT                   /gene="Slco4a1"
FT                   /locus_tag="mCG_6727"
FT                   /note="gene_id=mCG6727.1"
FT   mRNA            join(2454136..2454305,2457048..2457935,2458705..2458795,
FT                   2460166..2460287,2460675..2460786,2464268..2464422,
FT                   2465218..2465413,2465569..2465734,2465825..2465997,
FT                   2466267..2466331,2466678..2466826,2467269..2468031)
FT                   /gene="Slco4a1"
FT                   /locus_tag="mCG_6727"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4a1, transcript variant mCT5503"
FT                   /note="gene_id=mCG6727.1 transcript_id=mCT5503.2 created on
FT                   18-APR-2002"
FT   mRNA            join(2454137..2454305,2457048..2457935,2458705..2458795,
FT                   2460166..2460287,2460675..2460786,2464268..2464422,
FT                   2465218..2465413,2465569..2465997,2466267..2466331,
FT                   2466678..2466826,2467269..2468031)
FT                   /gene="Slco4a1"
FT                   /locus_tag="mCG_6727"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4a1, transcript variant mCT167946"
FT                   /note="gene_id=mCG6727.1 transcript_id=mCT167946.0 created
FT                   on 18-APR-2002"
FT   CDS             join(2457134..2457935,2458705..2458795,2460166..2460287,
FT                   2460675..2460786,2464268..2464422,2465218..2465413,
FT                   2465569..2465997,2466267..2466331,2466678..2466826,
FT                   2467269..2467409)
FT                   /codon_start=1
FT                   /gene="Slco4a1"
FT                   /locus_tag="mCG_6727"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4a1, isoform CRA_a"
FT                   /note="gene_id=mCG6727.1 transcript_id=mCT167946.0
FT                   protein_id=mCP90878.0 isoform=CRA_a"
FT                   /protein_id="EDL07334.1"
FT                   /translation="MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRS
FT                   AHGTLGSSSQPLFEPQAEKRSSQTAREVQYVSSGPQNSLCGWQAFTPKCLQVFNTPKGF
FT                   LFFLCAASFLQGMTVNGFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFG
FT                   GNGHKPRWLGWGVLVLGIGSLVFALPHFTAGRYEVEMDEGLGTGTCLTNQSHVECKDSA
FT                   SGLSNYRLIFMLGQLLHGVGATPLYTLGVTYLDENVKSSYSPIYIAIFYTAAILGPAAG
FT                   YLIGGAMLNVYTEVGQRTELTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPGS
FT                   QRYVVMRAAETQQLKDHSRGAVSNPAFGKTVRDLPLSIWLLLRNPTFILLCLAGATEAT
FT                   LIAGMSTFGPKFFEAQFSLSASEAATLFGYLVVPAGGGGTLLGGFLVNKFKLRGSGIIR
FT                   FCLFCTLTSLLAFFVFLMHCPNVHMAGVTTGYVGSLLPKGQLDLKAACNAIYCCQPKHY
FT                   SPLCGSDGTMYYSPCYAGCPADAETDLGGQKVSVATPTSPSLAGTRKLLPLCDQHCCWA
FT                   PQVYRGCSCILEKASSGWGNATAGKCASTCQSKPFLLVLVFVVIIFTFLSSIPALTATL
FT                   RCVSDRQRSFALGIQWIVVRTLGSIPGPIAFGWVIDKACLLWQDQCGHQGSCFVYENEA
FT                   MSRYMLIAGLTFKVLGFLFFVAAYFLYKSPSVSSDGLEASLPSQSSASDSPTEQLQSNV
FT                   "
FT   CDS             join(2457134..2457935,2458705..2458795,2460166..2460287,
FT                   2460675..2460786,2464268..2464422,2465218..2465413,
FT                   2465569..2465734,2465825..2465997,2466267..2466331,
FT                   2466678..2466826,2467269..2467409)
FT                   /codon_start=1
FT                   /gene="Slco4a1"
FT                   /locus_tag="mCG_6727"
FT                   /product="solute carrier organic anion transporter family,
FT                   member 4a1, isoform CRA_b"
FT                   /note="gene_id=mCG6727.1 transcript_id=mCT5503.2
FT                   protein_id=mCP20266.1 isoform=CRA_b"
FT                   /protein_id="EDL07335.1"
FT                   /translation="MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRS
FT                   AHGTLGSSSQPLFEPQAEKRSSQTAREVQYVSSGPQNSLCGWQAFTPKCLQVFNTPKGF
FT                   LFFLCAASFLQGMTVNGFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFG
FT                   GNGHKPRWLGWGVLVLGIGSLVFALPHFTAGRYEVEMDEGLGTGTCLTNQSHVECKDSA
FT                   SGLSNYRLIFMLGQLLHGVGATPLYTLGVTYLDENVKSSYSPIYIAIFYTAAILGPAAG
FT                   YLIGGAMLNVYTEVGQRTELTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPGS
FT                   QRYVVMRAAETQQLKDHSRGAVSNPAFGKTVRDLPLSIWLLLRNPTFILLCLAGATEAT
FT                   LIAGMSTFGPKFFEAQFSLSASEAATLFGYLVVPAGGGGTLLGGFLVNKFKLRGSGIIR
FT                   FCLFCTLTSLLAFFVFLMHCPNVHMAGVTTGYVGSLLPKGQLDLKAACNAIYCCQPKHY
FT                   SPLCGSDGTMYYSPCYAGCPADAETDLGGQKVYRGCSCILEKASSGWGNATAGKCASTC
FT                   QSKPFLLVLVFVVIIFTFLSSIPALTATLRCVSDRQRSFALGIQWIVVRTLGSIPGPIA
FT                   FGWVIDKACLLWQDQCGHQGSCFVYENEAMSRYMLIAGLTFKVLGFLFFVAAYFLYKSP
FT                   SVSSDGLEASLPSQSSASDSPTEQLQSNV"
FT   gene            2492927..2538807
FT                   /gene="Ntsr1"
FT                   /locus_tag="mCG_6723"
FT                   /note="gene_id=mCG6723.1"
FT   mRNA            join(2492927..2494083,2532370..2532586,2535183..2535273,
FT                   2536281..2538225,2538524..2538807)
FT                   /gene="Ntsr1"
FT                   /locus_tag="mCG_6723"
FT                   /product="neurotensin receptor 1"
FT                   /note="gene_id=mCG6723.1 transcript_id=mCT5504.2 created on
FT                   19-APR-2002"
FT   CDS             join(2493370..2494083,2532370..2532586,2535183..2535273,
FT                   2536281..2536533)
FT                   /codon_start=1
FT                   /gene="Ntsr1"
FT                   /locus_tag="mCG_6723"
FT                   /product="neurotensin receptor 1"
FT                   /note="gene_id=mCG6723.1 transcript_id=mCT5504.2
FT                   protein_id=mCP20263.2"
FT                   /db_xref="GOA:A2ACT4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003984"
FT                   /db_xref="InterPro:IPR003985"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97386"
FT                   /db_xref="UniProtKB/TrEMBL:A2ACT4"
FT                   /protein_id="EDL07336.1"
FT                   /translation="MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSE
FT                   SILEPNSNLDVNTDIYSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYH
FT                   LGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLS
FT                   VERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGL
FT                   VCTPTVDTATVKVVIQVNTFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVG
FT                   THNSLEHSTFNMSIEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWT
FT                   TFLFDFYHYFYMLTNALFYVSSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRP
FT                   TFSRKPNSMSSNHAFSTSATRETLY"
FT   gene            2575037..2580121
FT                   /locus_tag="mCG_6726"
FT                   /note="gene_id=mCG6726.2"
FT   mRNA            join(2575037..2575352,2576427..2576771,2577217..2577338,
FT                   2578222..2578303,2578510..2578687,2579117..2580121)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT167945"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167945.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2575037..2575352,2576427..2576771,2577217..2577338,
FT                   2578222..2578303,2578613..2578687,2579117..2580121)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT5507"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT5507.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(2576426..2576771,2577217..2577338,2578222..2578303,
FT                   2578613..2579022)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT167943"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167943.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2576547..2576771,2578222..2578303,2578510..2578687,
FT                   2579117..2580106)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT185613"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT185613.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2576573..2576771,2577217..2578687,2579117..2580106)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT167944"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167944.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2576579..2576771,2577217..2577338,2578222..2578687,
FT                   2579117..2580106)
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, transcript variant mCT185612"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT185612.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(2576624..2576771,2577217..2577338,2578222..2578303,
FT                   2578613..2578687,2579117..2579304)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_f"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT5507.2
FT                   protein_id=mCP20254.1 isoform=CRA_f"
FT                   /db_xref="GOA:Q9DAT2"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="MGI:MGI:1920497"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAT2"
FT                   /protein_id="EDL07342.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERN
FT                   FVLPDEIIQEVREGKVVIEEEMKEEMKEDVDPHSGADDVFSSSGSLGKALEKSSKDKEK
FT                   NSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT"
FT   CDS             join(2576624..2576771,2577217..2577338,2578222..2578303,
FT                   2578613..2578857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_a"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167943.0
FT                   protein_id=mCP90876.0 isoform=CRA_a"
FT                   /protein_id="EDL07337.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERN
FT                   FVLPDEIIQEVREGKVVIEEEMKEEMKEDVDPHSGADDGECELPFGANMSPPQSPHRRP
FT                   ASGRVRSGSHGVKSEWSLKDELSAGHLRQDGPWGP"
FT   CDS             join(2576624..2576771,2577217..2577338,2578222..2578303,
FT                   2578510..2578628)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_c"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167945.1
FT                   protein_id=mCP90846.0 isoform=CRA_c"
FT                   /protein_id="EDL07339.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERN
FT                   FVLPDEIIQEVREGLCGQRESEAVMARPSPSAGHHRGFPVNGSCLLHRKSGH"
FT   CDS             join(2576624..2576771,2577217..2577338,2578222..2578590)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_d"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT185612.0
FT                   protein_id=mCP106870.0 isoform=CRA_d"
FT                   /protein_id="EDL07340.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERN
FT                   FVLPDEIIQEVREGETRPPPGLGIKKASPGQRWGGLGPPGRCKDPAQTMPPVAPGRFWE
FT                   PRAGESGAQRQSPDGCRLVMDAEACVGSENRKQSWPDRPPALATTVGFQ"
FT   CDS             join(2576624..2576771,2578222..2578232)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_e"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT185613.0
FT                   protein_id=mCP106871.0 isoform=CRA_e"
FT                   /protein_id="EDL07341.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVARV"
FT   CDS             join(2576624..2576771,2577217..2577374)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6726"
FT                   /product="mCG6726, isoform CRA_b"
FT                   /note="gene_id=mCG6726.2 transcript_id=mCT167944.1
FT                   protein_id=mCP90833.0 isoform=CRA_b"
FT                   /protein_id="EDL07338.1"
FT                   /translation="MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLG
FT                   HKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALVSWILACPFTG"
FT   gene            2583258..2589616
FT                   /gene="Ogfr"
FT                   /locus_tag="mCG_6721"
FT                   /note="gene_id=mCG6721.2"
FT   mRNA            join(2583258..2583437,2584799..2584867,2585429..2585507,
FT                   2586239..2586317,2586916..2586982,2587382..2587530,
FT                   2588020..2589616)
FT                   /gene="Ogfr"
FT                   /locus_tag="mCG_6721"
FT                   /product="opioid growth factor receptor"
FT                   /note="gene_id=mCG6721.2 transcript_id=mCT5508.2 created on
FT                   19-APR-2002"
FT   CDS             join(2583297..2583437,2584799..2584867,2585429..2585507,
FT                   2586239..2586317,2586916..2586982,2587382..2587530,
FT                   2588020..2589310)
FT                   /codon_start=1
FT                   /gene="Ogfr"
FT                   /locus_tag="mCG_6721"
FT                   /product="opioid growth factor receptor"
FT                   /note="gene_id=mCG6721.2 transcript_id=mCT5508.2
FT                   protein_id=mCP20287.2"
FT                   /protein_id="EDL07343.1"
FT                   /translation="MDDPECDSTWEDESEEDGEDGQADDTTDEDTGDDDGDAEEARPSL
FT                   FQSRMTRYRNWRAMQDMQRYRHNYPDLTDQDCNGDMCNLSFYKNEICFQPNGFLIEDIL
FT                   QNWKDNYDLLEENHSYIQWLFPLREPGVNWHAKPLTLKEVEAFKSSKEVRERLVRAYEL
FT                   MLGFYGIQLEDRNTGAVCRAQNFQPRFHNLNSHSHNNLRITRILKSLGELGLEHYQAPL
FT                   VRFFLEETLVQHKLPSVRQSALDYFLFAVRCRHQRRELVHFAWEHFKPRREFVWGPRDK
FT                   LRRFRPQTISRPLMGLGQADKDEGPGDPSQEAGTQGRTCGSGRDLSGDSGTAEDLSLLS
FT                   AKPQDVGTLDGDQRHEAKSPSPKESKKRKLEGNRQEQVPGEPDPQGVSEVEKIALNLEG
FT                   CALSPTSQEPREAEQPCLVARVANEVRKRRKVEEGAEGDGVASNTQVQASALSPTPSEC
FT                   PESQKDGNGPEDPKSQVGPEDPKSQVGPEDPKSQVGPEDPKSQVGPEDPKGQVEPEDPK
FT                   GQVGPEDPKGQVGPEDPKGQVGPEDPKSQVGPEDPKSQVEPEDPKSQVEPEDPKSQVGP
FT                   EDPQSQVGPEQAASKSLGEDPDSDTTGTSMSESEELARIEASVEPPKP"
FT   gene            2592031..2615737
FT                   /gene="Col9a3"
FT                   /locus_tag="mCG_140084"
FT                   /note="gene_id=mCG140084.0"
FT   mRNA            join(2592031..2592113,2592654..2592722,2593832..2593867,
FT                   2594309..2594380,2595369..2595422,2596430..2596465,
FT                   2596890..2596913,2597145..2597198,2597537..2597590,
FT                   2597922..2597963,2599006..2599062,2599515..2599568,
FT                   2600263..2600316,2600596..2600649,2600871..2600924,
FT                   2601415..2601468,2602220..2602273,2603114..2603167,
FT                   2603269..2603322,2603844..2603888,2603978..2604031,
FT                   2604448..2604501,2605048..2605101,2605217..2605288,
FT                   2606748..2606783,2607931..2607975,2609072..2609104,
FT                   2609261..2609407,2609587..2609641,2610165..2610347,
FT                   2613479..2613556,2615016..2615737)
FT                   /gene="Col9a3"
FT                   /locus_tag="mCG_140084"
FT                   /product="procollagen, type IX, alpha 3"
FT                   /note="gene_id=mCG140084.0 transcript_id=mCT167938.0
FT                   created on 19-APR-2002"
FT   CDS             join(2592048..2592113,2592654..2592722,2593832..2593867,
FT                   2594309..2594380,2595369..2595422,2596430..2596465,
FT                   2596890..2596913,2597145..2597198,2597537..2597590,
FT                   2597922..2597963,2599006..2599062,2599515..2599568,
FT                   2600263..2600316,2600596..2600649,2600871..2600924,
FT                   2601415..2601468,2602220..2602273,2603114..2603167,
FT                   2603269..2603322,2603844..2603888,2603978..2604031,
FT                   2604448..2604501,2605048..2605101,2605217..2605288,
FT                   2606748..2606783,2607931..2607975,2609072..2609104,
FT                   2609261..2609407,2609587..2609641,2610165..2610347,
FT                   2613479..2613556,2615016..2615206)
FT                   /codon_start=1
FT                   /gene="Col9a3"
FT                   /locus_tag="mCG_140084"
FT                   /product="procollagen, type IX, alpha 3"
FT                   /note="gene_id=mCG140084.0 transcript_id=mCT167938.0
FT                   protein_id=mCP90879.0"
FT                   /db_xref="GOA:A2ACT7"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="MGI:MGI:894686"
FT                   /db_xref="UniProtKB/TrEMBL:A2ACT7"
FT                   /protein_id="EDL07344.1"
FT                   /translation="MTGAPALALLLLGQLLTATSAQKVGPRGPPGPQGPPGKPGKDGID
FT                   GEAGPPGLPGLPGPKGTSGKPGKPGEAGLPGLPGVDGLTGRDGPAGPKGAPGERGSLGP
FT                   PGPPGLGGKGLPGPPGEAGVSGLPGGIGLRGPPGPSGLPGLPGLPGPPGPPGNPGVLPE
FT                   GATDLQCPAICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGSPGPPGPPGIPGTVG
FT                   LQGPRGLRGLPGPLGPPGDRGPIGFRGPPGTPGAPGKVGDRGERGPEGFRGPKGDLGRP
FT                   GPKGIPGMAGPGGEPGMPGKDGKDGVPGLDGEKGEAGRNGGQGEKGPNGLPGLPGRAGS
FT                   KGEKGEPGRTGELGEAGPSGEPGIPGDVGVPGERGEAGHRGSVGALGPQGPPGAPGIRG
FT                   FQGQKGSTGDPGLPGPQGLRGDVGDRGPGGATGPKGDQGIAGSDGLPGDKGELGPNGPV
FT                   GQKGESGSRGELGPKGIQGPNGTSGVQGVPGPPGPLGLQGVQGVPGITGKPGVPGKEAS
FT                   EQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPP
FT                   GYRGPTGELGDPGPRGSQGDRGDKGATGAGLDGPAGDQGYQGPQGVPGISKDGRDGAHG
FT                   EPGLPGDPGLPGAAGAQGTPGICDTSACQGAVLGGGGEKSGPRSS"
FT   gene            complement(2615748..>2636277)
FT                   /gene="Tcfl5"
FT                   /locus_tag="mCG_140083"
FT                   /note="gene_id=mCG140083.1"
FT   mRNA            complement(join(2615748..2616500,2629049..2629190,
FT                   2632199..2632445,2634096..2634258,2634676..2634859,
FT                   2635771..>2636277))
FT                   /gene="Tcfl5"
FT                   /locus_tag="mCG_140083"
FT                   /product="transcription factor-like 5 (basic
FT                   helix-loop-helix)"
FT                   /note="gene_id=mCG140083.1 transcript_id=mCT167936.1
FT                   created on 10-JUN-2003"
FT   CDS             complement(join(2616378..2616500,2629049..2629190,
FT                   2632199..2632445,2634096..2634258,2634676..2634859,
FT                   2635771..>2636276))
FT                   /codon_start=1
FT                   /gene="Tcfl5"
FT                   /locus_tag="mCG_140083"
FT                   /product="transcription factor-like 5 (basic
FT                   helix-loop-helix)"
FT                   /note="gene_id=mCG140083.1 transcript_id=mCT167936.1
FT                   protein_id=mCP90883.1"
FT                   /protein_id="EDL07345.1"
FT                   /translation="LSFTTTDLSLVEMTEVEYTQLQHILYSHMEAADGELEARLGSALL
FT                   AGPGAGSGAAGSLAPAPPVYPVLCPPLAADAPCLGHVDFQELRMMLLGEAGAAEKTPGG
FT                   ADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSMPAEPPAPRGAEPAES
FT                   GVALNNLVTLIRHPSELMNVPLHQQQNKCTTLVKNKTAAATTALQFTYPLFTSACSTGG
FT                   NASLAQTQSSSNSCSILEAAKHQDIGLPRTFSFCYQQEIESTKQTGGSRNKALPEQVWI
FT                   KVGEEALCKQAINKRNRSRIRQLDTSVERRALGEIQNVGEGSSTSQGTWQSSESSQSNL
FT                   GEQTQSGPQGGRSQRRERHNRMERDRRRRIRICCDELNLLVPFCNAETDKATTLQWTTA
FT                   FLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPESLVTCPAQGSLQSSPAMEIK"
FT   gene            complement(2651473..2695586)
FT                   /gene="Dido1"
FT                   /locus_tag="mCG_140082"
FT                   /note="gene_id=mCG140082.0"
FT   mRNA            complement(join(2651473..2656095,2663166..2663361,
FT                   2664040..2664129,2664631..2664784,2665162..2665684,
FT                   2666053..2666188,2667001..2667105,2667245..2667361,
FT                   2668461..2668620,2668738..2668946,2678513..2678725,
FT                   2681025..2681346,2682373..2683204,2685413..2685597,
FT                   2695445..2695586))
FT                   /gene="Dido1"
FT                   /locus_tag="mCG_140082"
FT                   /product="death inducer-obliterator 1, transcript variant
FT                   mCT167934"
FT                   /note="gene_id=mCG140082.0 transcript_id=mCT167934.0
FT                   created on 19-APR-2002"
FT   CDS             complement(join(2652980..2656095,2663166..2663361,
FT                   2664040..2664129,2664631..2664784,2665162..2665684,
FT                   2666053..2666188,2667001..2667105,2667245..2667361,
FT                   2668461..2668620,2668738..2668946,2678513..2678725,
FT                   2681025..2681346,2682373..2683202))
FT                   /codon_start=1
FT                   /gene="Dido1"
FT                   /locus_tag="mCG_140082"
FT                   /product="death inducer-obliterator 1, isoform CRA_a"
FT                   /note="gene_id=mCG140082.0 transcript_id=mCT167934.0
FT                   protein_id=mCP90844.0 isoform=CRA_a"
FT                   /protein_id="EDL07346.1"
FT                   /translation="MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDTEV
FT                   DPSEQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTD
FT                   VETASEGSVESSSEIRSGPVSDSLGKEHPASSEKAKGGEEEEDTSDSDSDGLTLKELQN
FT                   RLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGP
FT                   VSQSETDDIENQLEGKATQGNTEENPREAGKPKPECEVYDPNALYCICRQPHNNRFMIC
FT                   CDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETNGSATDEQDSGCRSV
FT                   GADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQPVVEAPGAPKCIGPGC
FT                   SSVAQPDSVYCSNDCILKHAAATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQAGP
FT                   TPMTAASKKLPGSAAVVGVTRKPMSANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRS
FT                   LKEILWKRVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPK
FT                   NQGLFHRVLREEISLAKLVRMKPEELVSKELSMWTEKPTKSVIESRTKLLNESKKNTTK
FT                   PETIPDMEDSPPVSDSEEQQESVRAAPEKSAAPLLDVFSSMLKDTTSQHRAHLFDLNCK
FT                   ICTGQVPSSEDEPAPKKQKLSASSKKEDFKPRHDSSPPNAVPNTADEGIADTLPENASE
FT                   PDPESTSSLNQERKCFPESPGDSHPEPSSLGGLSPSSASGGSGVVTTVTMSGRDPRTAL
FT                   SGSCTVTASMAAHLDNSQASETKLDMIKPALTSAVVPKSILAKPSSSPDPRYLSVPPSP
FT                   SISESRSPPEGDTTLFLSRLNTIWKGFINMQSVAKFVTKAYPVSGCLDYLSEDLPDTIH
FT                   IGGRIAPKTVWDYVGKLKSSVSKELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVAN
FT                   NNRHVKDLYLIPLSAKDPVPSKLLPFEGPGLESPRPNIILGLVICQKVKRPSSAGELDK
FT                   TDEKRTRLQQEELETSVYPKVTAALPSEKKPPKYSVHSIDTAATSTTPPGSPPPPPPLP
FT                   EPPVLKILSSLKPGSTSTVTAPTTAAITTTASPVTAATSKTASPLEHILQTLFGKKKSF
FT                   EPSGKESVGSTLSPHQDSKAKGEDTMSAAPLLDPIVQQFGQFSKDKALEEEEEDDRPYD
FT                   PEEEYNPDRAFHTLLAEPGRPHDVQSVSETAEREEVAYDPEDETILEEAKVTIDDLPNR
FT                   MCMKVSATERPADFTTDASSASLVEQQKMLEELNKQIEEQKRQLEEQEEALRQQRAAVG
FT                   VSMAHFSVSDALMSPPPKSSLGKTELFSQEQQAPDPSQGAPNTNHNLDSRQSRDPRQAR
FT                   RLAAENTENESLPRAPTGSTPGPQGTLPARETPAGTAVVQGPGLAAEAKESMAVPWAPG
FT                   ENAVLRPEHDIQKCEHPGNPVSLPLDTSHLPTAGDGAARPAPPRRVLLPTPPSTTFPPS
FT                   FPLQPKAQNFSSGSREPFSGPTFMSQETSLGSSQYEDPRGAQSAGKNDSPVADMEDSRE
FT                   PQPRPGESTTSFPQPGQRGGGPQPQFPGQREPAPRTFGMSGHHGPSFPGPRGPVPPYSE
FT                   ENLVPNSDGPRGPPPARFGAQKPPIPSLFSGQHGPPPYGDNRGLSPSYLGGPRGGAPAQ
FT                   FEDRKDPHGEKREFQDTPYNEMTGAPAQCEGPDQAQFMGNRAPFQFGGQRRPLLTQMKG
FT                   PRGGPPPSQFGAQRGPPPGHFVGPRGPHPSQFENSRGTHPGQFEGARGQAPGFMPGPRG
FT                   IQPQQFEEQRVNSPPRFAGQRASAPLPYGGPRGPAPFPEKNEQPPSRFHFQGPSSQPVK
FT                   PPPRPLLELPSHPPQHRKDRWDEAGPATALPSSAGPGQGHEADGQWATSEFREGKGHEY
FT                   RSPAFEGRQRERFEAGSKEKPLDEPEAQGLESRQGRAFEDRRRERERGRNWSRERDWER
FT                   SRDWDRHREWDKGRDRSSNRDRERDNDRAKEWDRSRERSRNRDRDREKAARPRQVPQQR
FT                   PRQGP"
FT   mRNA            complement(join(2676575..2677577,2678513..2678725,
FT                   2681025..2681346,2682373..2683204,2684071..2684182,
FT                   2685413..2685597,2695445..2695586))
FT                   /gene="Dido1"
FT                   /locus_tag="mCG_140082"
FT                   /product="death inducer-obliterator 1, transcript variant
FT                   mCT167935"
FT                   /note="gene_id=mCG140082.0 transcript_id=mCT167935.0
FT                   created on 19-APR-2002"
FT   CDS             complement(join(2677098..2677577,2678513..2678725,
FT                   2681025..2681346,2682373..2683202))
FT                   /codon_start=1
FT                   /gene="Dido1"
FT                   /locus_tag="mCG_140082"
FT                   /product="death inducer-obliterator 1, isoform CRA_b"
FT                   /note="gene_id=mCG140082.0 transcript_id=mCT167935.0
FT                   protein_id=mCP90871.0 isoform=CRA_b"
FT                   /protein_id="EDL07347.1"
FT                   /translation="MDDKGHLSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDTEV
FT                   DPSEQQPQQHNLSLRRSGRQPKRTERVEEFLTTVRRRGKKNVPVSLEDSSEPTSSTVTD
FT                   VETASEGSVESSSEIRSGPVSDSLGKEHPASSEKAKGGEEEEDTSDSDSDGLTLKELQN
FT                   RLRRKREQEPVERSLRGSQNRLRKKRREEDSAETGSVQIGSAEQDRPLCKQEPEASQGP
FT                   VSQSETDDIENQLEGKATQGNTEENPREAGKPKPECEVYDPNALYCICRQPHNNRFMIC
FT                   CDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETNGSATDEQDSGCRSV
FT                   GADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQPVVEAPGAPKCIGPGC
FT                   SSVAQPDSVYCSNDCILKHAAATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCSVQVGI
FT                   KISSVHKRLASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEK
FT                   PTALSPTLLSKCTYHPKAGFPGPSHHLGGCLGLSRTRVLGVLVLIVASSSLPARSRYQD
FT                   ASGPQVFLPSLWSLSGWFLKSCVGLMLEAISYFSFRPW"
FT   gene            2689438..2691965
FT                   /locus_tag="mCG_147211"
FT                   /note="gene_id=mCG147211.0"
FT   mRNA            join(2689438..2691156,2691550..2691965)
FT                   /locus_tag="mCG_147211"
FT                   /product="mCG147211"
FT                   /note="gene_id=mCG147211.0 transcript_id=mCT187474.0
FT                   created on 13-JAN-2004"
FT   CDS             2691652..2691831
FT                   /codon_start=1
FT                   /locus_tag="mCG_147211"
FT                   /product="mCG147211"
FT                   /note="gene_id=mCG147211.0 transcript_id=mCT187474.0
FT                   protein_id=mCP109570.0"
FT                   /protein_id="EDL07348.1"
FT                   /translation="MTCKFMKRSIFKKKKKKKKKSSYLSRVGSPPVPFTFPETWALYGE
FT                   LLLLTSAAEHHIMY"
FT   gene            <2703748..2712213
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /note="gene_id=mCG6738.1"
FT   mRNA            join(<2703748..2703834,2706675..2706804,2708174..2708370,
FT                   2710342..2710539,2711319..2712213)
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, transcript variant
FT                   mCT5488"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT5488.1 created on
FT                   19-APR-2002"
FT   mRNA            join(2703857..2703970,2706675..2706804,2708174..2708370,
FT                   2710342..2710539,2711319..2712211)
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, transcript variant
FT                   mCT167951"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT167951.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(2705171..2705334,2706675..2706804,2708174..2708370,
FT                   2710342..2710539,2711319..2712213)
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, transcript variant
FT                   mCT167952"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT167952.0 created
FT                   on 19-APR-2002"
FT   CDS             join(<2706681..2706804,2708174..2708370,2710342..2710539,
FT                   2711319..2711492)
FT                   /codon_start=1
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, isoform CRA_b"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT5488.1
FT                   protein_id=mCP20265.0 isoform=CRA_b"
FT                   /protein_id="EDL07351.1"
FT                   /translation="IIMSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFK
FT                   EAAEKFRMESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYF
FT                   HLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAFDSPEESPFG
FT                   DLLHMMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLS
FT                   KGVIEEPK"
FT   CDS             join(2706687..2706804,2708174..2708370,2710342..2710539,
FT                   2711319..2711492)
FT                   /codon_start=1
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, isoform CRA_a"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT167951.0
FT                   protein_id=mCP90882.0 isoform=CRA_a"
FT                   /protein_id="EDL07349.1"
FT                   /translation="MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEA
FT                   AEKFRMESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHL
FT                   QQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAFDSPEESPFGDL
FT                   LHMMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKG
FT                   VIEEPK"
FT   CDS             join(2706687..2706804,2708174..2708370,2710342..2710539,
FT                   2711319..2711492)
FT                   /codon_start=1
FT                   /gene="2310003C23Rik"
FT                   /locus_tag="mCG_6738"
FT                   /product="RIKEN cDNA 2310003C23, isoform CRA_a"
FT                   /note="gene_id=mCG6738.1 transcript_id=mCT167952.0
FT                   protein_id=mCP90849.0 isoform=CRA_a"
FT                   /protein_id="EDL07350.1"
FT                   /translation="MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEA
FT                   AEKFRMESGIEPSVDLETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHL
FT                   QQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAFDSPEESPFGDL
FT                   LHMMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKG
FT                   VIEEPK"
FT   gene            2718821..2735956
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /note="gene_id=mCG6716.2"
FT   mRNA            join(2718821..2718933,2725446..2725643,2725999..2726138,
FT                   2727283..2727382,2729404..2729534,2730248..2730344,
FT                   2730568..2730664,2731153..2731240,2731970..2732004,
FT                   2733497..2733612,2734204..2734259,2734391..2734420,
FT                   2734961..2735955)
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, transcript variant
FT                   mCT5514"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT5514.1 created on
FT                   19-APR-2002"
FT   mRNA            join(2718821..2718933,2725446..2726139)
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, transcript variant
FT                   mCT167933"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT167933.0 created
FT                   on 19-APR-2002"
FT   CDS             join(2718842..2718933,2725446..2725643,2725999..2726138,
FT                   2727283..2727382,2729404..2729534,2730248..2730344,
FT                   2730568..2730664,2731153..2731240,2731970..2732004,
FT                   2733497..2733612,2734204..2734259,2734391..2734420,
FT                   2734961..2735124)
FT                   /codon_start=1
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, isoform CRA_c"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT5514.1
FT                   protein_id=mCP20299.2 isoform=CRA_c"
FT                   /protein_id="EDL07354.1"
FT                   /translation="MPSQRSSLMQPIPEETRKTPSAAAEDTRWSRPECQAWTGILLLGT
FT                   CLLYCARVTMPVCTVAMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVI
FT                   LLSASAWGFITVTTPLLAHLGSGHLAFLTFSRILTGLLQGVYFPALTSLLSQKVQESER
FT                   AFTYSTVGAGSQVGTLVTGGVGSVLLDQCGWQSVFYFSGGLTLLWAYYVYRYLLNEKDL
FT                   VLALGFLAQGLPVTKPSKVPWRQLFRKASVWAAICSQLCSACSFFILLSWLPTFFKETF
FT                   PNSKGWVFNVVPWMLAIPASLFSGFISDRLISQGYRVITVRKFMQVMGLGLSSIFALCL
FT                   GHTTSFLKAMIFASASIGFQTFNHSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVC
FT                   LSGYLIETTGSWTCVFHLVAIISNLGLGTFLVFGKAQRVDLVPTHEDL"
FT   CDS             join(2718842..2718933,2725446..2725647)
FT                   /codon_start=1
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, isoform CRA_b"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT167933.0
FT                   protein_id=mCP90857.0 isoform=CRA_b"
FT                   /protein_id="EDL07353.1"
FT                   /translation="MPSQRSSLMQPIPEETRKTPSAAAEDTRWSRPECQAWTGILLLGT
FT                   CLLYCARVTMPVCTVAMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDR"
FT   mRNA            join(2729978..2730003,2730248..2730457,2730568..2730664,
FT                   2731970..2732004,2733497..2733612,2734204..2734259,
FT                   2734391..2734420,2734961..2735956)
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, transcript variant
FT                   mCT167932"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT167932.0 created
FT                   on 19-APR-2002"
FT   CDS             join(2730386..2730457,2730568..2730664,2731970..2732004,
FT                   2733497..2733612,2734204..2734259,2734391..2734420,
FT                   2734961..2735124)
FT                   /codon_start=1
FT                   /gene="BC019537"
FT                   /locus_tag="mCG_6716"
FT                   /product="cDNA sequence BC019537, isoform CRA_a"
FT                   /note="gene_id=mCG6716.2 transcript_id=mCT167932.0
FT                   protein_id=mCP90835.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="MGI:MGI:1919107"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DA66"
FT                   /protein_id="EDL07352.1"
FT                   /translation="MGHEVWQPLLLWKDPVLTLQQMSQGGNLLPVVLCLLLLHSTLLAA
FT                   HLLQGDLPQLQGYRVITVRKFMQVMGLGLSSIFALCLGHTTSFLKAMIFASASIGFQTF
FT                   NHSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVCLSGYLIETTGSWTCVFHLVAII
FT                   SNLGLGTFLVFGKAQRVDLVPTHEDL"
FT   gene            complement(2759815..2769498)
FT                   /locus_tag="mCG_49636"
FT                   /note="gene_id=mCG49636.2"
FT   mRNA            complement(join(2759815..2760049,2760152..2760268,
FT                   2760411..2760588,2763211..2763318,2763402..2763506,
FT                   2768012..2768066))
FT                   /locus_tag="mCG_49636"
FT                   /product="mCG49636, transcript variant mCT167928"
FT                   /note="gene_id=mCG49636.2 transcript_id=mCT167928.0 created
FT                   on 06-JUN-2003"
FT   mRNA            complement(join(2760143..2760588,2763200..2763318,
FT                   2769362..2769498))
FT                   /locus_tag="mCG_49636"
FT                   /product="mCG49636, transcript variant mCT49819"
FT                   /note="gene_id=mCG49636.2 transcript_id=mCT49819.2 created
FT                   on 06-JUN-2003"
FT   CDS             complement(join(2760476..2760588,2763211..2763313))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49636"
FT                   /product="mCG49636, isoform CRA_a"
FT                   /note="gene_id=mCG49636.2 transcript_id=mCT167928.0
FT                   protein_id=mCP90873.0 isoform=CRA_a"
FT                   /protein_id="EDL07355.1"
FT                   /translation="MLMDRALGRPGCSGQETLIGEEQLTSCLQSCLGSCQMMAPECSLG
FT                   AAIKREALLCTNYQPRLLTRPQPTTE"
FT   CDS             complement(join(2760580..2760588,2763200..2763313))
FT                   /codon_start=1
FT                   /locus_tag="mCG_49636"
FT                   /product="mCG49636, isoform CRA_b"
FT                   /note="gene_id=mCG49636.2 transcript_id=mCT49819.2
FT                   protein_id=mCP40441.2 isoform=CRA_b"
FT                   /protein_id="EDL07356.1"
FT                   /translation="MLMDRALGRPGCSGQETLIGEEQLTSCLQSCLGSCELPVK"
FT   gene            complement(2769572..2771002)
FT                   /gene="Bhlhb4"
FT                   /locus_tag="mCG_140079"
FT                   /note="gene_id=mCG140079.0"
FT   mRNA            complement(2769572..2771002)
FT                   /gene="Bhlhb4"
FT                   /locus_tag="mCG_140079"
FT                   /product="basic helix-loop-helix domain containing, class
FT                   B4"
FT                   /note="gene_id=mCG140079.0 transcript_id=mCT167929.0
FT                   created on 06-JUN-2003"
FT   CDS             complement(2770174..2770845)
FT                   /codon_start=1
FT                   /gene="Bhlhb4"
FT                   /locus_tag="mCG_140079"
FT                   /product="basic helix-loop-helix domain containing, class
FT                   B4"
FT                   /note="gene_id=mCG140079.0 transcript_id=mCT167929.0
FT                   protein_id=mCP90858.0"
FT                   /db_xref="GOA:Q0VEJ8"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:2153710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEJ8"
FT                   /protein_id="EDL07357.1"
FT                   /translation="MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGG
FT                   DLPAAPASRVPAATVESSGEQSGDEDEAFERRRRRRGSGVAVDARRRPREQRSLRLSIN
FT                   ARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLV
FT                   AYLNQGQGLAAPVAAAPLTPFGQAAIYPFSAGTALGPCPDKCATFSGSPSALCKHCGEK
FT                   P"
FT   gene            complement(2823764..>2883655)
FT                   /locus_tag="mCG_145075"
FT                   /note="gene_id=mCG145075.0"
FT   mRNA            complement(join(2823764..2824783,2824839..2825510,
FT                   2832521..2832687,2834246..2834411,2883558..>2883655))
FT                   /locus_tag="mCG_145075"
FT                   /product="mCG145075"
FT                   /note="gene_id=mCG145075.0 transcript_id=mCT184499.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2824853..>2825143)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145075"
FT                   /product="mCG145075"
FT                   /note="gene_id=mCG145075.0 transcript_id=mCT184499.0
FT                   protein_id=mCP106132.0"
FT                   /protein_id="EDL07358.1"
FT                   /translation="ELAVVAWVQESCLCLSPAAALQRAGSATCLLCGGVGEEEMPSPPL
FT                   TPHPSLPEAGRRAVPGPHQLQHLREPTLQLSWAHRRTGPGGRNSCELAPRI"
FT   gene            complement(2898578..2915114)
FT                   /gene="Ythdf1"
FT                   /locus_tag="mCG_6742"
FT                   /note="gene_id=mCG6742.2"
FT   mRNA            complement(join(2898578..2899869,2904854..2906374,
FT                   2913300..2913379,2914477..2914501,2914849..2915114))
FT                   /gene="Ythdf1"
FT                   /locus_tag="mCG_6742"
FT                   /product="YTH domain family 1, transcript variant mCT5487"
FT                   /note="gene_id=mCG6742.2 transcript_id=mCT5487.2 created on
FT                   19-APR-2002"
FT   mRNA            complement(join(2898578..2899869,2904854..2906374,
FT                   2913300..2913379,2914071..2914151,2914477..2914501,
FT                   2914849..2915114))
FT                   /gene="Ythdf1"
FT                   /locus_tag="mCG_6742"
FT                   /product="YTH domain family 1, transcript variant
FT                   mCT167956"
FT                   /note="gene_id=mCG6742.2 transcript_id=mCT167956.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(2899843..2899869,2904854..2906374,
FT                   2913300..2913379,2914477..2914501,2914849..2914875))
FT                   /codon_start=1
FT                   /gene="Ythdf1"
FT                   /locus_tag="mCG_6742"
FT                   /product="YTH domain family 1, isoform CRA_b"
FT                   /note="gene_id=mCG6742.2 transcript_id=mCT5487.2
FT                   protein_id=mCP20305.1 isoform=CRA_b"
FT                   /protein_id="EDL07360.1"
FT                   /translation="MSATSVDPQRTKGQDNKVQNGSLHQKDAVHDNDFEPYLSGQSNPS
FT                   NSYPSMSDPYLSSYYPPSIGFPYSLSEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAV
FT                   FGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVV
FT                   DGQTGFHSDSLNKAPGMNSLEQGMVGLKIGDVTTSAVKTVGSVVNSVALTGVLSGNGGT
FT                   NVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPIVGGALPPPPIKHNMDIGTWDNKGPAP
FT                   KASAPQQTPSPQAAPQPQQVAQPLPVQPPPLVQPQYQSPQQPLQPRWVAPRNRNAAFGQ
FT                   SGGANSDSNSVGNAQPTSAPSVESHPVLEKLKAAHSYNPKEFDWNLKSGRVFIIKSYSE
FT                   DDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDY
FT                   GTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAK
FT                   QVLKIIASYKHTTSIFDDFSHYEKRQEEEEVVRKERQNRNKQ"
FT   CDS             complement(join(2899843..2899869,2904854..2906374,
FT                   2913300..2913379,2914071..2914151,2914477..2914501,
FT                   2914849..2914875))
FT                   /codon_start=1
FT                   /gene="Ythdf1"
FT                   /locus_tag="mCG_6742"
FT                   /product="YTH domain family 1, isoform CRA_a"
FT                   /note="gene_id=mCG6742.2 transcript_id=mCT167956.0
FT                   protein_id=mCP90880.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AWN8"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="MGI:MGI:1917431"
FT                   /db_xref="UniProtKB/TrEMBL:A2AWN8"
FT                   /protein_id="EDL07359.1"
FT                   /translation="MSATSVDPQRTKGQDNKGSGWLWRRVSQLAVDPEALPSILSYSHL
FT                   QNGSLHQKDAVHDNDFEPYLSGQSNPSNSYPSMSDPYLSSYYPPSIGFPYSLSEAPWST
FT                   AGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSG
FT                   SQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDSLNKAPGMNSLEQGMVGLKIGDV
FT                   TTSAVKTVGSVVNSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGP
FT                   IVGGALPPPPIKHNMDIGTWDNKGPAPKASAPQQTPSPQAAPQPQQVAQPLPVQPPPLV
FT                   QPQYQSPQQPLQPRWVAPRNRNAAFGQSGGANSDSNSVGNAQPTSAPSVESHPVLEKLK
FT                   AAHSYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSK
FT                   GPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLR
FT                   HIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEEVV
FT                   RKERQNRNKQ"
FT   gene            <2923191..2928177
FT                   /locus_tag="mCG_6733"
FT                   /note="gene_id=mCG6733.3"
FT   mRNA            join(<2923191..2923681,2924973..2925505,2925587..2925632,
FT                   2927087..2927158,2927305..2927503,2927988..2928177)
FT                   /locus_tag="mCG_6733"
FT                   /product="mCG6733, transcript variant mCT189969"
FT                   /note="gene_id=mCG6733.3 transcript_id=mCT189969.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2923267..2923681,2924973..2925076)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6733"
FT                   /product="mCG6733, isoform CRA_a"
FT                   /note="gene_id=mCG6733.3 transcript_id=mCT189969.0
FT                   protein_id=mCP110962.0 isoform=CRA_a"
FT                   /protein_id="EDL07361.1"
FT                   /translation="RQELERYNTRHIPGLVMFSPADLFRAAVFSMGPESRARDSVRGPE
FT                   LSHREDGSGRTQEQDKPHCPCNHVLGQDCLDGQILGQLRPLSEEEESSGAAFLGEPAFP
FT                   EMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERGDDPW
FT                   TEHARWFPR"
FT   mRNA            join(2923331..2923681,2924973..2925072,2925427..2925505,
FT                   2925587..2925632,2927087..2927158,2927305..2927503,
FT                   2927988..2928177)
FT                   /locus_tag="mCG_6733"
FT                   /product="mCG6733, transcript variant mCT5502"
FT                   /note="gene_id=mCG6733.3 transcript_id=mCT5502.2 created on
FT                   19-APR-2002"
FT   CDS             join(2923357..2923681,2924973..2925072,2925427..2925505,
FT                   2925587..2925632,2927087..2927158,2927305..2927498)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6733"
FT                   /product="mCG6733, isoform CRA_b"
FT                   /note="gene_id=mCG6733.3 transcript_id=mCT5502.2
FT                   protein_id=mCP20300.2 isoform=CRA_b"
FT                   /protein_id="EDL07362.1"
FT                   /translation="MGPESRARDSVRGPELSHREDGSGRTQEQDKPHCPCNHVLGQDCL
FT                   DGQILGQLRPLSEEEESSGAAFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAG
FT                   FFHTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQTYTP
FT                   LLGSWDQREEPEDAVSATPSAPAHGSPELLRSRRETQPEDVSEPGAKDVQEQLRQLQEE
FT                   RRCKVCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFLS"
FT   gene            complement(2928940..2949090)
FT                   /gene="C030019F02Rik"
FT                   /locus_tag="mCG_6725"
FT                   /note="gene_id=mCG6725.2"
FT   mRNA            complement(join(2928940..2929197,2930111..2930195,
FT                   2931319..2931379,2937468..2937665,2938179..2938259,
FT                   2938515..2938652,2949005..2949090))
FT                   /gene="C030019F02Rik"
FT                   /locus_tag="mCG_6725"
FT                   /product="RIKEN cDNA C030019F02"
FT                   /note="gene_id=mCG6725.2 transcript_id=mCT5506.1 created on
FT                   19-APR-2002"
FT   CDS             complement(join(2929188..2929197,2930111..2930195,
FT                   2931319..2931379,2937468..2937665,2938179..2938259,
FT                   2938515..2938652,2949005..2949058))
FT                   /codon_start=1
FT                   /gene="C030019F02Rik"
FT                   /locus_tag="mCG_6725"
FT                   /product="RIKEN cDNA C030019F02"
FT                   /note="gene_id=mCG6725.2 transcript_id=mCT5506.1
FT                   protein_id=mCP20282.1"
FT                   /protein_id="EDL07363.1"
FT                   /translation="MGFCSGRCTLLALCALQLVTALERQVFDFLGYQWAPILANFTHII
FT                   VVILGLFGTIQYRPRYIVVYVVWAAVWVTWNVFIICFYLEVGGLSKDSELLTFNLSGHR
FT                   SWWEEHGPGCLHEEEATAGLGALHGQSLVVGAGCAMVHSYVEALHSGLQILLALLGFVY
FT                   GCYVVSVLTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQAYLPA"
FT   gene            <2948914..2961230
FT                   /locus_tag="mCG_140086"
FT                   /note="gene_id=mCG140086.0"
FT   mRNA            join(<2948914..2949059,2953819..2954002,2960933..2961230)
FT                   /locus_tag="mCG_140086"
FT                   /product="mCG140086"
FT                   /note="gene_id=mCG140086.0 transcript_id=mCT167942.0
FT                   created on 19-APR-2002"
FT   CDS             join(<2948915..2949059,2953819..2953982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140086"
FT                   /product="mCG140086"
FT                   /note="gene_id=mCG140086.0 transcript_id=mCT167942.0
FT                   protein_id=mCP90859.0"
FT                   /protein_id="EDL07364.1"
FT                   /translation="QQPQPSASRHPRNHPRLVRVRKATQDTRTHQLQSAERKKRAAAGA
FT                   KAHESLTLLSGEQHAWASLGPRAEREFQVQVMRPPPVQCRMEPIPANDGDSMSEYEH"
FT   gene            2961674..2976963
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /note="gene_id=mCG6720.1"
FT   mRNA            join(2961674..2961770,2962043..2962255,2965493..2965556,
FT                   2966016..2966125,2966426..2966597,2967137..2967237,
FT                   2967903..2967989,2968502..2968598,2970749..2970805,
FT                   2971762..2971794,2973611..2973697,2974101..2974160,
FT                   2974838..2974914,2975477..2976963)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT5509"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT5509.2 created on
FT                   19-APR-2002"
FT   mRNA            join(2961675..2961770,2965493..2965556,2966016..2966125,
FT                   2966426..2966597,2967137..2967371)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT167937"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT167937.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(<2961704..2961770,2962043..2962255,2965456..2965556,
FT                   2966016..2966125,2966426..2966597,2967137..2968598,
FT                   2970749..2970805,2971762..2971794,2973611..2973667,
FT                   2974101..2974160,2974838..2974914,2975477..2976898)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT189959"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189959.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2961708..2961770,2965493..2965556,2966426..2966597,
FT                   2967137..2967237,2967903..2967989,2968502..2968598,
FT                   2970749..2970805,2971762..2971794,2973611..2973667,
FT                   2974101..2974160,2974838..2974914,2975477..2976885)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT189961"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189961.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2961710..2961770,2962043..2962255,2965493..2965556,
FT                   2966016..2966125,2966426..2966597,2967137..2967237,
FT                   2967903..2967989,2968502..2968598,2970749..2970805,
FT                   2971762..2971794,2973611..2973667,2974101..2974160,
FT                   2974838..2974914,2975477..2976882)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT189962"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189962.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2961710..2961770,2965493..2965556,2966426..2966597,
FT                   2967137..2967237,2967903..2967989,2968502..2968598,
FT                   2970749..2970805,2971762..2971794,2973611..2973667,
FT                   2974101..2974160,2974838..2974914,2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189961.0
FT                   protein_id=mCP110953.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q05DE0"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="MGI:MGI:2183559"
FT                   /db_xref="UniProtKB/TrEMBL:Q05DE0"
FT                   /protein_id="EDL07368.1"
FT                   /translation="GSERLVQLGTSAGPDLLGAAAPWPAQEPGKFLRKSGHRMRIIFVR
FT                   SVTMDKWKDIELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAAALFRDKVATLA
FT                   EGKEWSLESSPAQNWTPPQPKTLQFTAHRASGQPQSAAASGDKAFEDWLNDDLGSYQGA
FT                   QENRYVGFGNTVPPQKREDDFLNNAMSSLYSGWSSFTTGASKFASAAKEGATKFGSQAS
FT                   QKASELGHSLNENVLKPAQEKVKEGRIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSG
FT                   KAEDSSDRPLEGHSYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSPSSDSWTCADAST
FT                   GRRSSDSWDVWGSGSASNNKNSNSDGWESWEGASGEGRAKATKKAAPSTADEGWDNQNW
FT                   "
FT   mRNA            join(<2961718..2961770,2965493..2965556,2966016..2966125,
FT                   2966426..2966597,2967137..2967237,2967903..2967989,
FT                   2968502..2968598,2970749..2970805,2971762..2971794,
FT                   2973611..2973667,2974844..2974914,2975477..2976898)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT189963"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189963.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2961718..2961770,2962043..2962255,2965493..2965556,
FT                   2966016..2966125,2966426..2966597,2967137..2967237,
FT                   2967903..2967989,2968502..2968598,2970749..2970805,
FT                   2971762..2971794,2973611..2973667,2974101..2974160,
FT                   2974838..2974914,2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_e"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189962.0
FT                   protein_id=mCP110954.0 isoform=CRA_e"
FT                   /protein_id="EDL07369.1"
FT                   /translation="APSPAWHLGRTRPPGGSRIPVCGRPDPPSPASRPVSFTALQPSGC
FT                   RDLRGPSALWSRAVLDADWFCTAHFVGKGPQPFTSKEDSVQRCRTMASPRTRKVLKEVR
FT                   AQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDIELE
FT                   KMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEWSLESSPAQ
FT                   NWTPPQPKTLQFTAHRASGQPQSAAASGDKAFEDWLNDDLGSYQGAQENRYVGFGNTVP
FT                   PQKREDDFLNNAMSSLYSGWSSFTTGASKFASAAKEGATKFGSQASQKASELGHSLNEN
FT                   VLKPAQEKVKEGRIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEDSSDRPLEGH
FT                   SYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSPSSDSWTCADASTGRRSSDSWDVWGS
FT                   GSASNNKNSNSDGWESWEGASGEGRAKATKKAAPSTADEGWDNQNW"
FT   CDS             join(<2961718..2961770,2965493..2965556,2966016..2966125,
FT                   2966426..2966597,2967137..2967237,2967903..2967989,
FT                   2968502..2968598,2970749..2970805,2971762..2971794,
FT                   2973611..2973667,2974844..2974914,2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_f"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189963.0
FT                   protein_id=mCP110955.0 isoform=CRA_f"
FT                   /protein_id="EDL07370.1"
FT                   /translation="APSPAWHLGRTRPPGGSSTMASPRTRKVLKEVRAQDENNVCFECG
FT                   AFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFRE
FT                   FLETQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPKTLQF
FT                   TAHRASGQPQSAAASGDKAFEDWLNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNA
FT                   MSSLYSGWSSFTTGASKFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKGVGS
FT                   KGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSP
FT                   SSDSWTCADASTGRRSSDSWDVWGSGSASNNKNSNSDGWESWEGASGEGRAKATKKAAP
FT                   STADEGWDNQNW"
FT   mRNA            join(<2961739..2962255,2965493..2965556,2966016..2966125,
FT                   2966426..2966597,2967137..2967237,2967903..2967989,
FT                   2968502..2968598,2970749..2970805,2971762..2971794,
FT                   2973611..2973667,2974844..2974914,2975477..2976751)
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, transcript variant mCT189960"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189960.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2961741..2962255,2965493..2965556,2966016..2966125,
FT                   2966426..2966597,2967137..2967237,2967903..2967989,
FT                   2968502..2968598,2970749..2970805,2971762..2971794,
FT                   2973611..2973667,2974844..2974914,2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189960.0
FT                   protein_id=mCP110952.0 isoform=CRA_c"
FT                   /protein_id="EDL07367.1"
FT                   /translation="RPDPTSWGQQVSLRPGHRASADPQFLALPALRSPSSWPCNPRFCS
FT                   PRPLVPQYRDCPTPPVFSPDLLPGASRVPPISQLPGPGFSSPSTRDVFVPRTPNSRIPV
FT                   CGRPDPPSPASRPVSFTALQPSGCRDLRGPSALWSRAVLDADWFCTAHFVGKGPQPFTS
FT                   KEDSVQRCRTMASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRH
FT                   RGLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAA
FT                   ALFRDKVATLAEGKEWSLESSPAQNWTPPQPKTLQFTAHRASGQPQSAAASGDKAFEDW
FT                   LNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNAMSSLYSGWSSFTTGASKFASAAK
FT                   EGATKFGSQASQKASELGHSLNENVLKPAQEKGVGSKGWRDVTTFFSGKAEDSSDRPLE
FT                   GHSYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSPSSDSWTCADASTGRRSSDSWDVW
FT                   GSGSASNNKNSNSDGWESWEGASGEGRAKATKKAAPSTADEGWDNQNW"
FT   CDS             join(2965497..2965556,2966016..2966125,2966426..2966597,
FT                   2967137..2967237,2967903..2967989,2968502..2968598,
FT                   2970749..2970805,2971762..2971794,2973611..2973697,
FT                   2974101..2974160,2974838..2974914,2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_g"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT5509.2
FT                   protein_id=mCP20255.2 isoform=CRA_g"
FT                   /protein_id="EDL07371.1"
FT                   /translation="MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLEC
FT                   SGRHRGLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYS
FT                   SRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPKTLQFTAHRASGQPQSAAASGDKA
FT                   FEDWLNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNAMSSLYSGWSSFTTGASKFA
FT                   SAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVWVAPKIKVLVKEGRIFDDVSSG
FT                   VSQLASKVQGVGSKGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNSNIDQSFWE
FT                   TFGSAEPPKAKSPSSDSWTCADASTGRRSSDSWDVWGSGSASNNKNSNSDGWESWEGAS
FT                   GEGRAKATKKAAPSTADEGWDNQNW"
FT   CDS             join(2965497..2965556,2966016..2966125,2966426..2966597,
FT                   2967137..2967241)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT167937.0
FT                   protein_id=mCP90875.0 isoform=CRA_a"
FT                   /protein_id="EDL07365.1"
FT                   /translation="MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLEC
FT                   SGRHRGLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYS
FT                   SRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPKTLQFTAHR"
FT   CDS             join(<2968452..2968598,2970749..2970805,2971762..2971794,
FT                   2973611..2973667,2974101..2974160,2974838..2974914,
FT                   2975477..2975810)
FT                   /codon_start=1
FT                   /gene="Arfgap1"
FT                   /locus_tag="mCG_6720"
FT                   /product="ADP-ribosylation factor GTPase activating protein
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG6720.1 transcript_id=mCT189959.0
FT                   protein_id=mCP110951.0 isoform=CRA_b"
FT                   /protein_id="EDL07366.1"
FT                   /translation="GVARFMAVVVMSVFIFSAQENRYVGFGNTVPPQKREDDFLNNAMS
FT                   SLYSGWSSFTTGASKFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGRI
FT                   FDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNSN
FT                   IDQSFWETFGSAEPPKAKSPSSDSWTCADASTGRRSSDSWDVWGSGSASNNKNSNSDGW
FT                   ESWEGASGEGRAKATKKAAPSTADEGWDNQNW"
FT   gene            2983463..3012520
FT                   /locus_tag="mCG_142757"
FT                   /note="gene_id=mCG142757.0"
FT   mRNA            join(2983463..2983573,2986867..2987010,2987286..2987441,
FT                   2987676..2987801,2988633..2988791,2989310..2989429,
FT                   2989893..2990057,2990788..2990940,2991115..2991284,
FT                   2991699..2991828,2992787..2992932,2993018..2993141,
FT                   2993551..2993687,2994120..2994249,2994466..2994608,
FT                   2994798..2994930,2995326..2995474,2995647..2995776,
FT                   2996762..2996800,2997761..2997899,3001121..3001263,
FT                   3001542..3001651,3001983..3002141,3002212..3002289,
FT                   3002936..3003022,3003793..3003846,3007484..3007579,
FT                   3007653..3007706,3007807..3007860,3008287..3008340,
FT                   3009204..3009275,3009843..3009878,3009959..3010025,
FT                   3010106..3010273,3010663..3010740,3011727..3012520)
FT                   /locus_tag="mCG_142757"
FT                   /product="mCG142757"
FT                   /note="gene_id=mCG142757.0 transcript_id=mCT182086.0
FT                   created on 29-APR-2003"
FT   CDS             join(2983510..2983573,2986867..2987010,2987286..2987441,
FT                   2987676..2987801,2988633..2988791,2989310..2989429,
FT                   2989893..2990057,2990788..2990940,2991115..2991284,
FT                   2991699..2991828,2992787..2992932,2993018..2993141,
FT                   2993551..2993687,2994120..2994249,2994466..2994608,
FT                   2994798..2994930,2995326..2995474,2995647..2995776,
FT                   2996762..2996800,2997761..2997899,3001121..3001263,
FT                   3001542..3001651,3001983..3002141,3002212..3002289,
FT                   3002936..3003022,3003793..3003846,3007484..3007579,
FT                   3007653..3007706,3007807..3007860,3008287..3008340,
FT                   3009204..3009275,3009843..3009878,3009959..3010025,
FT                   3010106..3010273,3010663..3010736)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142757"
FT                   /product="mCG142757"
FT                   /note="gene_id=mCG142757.0 transcript_id=mCT182086.0
FT                   protein_id=mCP105008.0"
FT                   /protein_id="EDL07372.1"
FT                   /translation="MKWREAEGSGLGFLVQVTPMAGDLEQELILTTKTPKATVGGLNPS
FT                   KSYTLQIFELTDSGPILLARREFVIEDLKSQSLGRGSRRLAGATLEPTSLPLRGPDSEK
FT                   TSEPSIAFTLSRDLPILGVASKDQRKLKQGLGVQNSAQTTTDLERQSHTAASVGKQGKL
FT                   DHPQFQCTPPTPADIIFLVDGSWSIGHNHFQQVKDFLASIITQFAIGPDKVQVGLTQYS
FT                   GDPQTEWDLNSFQTKEQVLAAVHHLRYKGGNTFTGLALTHVLEQNLKPAAGVRPEAAKV
FT                   LILVTDGKSQDDVRTAARILKDQDIDVFVVGVKNVDEAELKLLASQPLDITVHNVLDFP
FT                   QLDTLAPLLSRLICQKIQGRGPVKPAAGTRVLDPLPTPTRLILTHATSSSIHLSWTPAL
FT                   YPPLKYLIVWQPSRGGAPKEVVVEGPVSSMELGNLTSSTEYLVSVLPVYESGVGKSLQG
FT                   RATTAPLPPPGPLTLAAVTPRTLHVTWPPSAGVTQYLVQYLLATSTGEEQKREVHVGQP
FT                   EVLLDGLEPGQDYDVSVQSLRGPEASEVQSIRARTSALGPPRHLTFSDVRYNSTCVSWE
FT                   AQRPVRLVKVSYISSDGSHSGQTQVPGNLTSATLGPLSSSTMYTVRVTCFYLGGGSSVL
FT                   TGHVTTQKAPSPGQLSVMELPGDAVKLSWLATALSGVLVYQIKWMPLGEGKAREISVPG
FT                   TLGTATLPGLMKHVEYEITILAYYRDGTRSDPVSLRYTPSAASRSPPSSLALSSETPNS
FT                   LQVNWTPPSGHVLHYRLNYTLASGSGPEKSISVPGTRSHAVLRDLMSATKYRVLVSAVY
FT                   RAGESMAVSATYRTAACPALHPDSSLSGFDLMVAFGLVAKEYASIRGVAMEPSALGVVP
FT                   TFTLLKDAQLMRRVSDIYPATLPPEHTIVFLVRLLPETPREAFALWQMMAEDFQPILGV
FT                   LLDAGRKSLTYFNHDSRAALQEVTFDLQDAKKIFFGSFHKVHIAVGHSKVRLYVDCRKV
FT                   AERPIGDAGSPPTGGFITLGRLAKARGPRSSSATFQLQMLQIVCSDTWADKDRCCEIPA
FT                   LRDGETCPAFPSACAYSSETPGPPGPQGPPGLPGRNGPPGQQGHPGPKGEPGPPGQTGP
FT                   EGPGGQQGSPGTQGRAVQGPMGPPGAKGEKGDQGLSGLQGLSGQQGIPGKTGLQGPKGM
FT                   RGLEGPAGLPGPPGPRGFQGLAGARGTNGERGAPGAVGPTGLPGSKGERGEKGEPQSLA
FT                   TIFQLVSQACESAIRTHVLKLNSFLHENARPPMPFMAETAKLGRPRSIDPGLHNEALLP
FT                   GDWGHILRPEDQGEPVTISHTSNPRLQEVQTPESLE"
FT   gene            complement(3019113..3033495)
FT                   /gene="Chrna4"
FT                   /locus_tag="mCG_23081"
FT                   /note="gene_id=mCG23081.1"
FT   mRNA            complement(join(3019113..3019299,3022618..3023992,
FT                   3028340..3028449,3028529..3028573,3031839..3031990,
FT                   3033412..3033495))
FT                   /gene="Chrna4"
FT                   /locus_tag="mCG_23081"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 4"
FT                   /note="gene_id=mCG23081.1 transcript_id=mCT23068.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3019174..3019299,3022618..3023992,
FT                   3028340..3028449,3028529..3028573,3031839..3031990,
FT                   3033412..3033493))
FT                   /codon_start=1
FT                   /gene="Chrna4"
FT                   /locus_tag="mCG_23081"
FT                   /product="cholinergic receptor, nicotinic, alpha
FT                   polypeptide 4"
FT                   /note="gene_id=mCG23081.1 transcript_id=mCT23068.1
FT                   protein_id=mCP20316.1"
FT                   /protein_id="EDL07373.1"
FT                   /translation="MEIGGSGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKR
FT                   LFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDP
FT                   GDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSC
FT                   SIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNT
FT                   RKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCI
FT                   SVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTH
FT                   TMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPESEPGILGD
FT                   ICNQGLSPAPTFCNRMDTAVETQPTCRSPSHKVPDLKTSEVEKASPCPSPGSCHPPNSS
FT                   GAPVLIKARSLSVQHVPSSQEAAEGSIRCRSRSIQYCVSQDGAASLTESKPTGSPASLK
FT                   TRPSQLPVSDQASPCKCTCKEPSPVSPITVLKAGGTKAPPQHLPLSPALTRAVEGVQYI
FT                   ADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI"
FT   gene            complement(3069997..>3129524)
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /note="gene_id=mCG23080.2"
FT   mRNA            complement(join(3069997..3070611,3075866..3076186,
FT                   3076744..3076867,3079654..3079761,3081380..3081511,
FT                   3081986..3082094,3082758..3082945,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167925"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167925.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3069997..3070611,3081380..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..>3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT189950"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189950.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3069997..3070611,3075866..3076186,
FT                   3076744..3076867,3081380..3081511,3081986..3082094,
FT                   3082758..3082981,3091361..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167922"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167922.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3069997..3070611,3075866..3076186,
FT                   3076744..3076867,3079654..3079761,3081380..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..>3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT189951"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189951.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3070012..3070617,3081386..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167927"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167927.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3070567..3070611,3075866..3076186,
FT                   3076744..3076867,3079654..3079761,3081380..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..>3129453))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_j"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189951.0
FT                   protein_id=mCP110950.0 isoform=CRA_j"
FT                   /protein_id="EDL07383.1"
FT                   /translation="GAAGTMVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGAL
FT                   LIAGSEAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYV
FT                   FLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWR
FT                   GRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGT
FT                   WKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLT
FT                   TIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNP
FT                   AAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLT
FT                   FRKEPQPEPSPSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVP
FT                   KSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVS
FT                   IRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRIDMIVGPPPP
FT                   STPRHKKYPTKGPTAPSRESPQYSPRVDQIVGRGPTITDKDRTKGPAETELPEDPSMMG
FT                   RLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSRDHA
FT                   DKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVLR
FT                   LERSAGMMSCH"
FT   CDS             complement(join(3070567..3070611,3075866..3076186,
FT                   3076744..3076867,3079654..3079761,3081380..3081511,
FT                   3081986..3082094,3082758..3082945,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_e"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167925.0
FT                   protein_id=mCP90884.0 isoform=CRA_e"
FT                   /db_xref="GOA:B7ZBV8"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZBV8"
FT                   /protein_id="EDL07378.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
FT                   QPEPSPSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRI
FT                   KGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFK
FT                   ESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRIDMIVGPPPPSTPRHKKYPTKGPTAPS
FT                   RESPQYSPRVDQIVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLD
FT                   FLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTG
FT                   QRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVLRLERSAGMMSCH"
FT   CDS             complement(join(3070567..3070611,3075866..3076186,
FT                   3076744..3076867,3081380..3081511,3081986..3082094,
FT                   3082758..3082981,3091361..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_b"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167922.0
FT                   protein_id=mCP90869.0 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZBV7"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZBV7"
FT                   /protein_id="EDL07375.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
FT                   QPEPSPSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSF
FT                   GDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVC
FT                   VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPTITDKD
FT                   RTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAK
FT                   EPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQS
FT                   HQRHGTSPVGDHGSLVLRLERSAGMMSCH"
FT   CDS             complement(join(3070581..3070611,3081380..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..>3129453))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_i"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189950.0
FT                   protein_id=mCP110949.0 isoform=CRA_i"
FT                   /protein_id="EDL07382.1"
FT                   /translation="GAAGTMVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGAL
FT                   LIAGSEAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYV
FT                   FLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWR
FT                   GRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGT
FT                   WKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLT
FT                   TIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNP
FT                   AAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLT
FT                   FRKEPQPEPSPSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVP
FT                   KSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVS
FT                   IRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRSCDWRGVLA"
FT   CDS             complement(join(3070581..3070617,3081386..3081511,
FT                   3081986..3082094,3082758..3082981,3091361..3091390,
FT                   3094961..3095029,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_g"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167927.0
FT                   protein_id=mCP90840.0 isoform=CRA_g"
FT                   /protein_id="EDL07380.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
FT                   QPEPSPSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSF
FT                   GDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVC
FT                   VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLHSRSCDWRGVLA"
FT   mRNA            complement(join(<3075465..3076186,3076744..3076867,
FT                   3081380..3081511,3081986..3082094,3082758..3082981,
FT                   3086650..3086703,3091361..3091390,3094961..3095029,
FT                   3098053..3098082,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..>3129438))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT189949"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189949.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<3075465..3076186,3076744..3076867,
FT                   3081380..3081511,3081986..3082094,3082758..3082981,
FT                   3086650..3086703,3091361..3091390,3094961..3095029,
FT                   3098053..3098082,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_h"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT189949.0
FT                   protein_id=mCP110948.0 isoform=CRA_h"
FT                   /db_xref="GOA:B7ZBV9"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013821"
FT                   /db_xref="InterPro:IPR020969"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZBV9"
FT                   /protein_id="EDL07381.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKS
FT                   KSGLTFRKEPQPEPSPSKGRPCRGCLCGCCPGHSSQKVSLKDRVFSSPRGMAAKGKGSP
FT                   QAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDI
FT                   VEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGH
FT                   LDMLSRIKSLQSRVDQIVGRGPTITDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSME
FT                   KKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRST
FT                   SSTGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVRIPPPPAHERSLSAY
FT                   GGGNRASTEFLRLEGTPACRPSEAALRDSDTSISIPSVDHEELERSFSGFSISQSKENL
FT                   DALGSCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSATGEGPFGDVAWAGPRK"
FT   mRNA            complement(join(3080385..3081511,3081986..3082094,
FT                   3082758..3082981,3091361..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167923"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167923.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3081190..3081511,3081986..3082094,
FT                   3082758..3082981,3091361..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_c"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167923.0
FT                   protein_id=mCP90845.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E900"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:G5E900"
FT                   /protein_id="EDL07376.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
FT                   QPEPSPSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSF
FT                   GDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVC
FT                   VMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRQEPLPVQSGHEQGPP
FT                   GQNQAWHKGHQGLGDRCAEQGQYQLWRSLPTLLASCCFLLCFHTVCF"
FT   mRNA            complement(join(3090652..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167926"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167926.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3090877..3091390,3094961..3095029,
FT                   3098053..3098082,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167924"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167924.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3091186..3091390,3094961..3095029,
FT                   3099298..3099392,3103433..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_f"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167926.0
FT                   protein_id=mCP90868.0 isoform=CRA_f"
FT                   /db_xref="GOA:G3XA60"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA60"
FT                   /protein_id="EDL07379.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRLIPPLNQLELLRNLKSKSGLTFRKEP
FT                   QPEPSPRSVPPASSRPGVCCTHLALLSLCIHHVSWGRATMGPCVCFYVQQVTVCPGTPR
FT                   VTSQL"
FT   CDS             complement(join(3091186..3091390,3094961..3095029,
FT                   3098053..3098082,3099298..3099392,3103433..3103528,
FT                   3104086..3104196,3106359..3106484,3107422..3107597,
FT                   3107931..3108057,3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_d"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167924.0
FT                   protein_id=mCP90870.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3UWC1"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003937"
FT                   /db_xref="InterPro:IPR003947"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1309503"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC1"
FT                   /protein_id="EDL07377.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QSAWRFYATNLSRTDLHSTWQYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKS
FT                   KSGLTFRKEPQPEPSPRSVPPASSRPGVCCTHLALLSLCIHHVSWGRATMGPCVCFYVQ
FT                   QVTVCPGTPRVTSQL"
FT   mRNA            complement(join(3102855..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT167921"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167921.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3102855..3104196,3106359..3106484,
FT                   3107422..3107597,3107931..3108057,3108998..3109088,
FT                   3129143..>3129524))
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, transcript variant mCT23067"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT23067.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3103412..3103528,3104086..3104196,
FT                   3106359..3106484,3107422..3107597,3107931..3108057,
FT                   3108998..3109088,3129143..3129438))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_a"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT167921.0
FT                   protein_id=mCP90842.0 isoform=CRA_a"
FT                   /protein_id="EDL07374.1"
FT                   /translation="MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGS
FT                   EAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVF
FT                   SCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKF
FT                   ARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLG
FT                   SVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYG
FT                   DKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLI
FT                   QVSLSPC"
FT   CDS             complement(join(3103996..3104196,3106359..3106484,
FT                   3107422..3107597,3107931..3108057,3108998..3109088,
FT                   3129143..>3129453))
FT                   /codon_start=1
FT                   /gene="Kcnq2"
FT                   /locus_tag="mCG_23080"
FT                   /product="potassium voltage-gated channel, subfamily Q,
FT                   member 2, isoform CRA_k"
FT                   /note="gene_id=mCG23080.2 transcript_id=mCT23067.1
FT                   protein_id=mCP20315.1 isoform=CRA_k"
FT                   /protein_id="EDL07384.1"
FT                   /translation="GAAGTMVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGAL
FT                   LIAGSEAPKRGSVLSKPRTGGAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYV
FT                   FLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWR
FT                   GRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGT
FT                   WKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLT
FT                   TIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAVSPAHLPTLEMLGVLEAPHKVWPWPT
FT                   CEL"
FT   gene            complement(3131261..3131949)
FT                   /locus_tag="mCG_1030238"
FT                   /note="gene_id=mCG1030238.0"
FT   mRNA            complement(3131261..3131949)
FT                   /locus_tag="mCG_1030238"
FT                   /product="mCG1030238"
FT                   /note="gene_id=mCG1030238.0 transcript_id=mCT147942.1
FT                   created on 19-APR-2002"
FT   CDS             complement(3131759..3131875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030238"
FT                   /product="mCG1030238"
FT                   /note="gene_id=mCG1030238.0 transcript_id=mCT147942.1
FT                   protein_id=mCP66778.1"
FT                   /protein_id="EDL07385.1"
FT                   /translation="MHSKQVLLLLSHVPKLLFCIVRDILKDYFRGRGYWQKL"
FT   gene            complement(3142142..3151462)
FT                   /gene="Eef1a2"
FT                   /locus_tag="mCG_23079"
FT                   /note="gene_id=mCG23079.2"
FT   mRNA            complement(join(3142142..3142555,3143047..3143281,
FT                   3144125..3144381,3145368..3145518,3147233..3147529,
FT                   3148100..3148279,3149712..3149930,3151173..3151462))
FT                   /gene="Eef1a2"
FT                   /locus_tag="mCG_23079"
FT                   /product="eukaryotic translation elongation factor 1 alpha
FT                   2"
FT                   /note="gene_id=mCG23079.2 transcript_id=mCT23066.2 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3142428..3142555,3143047..3143281,
FT                   3144125..3144381,3145368..3145518,3147233..3147529,
FT                   3148100..3148279,3149712..3149855))
FT                   /codon_start=1
FT                   /gene="Eef1a2"
FT                   /locus_tag="mCG_23079"
FT                   /product="eukaryotic translation elongation factor 1 alpha
FT                   2"
FT                   /note="gene_id=mCG23079.2 transcript_id=mCT23066.2
FT                   protein_id=mCP20275.2"
FT                   /protein_id="EDL07386.1"
FT                   /translation="MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMIT
FT                   GTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYS
FT                   EKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGN
FT                   ASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFA
FT                   PVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQF
FT                   TSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDA
FT                   AIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKA
FT                   QKAGK"
FT   gene            3177448..3179279
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /note="gene_id=mCG23065.1"
FT   mRNA            join(3177448..3178225,3178321..3178507,3178580..3178657,
FT                   3178775..3178871,3178953..3179279)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT23052"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT23052.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(3177988..3178507,3178580..3178657,3178775..3178871,
FT                   3178953..3179279)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167917"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167917.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(3177988..3178225,3178321..3178657,3178775..3178871,
FT                   3178953..3179279)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167914"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167914.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(3177988..3178657,3178775..3178871,3178953..3179275)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167913"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167913.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(3177988..3178225,3178436..3178657,3178775..3178871,
FT                   3178953..3179275)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167915"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167915.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(3177988..3178225,3178436..3178507,3178580..3178657,
FT                   3178775..3178871,3178953..3179273)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167912"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167912.0 created
FT                   on 19-APR-2002"
FT   CDS             join(3178453..3178507,3178580..3178657,3178775..3178871,
FT                   3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_a"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167912.0
FT                   protein_id=mCP90855.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR37"
FT                   /db_xref="InterPro:IPR026754"
FT                   /db_xref="MGI:MGI:1913746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR37"
FT                   /protein_id="EDL07387.1"
FT                   /translation="MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPG
FT                   LPKADPGHWWASFFFGKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVI
FT                   HSGQTNPRDLS"
FT   CDS             join(3178453..3178507,3178580..3178657,3178775..3178871,
FT                   3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_a"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167917.0
FT                   protein_id=mCP90874.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR37"
FT                   /db_xref="InterPro:IPR026754"
FT                   /db_xref="MGI:MGI:1913746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR37"
FT                   /protein_id="EDL07392.1"
FT                   /translation="MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPG
FT                   LPKADPGHWWASFFFGKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVI
FT                   HSGQTNPRDLS"
FT   CDS             join(3178453..3178507,3178580..3178657,3178775..3178871,
FT                   3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_a"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT23052.1
FT                   protein_id=mCP20268.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR37"
FT                   /db_xref="InterPro:IPR026754"
FT                   /db_xref="MGI:MGI:1913746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR37"
FT                   /protein_id="EDL07393.1"
FT                   /translation="MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPG
FT                   LPKADPGHWWASFFFGKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVI
FT                   HSGQTNPRDLS"
FT   mRNA            join(3178685..3178871,3178953..3179279)
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, transcript variant
FT                   mCT167916"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167916.0 created
FT                   on 19-APR-2002"
FT   CDS             join(3178843..3178871,3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_b"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167913.0
FT                   protein_id=mCP90867.0 isoform=CRA_b"
FT                   /protein_id="EDL07388.1"
FT                   /translation="MTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPR
FT                   DLS"
FT   CDS             join(3178843..3178871,3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_b"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167914.0
FT                   protein_id=mCP90839.0 isoform=CRA_b"
FT                   /protein_id="EDL07389.1"
FT                   /translation="MTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPR
FT                   DLS"
FT   CDS             join(3178843..3178871,3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_b"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167915.0
FT                   protein_id=mCP90843.0 isoform=CRA_b"
FT                   /protein_id="EDL07390.1"
FT                   /translation="MTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPR
FT                   DLS"
FT   CDS             join(3178843..3178871,3178953..3179070)
FT                   /codon_start=1
FT                   /gene="2700038C09Rik"
FT                   /locus_tag="mCG_23065"
FT                   /product="RIKEN cDNA 2700038C09, isoform CRA_b"
FT                   /note="gene_id=mCG23065.1 transcript_id=mCT167916.0
FT                   protein_id=mCP90861.0 isoform=CRA_b"
FT                   /protein_id="EDL07391.1"
FT                   /translation="MTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPR
FT                   DLS"
FT   gene            complement(3185895..3193560)
FT                   /gene="Ptk6"
FT                   /locus_tag="mCG_23070"
FT                   /note="gene_id=mCG23070.1"
FT   mRNA            complement(join(3185895..3186727,3187072..3187225,
FT                   3187716..3187897,3189151..3189312,3189848..3190001,
FT                   3190370..3190533,3190902..3191023,3193046..3193560))
FT                   /gene="Ptk6"
FT                   /locus_tag="mCG_23070"
FT                   /product="PTK6 protein tyrosine kinase 6"
FT                   /note="gene_id=mCG23070.1 transcript_id=mCT23058.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3186540..3186727,3187072..3187225,
FT                   3187716..3187897,3189151..3189312,3189848..3190001,
FT                   3190370..3190533,3190902..3191023,3193046..3193275))
FT                   /codon_start=1
FT                   /gene="Ptk6"
FT                   /locus_tag="mCG_23070"
FT                   /product="PTK6 protein tyrosine kinase 6"
FT                   /note="gene_id=mCG23070.1 transcript_id=mCT23058.1
FT                   protein_id=mCP20261.1"
FT                   /db_xref="GOA:Q05AA8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:99683"
FT                   /db_xref="UniProtKB/TrEMBL:Q05AA8"
FT                   /protein_id="EDL07394.1"
FT                   /translation="MVSWDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWW
FT                   WATLLDAEGKALAEGYVPHNYLAEKETVESEPWFFGCISRSEAMHRLQAEDNSKGAFLI
FT                   RVSQKPGADYVLSVRDAQAVRHYRIWKNNEGRLHLNEAVSFSNLSELVDYHKTQSLSHG
FT                   LQLSMPCWKHKTEPLPHWDDWERPREEFTLCKKLGAGYFGEVFEALWKGQVHVAVKVIS
FT                   RDNLLHQHTFQAEIQAMKKLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSDE
FT                   KALPILELVDFASQVAEGMCYLESQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKED
FT                   IYLSHEHNVPYKWTAPEALSRGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNHETFLR
FT                   VDAGYRMPCPLECPPNIHKLMLSCWSRDPKQRPCFKDLCEKLTGITRYENLV"
FT   gene            complement(3196334..>3203746)
FT                   /gene="Srms"
FT                   /locus_tag="mCG_23068"
FT                   /note="gene_id=mCG23068.1"
FT   mRNA            complement(join(3196334..3197151,3197406..3197562,
FT                   3197644..3197825,3198390..3198548,3198635..3198776,
FT                   3199446..3199612,3200221..3200342,3203111..>3203746))
FT                   /gene="Srms"
FT                   /locus_tag="mCG_23068"
FT                   /product="src-related kinase lacking C-terminal regulatory
FT                   tyrosine and N-terminal myristylation sites"
FT                   /note="gene_id=mCG23068.1 transcript_id=mCT23055.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3196958..3197151,3197406..3197562,
FT                   3197644..3197825,3198390..3198548,3198635..3198776,
FT                   3199446..3199612,3200221..3200342,3203111..>3203526))
FT                   /codon_start=1
FT                   /gene="Srms"
FT                   /locus_tag="mCG_23068"
FT                   /product="src-related kinase lacking C-terminal regulatory
FT                   tyrosine and N-terminal myristylation sites"
FT                   /note="gene_id=mCG23068.1 transcript_id=mCT23055.0
FT                   protein_id=mCP20256.0"
FT                   /protein_id="EDL07395.1"
FT                   /translation="PEVGSMRFRPQPGPLGMEPFLRKRLTFLSFFWDKIWPADESEEDI
FT                   PRIQGHDDNPVPEQAAAVEPCSFPAPRARLFRALYDFTARCAEELSVSRGDRLYALKEE
FT                   GDYIFAQRLSGPPSTGLVPVTYLAKATPEPPSDQPWYFSGISRAQAQQLLLSPANAPGA
FT                   FLIRPSESSIGGYSLSVRAQAKVCHYRICMAPSGSLYLQEGQLFPSLDALLAYYKTNWK
FT                   LIQNPLLQPCIPQIPLAQDEWERPRSEFVLRRKLGEGFFGEVWEGLWLGSIPVAVKVIK
FT                   SADMKLADLTKEIEALKSLRHERLIRLHAICSLGEPVYIVTELMGKGNLQVYLGSSEGK
FT                   ALSLPHLLGFACQVAEGMSYLEERRVVHRDLAARNVLVGDDLTCKVADFGLARLLKDDV
FT                   YSPSSGSKIPVKWTAPEAANYRVFSQKSDVWSFGILLYEVFTYGQCPYEGMTNHETLQQ
FT                   ISRGYRLPRPAVCPAEVYVLMVECWKGSPEERPTFAILREKLNAINRRLHLGLT"
FT   gene            <3203345..3213606
FT                   /locus_tag="mCG_145910"
FT                   /note="gene_id=mCG145910.0"
FT   mRNA            join(<3203345..3206699,3206775..3206864,3213310..3213606)
FT                   /locus_tag="mCG_145910"
FT                   /product="mCG145910"
FT                   /note="gene_id=mCG145910.0 transcript_id=mCT186018.0
FT                   created on 04-JUL-2003"
FT   CDS             <3203485..3203910
FT                   /codon_start=1
FT                   /locus_tag="mCG_145910"
FT                   /product="mCG145910"
FT                   /note="gene_id=mCG145910.0 transcript_id=mCT186018.0
FT                   protein_id=mCP107695.0"
FT                   /protein_id="EDL07396.1"
FT                   /translation="GAWLRTKAHGADLGSVLWDLRAAAEEAEHYNHAPGSQGAREKPER
FT                   LVGQPGLPRAFCPRPYLVQNGKRQVTRTLTLTPEVTTECSLIRHTTVSFPDGVSMRGAD
FT                   GDLRPRTTRAAPPSLHTLLQLCGLVSWISAGVKSRWA"
FT   gene            3207467..3208936
FT                   /pseudo
FT                   /locus_tag="mCG_140077"
FT                   /note="gene_id=mCG140077.0"
FT   mRNA            3207467..3208936
FT                   /pseudo
FT                   /locus_tag="mCG_140077"
FT                   /note="gene_id=mCG140077.0 transcript_id=mCT167907.0
FT                   created on 19-APR-2002"
FT   gene            <3210766..3213603
FT                   /gene="BC051628"
FT                   /locus_tag="mCG_122029"
FT                   /note="gene_id=mCG122029.1"
FT   mRNA            join(<3210766..3210886,3212146..3213113,3213310..3213603)
FT                   /gene="BC051628"
FT                   /locus_tag="mCG_122029"
FT                   /product="cDNA sequence BC051628, transcript variant
FT                   mCT189941"
FT                   /note="gene_id=mCG122029.1 transcript_id=mCT189941.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3210768..3210886,3212146..3213113,3213310..3213332)
FT                   /codon_start=1
FT                   /gene="BC051628"
FT                   /locus_tag="mCG_122029"
FT                   /product="cDNA sequence BC051628, isoform CRA_b"
FT                   /note="gene_id=mCG122029.1 transcript_id=mCT189941.0
FT                   protein_id=mCP110931.0 isoform=CRA_b"
FT                   /protein_id="EDL07398.1"
FT                   /translation="GERGSGSAPCSSGWAPHRKRAARHLQRGAGAHGGDPEEECSQTMN
FT                   FQVTGLALDKMKLDSPHSFLDAEEVEEAEDQQLLEPEAWRTYMERRNVLREFLTTDLSP
FT                   QLLKRHHARMQLLKKCSYYIEILPKHLALGDQNPLVLPNTMFQLIDPWKFQRMKKVGTA
FT                   QTKIQLLLLGDLLEQLDHGRAALDALLEAPDPRPFLAGWGLVEQQLADLSVVMDNFLAM
FT                   MVPGHLHVKHRLVSDIGATKIPHIRLMLSTKMPVMFDRKESVAHQDWVSLRWFVTIQPA
FT                   APEQYELRFKLLEPRTQQECTQCGIVPVAACTFDVHNLLPNRTYKFTIKRAESYTLVYE
FT                   PWRDSLTLQTTPGPPEGPAPRLGEPPAGL"
FT   mRNA            join(3210821..3210886,3212146..3213198)
FT                   /gene="BC051628"
FT                   /locus_tag="mCG_122029"
FT                   /product="cDNA sequence BC051628, transcript variant
FT                   mCT123243"
FT                   /note="gene_id=mCG122029.1 transcript_id=mCT123243.0
FT                   created on 19-APR-2002"
FT   CDS             3212156..3213154
FT                   /codon_start=1
FT                   /gene="BC051628"
FT                   /locus_tag="mCG_122029"
FT                   /product="cDNA sequence BC051628, isoform CRA_a"
FT                   /note="gene_id=mCG122029.1 transcript_id=mCT123243.0
FT                   protein_id=mCP66814.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AS00"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:3051572"
FT                   /db_xref="UniProtKB/TrEMBL:A2AS00"
FT                   /protein_id="EDL07397.1"
FT                   /translation="MNFQVTGLALDKMKLDSPHSFLDAEEVEEAEDQQLLEPEAWRTYM
FT                   ERRNVLREFLTTDLSPQLLKRHHARMQLLKKCSYYIEILPKHLALGDQNPLVLPNTMFQ
FT                   LIDPWKFQRMKKVGTAQTKIQLLLLGDLLEQLDHGRAALDALLEAPDPRPFLAGWGLVE
FT                   QQLADLSVVMDNFLAMMVPGHLHVKHRLVSDIGATKIPHIRLMLSTKMPVMFDRKESVA
FT                   HQDWVSLRWFVTIQPAAPEQYELRFKLLEPRTQQECTQCGIVPVAACTFDVHNLLPNRT
FT                   YKFTIKRAESYTLVYEPWRDSLTLQTTPGPPEGPAPRLGKPSLPLTTPSER"
FT   gene            complement(3218365..3231705)
FT                   /locus_tag="mCG_23072"
FT                   /note="gene_id=mCG23072.1"
FT   mRNA            complement(join(3218365..3218587,3219532..3219620,
FT                   3219706..3219873,3219975..3220131,3220307..3220660,
FT                   3220818..3221007,3221085..3221201,3221284..3221431,
FT                   3221510..3221671,3221759..3221890,3221982..3222253,
FT                   3222475..3226159,3226304..3226379,3226540..3227323,
FT                   3228144..3228785,3228884..3229401,3230095..3230199,
FT                   3230273..3230456,3230768..3231705))
FT                   /locus_tag="mCG_23072"
FT                   /product="mCG23072, transcript variant mCT23057"
FT                   /note="gene_id=mCG23072.1 transcript_id=mCT23057.2 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3218366..3219620,3219706..3219873,
FT                   3219975..3220050,3220307..3220660,3220818..3221013,
FT                   3221085..3221201,3221284..3221431,3221510..3221671,
FT                   3222147..3222253,3222475..3226151,3226540..3227323,
FT                   3228144..3228785,3228884..3229401,3230095..3230199,
FT                   3230273..3230456,3230768..>3231048))
FT                   /locus_tag="mCG_23072"
FT                   /product="mCG23072, transcript variant mCT167920"
FT                   /note="gene_id=mCG23072.1 transcript_id=mCT167920.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3218483..3218587,3219532..3219620,
FT                   3219706..3219873,3219975..3220131,3220307..3220660,
FT                   3220818..3221007,3221085..3221201,3221284..3221431,
FT                   3221510..3221671,3221759..3221890,3221982..3222253,
FT                   3222475..3226159,3226304..3226379,3226540..3227323,
FT                   3228144..3228785,3228884..3229401,3230095..3230199,
FT                   3230273..3230456,3230768..3231048))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23072"
FT                   /product="mCG23072, isoform CRA_b"
FT                   /note="gene_id=mCG23072.1 transcript_id=mCT23057.2
FT                   protein_id=mCP20269.2 isoform=CRA_b"
FT                   /protein_id="EDL07400.1"
FT                   /translation="MAVWKAEQLDGLQRGDLLTYPLFGENKWKASPNPNPPVTKLYCHA
FT                   CLVTCNSQEAFENHCSSLEHAQMVAFDQAVPWKHRAPPMGLSKFDLCPRPDLCEHGEVC
FT                   IKAHSKQELQEWVQRAQDMELREQAAWQDGLVPYQARLLAEYQRSSKEVSVMAETIRGV
FT                   SVTCHPPPVHQAQEKIQHQWVFTIHSEDPLLHVALLNQEPGAAFSLVAPSLPPHQLYAQ
FT                   GKHFCVQSSPAQYKVGVLVQAVAFGSFEQWVVFDFGRRPVLLQKLKLQLGQTHSQGLNG
FT                   KPAPSHPQELECWHTGNRHVVLEVDWTPEQEALMAKYKLPSLALEFNQIVPDWGPISRS
FT                   NYRQRMHKFLYEEEAAQQQLVAKLAMKGQVSLKTALETPALGMLFAPPGALYAKVPFHS
FT                   SLLPDTDQGFLLSRAVSTALVAPVPAPNSTVYQVRLEARASSDHALWLLLPARCCMALG
FT                   LQAQDSPILEVQFQIDPMTFRFWHQAVDALLEEHLVVPDLPACTLPHPWPTPPSFRGNH
FT                   KQKLAVGLIAGRRPEGTKHIPPLLIYGPFGTGKTYTLAMAALEVVQQPHTKVLICTHTN
FT                   SAADIYIREYFHDYVSSGHPEATPLRVMYADRPPRQTDPTTLQYCCLTEDRQAFRPPTG
FT                   PELVHHRLVVTTTSQARELQVPAGFFSHIFIDEAAQMLECEALIPLSYALSLTRVVLAG
FT                   DHMQVTPRLFSVPRDKSARHTLLHRLFLYYQQEAHKIAQQSRIIFHENYRSTAAIINFV
FT                   SHHFYLAKGNPIQASGKVPRHPQHYPLMFCHVAGSPEQDMSMTSWLNSAEVTQVVEKVR
FT                   EIYNTWPHCWGPREQRHICAVSHGAQVSALRQELRRRNLGEVSVGSFEILPGREFRVVV
FT                   LSSVHNRNSLLSPGAPTSEFFTEPRVLNTVMTRAQSQLVAVGDAVALCSSGACRNLWRS
FT                   FIRECIEHHSAFPEELSLEQIEQGVAQRQNWASLTLKARGPETEQKSMAQGPQRLIAEG
FT                   TMVTVKAETRAEAAAKAQTAAVAAEDTASGNSASRDAAAEVSTLEGGMSEEDSESDFWP
FT                   SDWELNADDAILKELLDESQQVTVTVREDGLLDTVVCSAPQKAREYTNLPSSVLWKFLR
FT                   SNSKQFRRCSFLQETFERALATPLDDMASSPIQVRGRLNCGMAFTGDEVLVQILGPAGD
FT                   DRCVPGSLQGRVMGVLKRRRHELAFVCRMDEWDPRIMIPINGSVTKIFVAEMKDPQQVP
FT                   IHRLIQGQVQRVRHETLKPEDRSTRLFWVRIVLWRERFYYPLGIVLEVLPKAITWEQGL
FT                   YILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRHFLTFTVDPQGACNLDDA
FT                   LSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAPNREPVLMLPASLCQDA
FT                   LSLLPGQDRLAISLFLTMEKGGGQIKSLRFAPSIIRSDRQLSYEEAEELIKRHPGAGLE
FT                   LPAHLDSVEACVVAACYFSWMLRRQRLSAACYYEPPDEDSVLGFRTAHIMVQEYMIQFN
FT                   SHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFKKYRGLVPLSLHLCHHSNTDYTPNK
FT                   QLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACLDLRRALGRSVFGRSSQG
FT                   KQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGSTYSNRDIDGLCLDFSR
FT                   QYASAQSYQRRAYSLHLAIQLKSQPQNKLGFVVDVEMGARCFKVLFPINRETLPDPCPI
FT                   HYHSLQLAEHPQELVSQTGVRLVWRRRMYSVQASKLPLPLLGTSLDPHTQTVDAALWMK
FT                   LLMLLKEQRWPEIAALIQEQDKRFHPREKVKIHQSRCGHFVEVVYELGSGDTLQVQLGS
FT                   SLQRGFLAPTLKLWTVVPGFSLCLEHMERPGDCFSSHVHQALQDQYLQVGEYSGAWGPR
FT                   CALESLTNAVTENDSIVLHDVHISWDTSQGQLQGTFQLEAAFLQEKCINIHFGCCYLCI
FT                   RLEGLPLPLDSSLPGPSGLGPFLNIDPNTYTWVAHGLSGDWDHELAGGDWDQENVDDRQ
FT                   EAPKQVYFLIHHMTMEKVPEEVLRPSARFTVEVLSKQLPDLRKEEAVRQLKTASPLVIS
FT                   IALGLPIPEIRWPISGPRRLVSELRWPIPGPRRPVSEPHRPMSGPCGPISEPCRSIPEP
FT                   CRGNWPRQHSFHKASTSRFLERQNYNIPAGHHKLNQSQDRAVRSALQKQFTVIQGPPGT
FT                   GKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRK
FT                   TEMKPLRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYA
FT                   AEIRKFDAQLREGKIFSKEDLRVRVLGKARKHELERHSVILCTCSCAASKSLKILNVRQ
FT                   ILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERY
FT                   HRDAIMLDTQYRMHKDICSFPSVEFYGGKLKTWSDLRRLPSILGHTGKPSCSVIFGSVQ
FT                   GHEQKLLVSTEDGNENSRANPEEVTQVVRIIKQLTLDRTVDPKDIAVLTPYNAQAAAIS
FT                   RGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRTCPRSDVDQRPTKSWLKKFLGFVVDP
FT                   HQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQHSLVSAEKCDNPTPNPAEVR
FT                   VAASEIYTRTSGASKAWLQNLL"
FT   CDS             complement(join(3219496..3219620,3219706..3219873,
FT                   3219975..3220050,3220307..3220660,3220818..3221013,
FT                   3221085..3221201,3221284..3221431,3221510..3221671,
FT                   3222147..3222253,3222475..3226151,3226540..3227323,
FT                   3228144..3228785,3228884..3229401,3230095..3230199,
FT                   3230273..3230456,3230768..3231048))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23072"
FT                   /product="mCG23072, isoform CRA_a"
FT                   /note="gene_id=mCG23072.1 transcript_id=mCT167920.0
FT                   protein_id=mCP90852.0 isoform=CRA_a"
FT                   /protein_id="EDL07399.1"
FT                   /translation="MAVWKAEQLDGLQRGDLLTYPLFGENKWKASPNPNPPVTKLYCHA
FT                   CLVTCNSQEAFENHCSSLEHAQMVAFDQAVPWKHRAPPMGLSKFDLCPRPDLCEHGEVC
FT                   IKAHSKQELQEWVQRAQDMELREQAAWQDGLVPYQARLLAEYQRSSKEVSVMAETIRGV
FT                   SVTCHPPPVHQAQEKIQHQWVFTIHSEDPLLHVALLNQEPGAAFSLVAPSLPPHQLYAQ
FT                   GKHFCVQSSPAQYKVGVLVQAVAFGSFEQWVVFDFGRRPVLLQKLKLQLGQTHSQGLNG
FT                   KPAPSHPQELECWHTGNRHVVLEVDWTPEQEALMAKYKLPSLALEFNQIVPDWGPISRS
FT                   NYRQRMHKFLYEEEAAQQQLVAKLAMKGQVSLKTALETPALGMLFAPPGALYAKVPFHS
FT                   SLLPDTDQGFLLSRAVSTALVAPVPAPNSTVYQVRLEARASSDHALWLLLPARCCMALG
FT                   LQAQDSPILEVQFQIDPMTFRFWHQAVDALLEEHLVVPDLPACTLPHPWPTPPSFRGNH
FT                   KQKLAVGLIAGRRPEGTKHIPPLLIYGPFGTGKTYTLAMAALEVVQQPHTKVLICTHTN
FT                   SAADIYIREYFHDYVSSGHPEATPLRVMYADRPPRQTDPTTLQYCCLTEDRQAFRPPTG
FT                   PELVHHRLVVTTTSQARELQVPAGFFSHIFIDEAAQMLECEALIPLSYALSLTRVVLAG
FT                   DHMQVTPRLFSVPRDKSARHTLLHRLFLYYQQEAHKIAQQSRIIFHENYRSTAAIINFV
FT                   SHHFYLAKGNPIQASGKVPRHPQHYPLMFCHVAGSPEQDMSMTSWLNSAEVTQVVEKVR
FT                   EIYNTWPHCWGPREQRHICAVSHGAQFRVVVLSSVHNRNSLLSPGAPTSEFFTEPRVLN
FT                   TVMTRAQSQLVAVGDAVALCSSGACRNLWRSFIRECIEHHSAFPEELSLEQIEQGVAQR
FT                   QNWASLTLKARGPETEQKSMAQGPQRLIAEGTMVTVKAETRAEAAAKAQTAAVAAEDTA
FT                   SGNSASRDAAAEVSTLEGGMSEEDSESDFWPSDWELNADDAILKELLDESQQVTVTVRE
FT                   DGLLDTVVCSAPQKAREYTNLPSSVLWKFLRSNSKQFRRCSFLQETFERALATPLDDMA
FT                   SSPIQVRGRLNCGMAFTGDEVLVQILGPAGDDRCVPGSLQGRVMGVLKRRRHELAFVCR
FT                   MDEWDPRIMIPINGSVTKIFVAEMKDPQQVPIHRLIQGQVQRVRHETLKPEDRSTRLFW
FT                   VRIVLWRERFYYPLGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRS
FT                   ELNTAAGHREDYRHFLTFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGA
FT                   LDVEARQQGTVFYAPNREPVLMLPASLCQDALSLLPGQDRLAISLFLTMEKGGGQIKSL
FT                   RFAPSIIRSDRQLSYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLS
FT                   AACYYEPPDEDSVLGFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQ
FT                   QLDSVFKKYRGLVPLSLHLCHHSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLI
FT                   AADDMHPSLAPACLDLRRALGRSVFGRSSQGKQQPAVHHSLQVDWYTWATSPIRRYLDV
FT                   VLQRLILLALGHRGSTYSNRDIDGLCLDFSRQYASAQSYQRRAYSLHLAIQLKSQPQNK
FT                   LGFVVDVEMGARCFKVLFPINRETLPDPCPIHYHSLQLAEHPQELVSQTGVRLVWRRRM
FT                   YSVQASKLPLPLLGTSLDPHTQTVDAALWMKLLMLLKEQRWPEIAALIQEQDKRFHPRE
FT                   KVKIHQSRCGHFVEVVYELGSGDTLQVQLGSSLQRGFLAPTLKLWTVVPGFSLCLEHME
FT                   RPGDCFSSHVHQALQDQYLQVGEYSGAWGPRCALESLTNAVTENDSIVLHDVHISWDTS
FT                   QGQLQGTFQLEAAFLQEKCINIHFGCCYLCIRLEGLPLPLDSSLPGPSGLGPFLNIDPN
FT                   TYTWVAHGLSGDWDHELAGGDWDQENVDDRQEAPKQVYFLIHHMTMEKVPEEVLRPSAR
FT                   FTVEVLSKQLPDLRKEEAVRQLKTASPLVISIALGLPIPEIRWPISGPRTGKTVVGFHI
FT                   VYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDVLGGLLLRRKTEMKPLRVY
FT                   GEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRIRQAPNPYAAEIRKFDAQ
FT                   LREGKIFSKEDLRVYRRVLGKARKHELERHSVILCTCSCAASKSLKILNVRQILIDEAG
FT                   MATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGMDRSLFERYHRDAIML
FT                   DTQYRMHKDICSFPSVEFYGGKLKTWSDLRRLPSILGHTGKPSCSVIFGSVQGHEQKLL
FT                   VSTEDGNENSRANPEEVTQVAAAISRGLMQRGVTGVTVTSITKSQGSEWRYVIVSTVRT
FT                   CPRSDVDQRPTKSWLKKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLD
FT                   FCEAQHSLVSAEKVRVQRKSALSS"
FT   gene            complement(3242214..3268685)
FT                   /gene="Gmeb2"
FT                   /locus_tag="mCG_23074"
FT                   /note="gene_id=mCG23074.2"
FT   mRNA            complement(join(3242214..3245182,3245901..3246023,
FT                   3246254..3246391,3246631..3246702,3249760..3249917,
FT                   3251071..3251174,3255715..3255842,3256549..3256646,
FT                   3268512..3268685))
FT                   /gene="Gmeb2"
FT                   /locus_tag="mCG_23074"
FT                   /product="glucocorticoid modulatory element binding protein
FT                   2"
FT                   /note="gene_id=mCG23074.2 transcript_id=mCT23061.2 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3244542..3245182,3245901..3246023,
FT                   3246254..3246391,3246631..3246702,3249760..3249917,
FT                   3251071..3251174,3255715..3255842,3256549..3256646,
FT                   3268512..3268642))
FT                   /codon_start=1
FT                   /gene="Gmeb2"
FT                   /locus_tag="mCG_23074"
FT                   /product="glucocorticoid modulatory element binding protein
FT                   2"
FT                   /note="gene_id=mCG23074.2 transcript_id=mCT23061.2
FT                   protein_id=mCP20260.1"
FT                   /protein_id="EDL07401.1"
FT                   /translation="MATPDVSVHMEEVVVVTTPDTAVDGSGVEEVKTVLVTTNLAPHGG
FT                   DLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLI
FT                   WRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELD
FT                   FYQHDKVCSNTCRSTKIDLSGARVSLSSPTSTEYIPLTPAAADVNGSPATITIETCEDP
FT                   GDWTTTIGDDTFAFWRGLKDAGLLDEVIQEFQQELEETMKGLQQRVQDPPLQLRDAVLL
FT                   NNIVQNFGMLDLVKKVLASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHL
FT                   SNVLMTLTPVPLPSPMKRPRLARATSGPAAMASQVLTQSAQIALSPGMPVSQLTSVPLG
FT                   KVVSTLPSTVLGKGSPQAAPASSPASPLLGGYTVLASSGSTFPNAVEIHPDTSSLTVLS
FT                   TAAMQDGSTVLKVVSPLQLLTLPGLGPTLQNVAQASPAGSTIVTMPTATATGPEEHTAT
FT                   IEVAAVAEDHEQK"
FT   gene            3278563..3284443
FT                   /locus_tag="mCG_23067"
FT                   /note="gene_id=mCG23067.2"
FT   mRNA            join(3278563..3278711,3282550..3284443)
FT                   /locus_tag="mCG_23067"
FT                   /product="mCG23067"
FT                   /note="gene_id=mCG23067.2 transcript_id=mCT23054.2 created
FT                   on 06-JUN-2003"
FT   CDS             3282938..3283600
FT                   /codon_start=1
FT                   /locus_tag="mCG_23067"
FT                   /product="mCG23067"
FT                   /note="gene_id=mCG23067.2 transcript_id=mCT23054.2
FT                   protein_id=mCP20271.2"
FT                   /protein_id="EDL07402.1"
FT                   /translation="MLVLEWPMPAQDLFDYITEKGLLGESCSCSFFTQVVAAVQHCHAC
FT                   GVVHWDIKDENILIDLCQGSIKLIDFGSRALLHDEPYTDFDGTRVYSPPKWILRHQYHA
FT                   LPATIWSLGVLLYDMLCGDIPFKRDQEILEAELDFPAHVSPDCCALIRRCLAPKPCSRP
FT                   SLEEVLLNPWMQTPAEEKPINSSKGSPPPCPGPCFPRPSQALESHGHATGIDGHLLT"
FT   gene            3285048..3285474
FT                   /locus_tag="mCG_1030240"
FT                   /note="gene_id=mCG1030240.0"
FT   mRNA            join(3285048..3285129,3285147..3285474)
FT                   /locus_tag="mCG_1030240"
FT                   /product="mCG1030240"
FT                   /note="gene_id=mCG1030240.0 transcript_id=mCT147944.0
FT                   created on 06-JUN-2003"
FT   CDS             join(3285114..3285129,3285147..3285199)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030240"
FT                   /product="mCG1030240"
FT                   /note="gene_id=mCG1030240.0 transcript_id=mCT147944.0
FT                   protein_id=mCP66780.1"
FT                   /protein_id="EDL07403.1"
FT                   /translation="MLPPPLCVCVCACVCVCVCVCN"
FT   gene            complement(3297104..3304933)
FT                   /gene="Stmn3"
FT                   /locus_tag="mCG_23066"
FT                   /note="gene_id=mCG23066.1"
FT   mRNA            complement(join(3297104..3297468,3297861..3298052,
FT                   3299366..3299541,3299792..3299887,3304839..3304933))
FT                   /gene="Stmn3"
FT                   /locus_tag="mCG_23066"
FT                   /product="stathmin-like 3"
FT                   /note="gene_id=mCG23066.1 transcript_id=mCT23053.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3297409..3297468,3297861..3298052,
FT                   3299366..3299541,3299792..3299887,3304839..3304857))
FT                   /codon_start=1
FT                   /gene="Stmn3"
FT                   /locus_tag="mCG_23066"
FT                   /product="stathmin-like 3"
FT                   /note="gene_id=mCG23066.1 transcript_id=mCT23053.0
FT                   protein_id=mCP20314.1"
FT                   /db_xref="GOA:Q545T6"
FT                   /db_xref="InterPro:IPR000956"
FT                   /db_xref="InterPro:IPR028835"
FT                   /db_xref="MGI:MGI:1277137"
FT                   /db_xref="UniProtKB/TrEMBL:Q545T6"
FT                   /protein_id="EDL07404.1"
FT                   /translation="MASTVSAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGDMEVKQL
FT                   DKRASGQSFEVILKSPSDLSPESPVLSSPPKRKDASLEELQKRLEAAEERRKTQEAQVL
FT                   KQLAERREHEREVLHKALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRERLREKEL
FT                   HAAEVRRNKEQREEMSG"
FT   gene            3311594..3346838
FT                   /gene="Rtel1"
FT                   /locus_tag="mCG_23073"
FT                   /note="gene_id=mCG23073.2"
FT   mRNA            join(3311594..3311701,3312956..3313154,3313445..3313538,
FT                   3314007..3314088,3314328..3314388,3319247..3319322,
FT                   3321436..3321520,3325554..3325619,3326535..3326688,
FT                   3329805..3329883,3331138..3331235,3332167..3332222,
FT                   3337053..3337127,3337234..3337315,3339396..3339528,
FT                   3339684..3339797,3339890..3339930,3340116..3340201,
FT                   3340347..3340424,3340856..3340933,3341248..3341394,
FT                   3341473..3341588,3341797..3341920,3342024..3342174,
FT                   3342262..3342401,3342974..3343069,3344198..3344396,
FT                   3344574..3344714,3345230..3345346,3345549..3345773,
FT                   3345872..3346033,3346145..3346300,3346352..3346479,
FT                   3346579..3346838)
FT                   /gene="Rtel1"
FT                   /locus_tag="mCG_23073"
FT                   /product="regulator of telomere elongation helicase 1"
FT                   /note="gene_id=mCG23073.2 transcript_id=mCT23060.2 created
FT                   on 19-APR-2002"
FT   CDS             join(3311600..3311701,3312956..3313154,3313445..3313538,
FT                   3314007..3314088,3314328..3314388,3319247..3319322,
FT                   3321436..3321520,3325554..3325619,3326535..3326688,
FT                   3329805..3329883,3331138..3331235,3332167..3332222,
FT                   3337053..3337127,3337234..3337315,3339396..3339528,
FT                   3339684..3339797,3339890..3339930,3340116..3340201,
FT                   3340347..3340424,3340856..3340933,3341248..3341394,
FT                   3341473..3341588,3341797..3341920,3342024..3342174,
FT                   3342262..3342401,3342974..3343069,3344198..3344396,
FT                   3344574..3344714,3345230..3345346,3345549..3345773,
FT                   3345872..3346033,3346145..3346300,3346352..3346479,
FT                   3346579..3346659)
FT                   /codon_start=1
FT                   /gene="Rtel1"
FT                   /locus_tag="mCG_23073"
FT                   /product="regulator of telomere elongation helicase 1"
FT                   /note="gene_id=mCG23073.2 transcript_id=mCT23060.2
FT                   protein_id=mCP20273.2"
FT                   /protein_id="EDL07405.1"
FT                   /translation="MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTG
FT                   TGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGDSIECYT
FT                   DIPKIIYASRTHSQLTQVIRELRNTAYRPKVCVLGSREQLCIHPEVKKQESNHMQISLC
FT                   RKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADII
FT                   FMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQ
FT                   VLEEQARVTQQGELQQEFIVDTSSSVILLRLEEAIDAVQLPGDDRGVTKPGSYIFELFA
FT                   EAQITFQTKGCILESLDQIIQHLAGRTGVFTNTAGLQKLMDIIQIVFSVDPPEGSPGSL
FT                   VGLGISHSYKVHIHPETSHRRAAKRSDAWSTTASRKQGKVLSYWCFSPSQSMRELVCQG
FT                   VRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYD
FT                   KRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLF
FT                   VEPRNKGSFSEVIDAYYQQVASPASNGATFLAVCRGKASEGLDFSDMNGRGVIVTGLPY
FT                   PPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGA
FT                   IFLCDHRFAYADARAQLPSWVRPYLKVYDNFGHVIRDVAQFFRVAQKTMPLPVPQAVTS
FT                   SVSEGEIALKDATLSSYSLSTRKAMSLDVHVPSLRQKPIGLPAAGDSESSLCGEYEQQT
FT                   FSAQQRPMGLLAALEYNEQKAGASEEQALGSSTPSLRCEKRLSTEQKGGRKKVRLVNHP
FT                   EEPMAGTQAGRAKMFMVAVKQALSQANFDTFTQALQHYKSSDDFEALVASLTCLFAEDP
FT                   KKHTLLKGFYQFVRPHHKQQFEDICFQLTGQRCGYQPGNNFPFGEQAQSTVDFTRKREL
FT                   ESKLTLSEGVDRQLDPGQHLNQGQPHLSAHPTSKGHTSHCTKVGCAVEKPGQPAVSDYL
FT                   SDVHKALGSASCNQLTAALRAYKQDDDLDKVVAVVAALTTAKPEHLPLLQRFGMFVRRH
FT                   HKPQFLQTCADLMGLPTTGKDLELEGPRDESPTVPPELTHEDLKPGPSMSKKPEKTQSK
FT                   ISSFFRQRPDESVRSDDTTPKPMQLPPRLPHELMKPHRMCSLRPPATEFVCPACATEDT
FT                   VLFQCPSCDFYRCWACWKLQLQASRLCPACGAVNRKQSITQVIWPKPQ"
FT   gene            complement(3347910..3355573)
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /note="gene_id=mCG23071.1"
FT   mRNA            complement(join(3347910..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354316,
FT                   3354531..3354618,3354825..3354931,3355439..3355573))
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   transcript variant mCT23059"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT23059.1 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3348053..3349782,3349860..3349960,
FT                   3351612..3351693,3354234..3354316,3354531..3354618,
FT                   3354825..3354931,3355439..>3355562))
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   transcript variant mCT189945"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT189945.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3349321..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354316,
FT                   3354531..3354618,3354825..3354931,3355433..>3355571))
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   transcript variant mCT189944"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT189944.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3349536..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354458))
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   transcript variant mCT167918"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT167918.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3349695..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354316,
FT                   3354531..3354618,3354825..3354931,3355433..>3355442))
FT                   /codon_start=1
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT189944.0
FT                   protein_id=mCP110946.0 isoform=CRA_b"
FT                   /protein_id="EDL07407.1"
FT                   /translation="AGTGCQNRMYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQS
FT                   KTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGV
FT                   IYVIDSTDEERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCT
FT                   CKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT"
FT   CDS             complement(join(3349695..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354316,
FT                   3354531..3354618,3354825..3354917))
FT                   /codon_start=1
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT23059.1
FT                   protein_id=mCP20267.1 isoform=CRA_d"
FT                   /protein_id="EDL07409.1"
FT                   /translation="MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNY
FT                   KGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTD
FT                   EERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDC
FT                   LTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT"
FT   CDS             complement(join(3349695..3349782,3349860..3349960,
FT                   3351222..3351292,3351612..3351693,3354234..3354284))
FT                   /codon_start=1
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT167918.0
FT                   protein_id=mCP90837.0 isoform=CRA_e"
FT                   /protein_id="EDL07410.1"
FT                   /translation="MFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFE
FT                   KVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQACSALTGKG
FT                   VREGIEWMVKCVVRNVHRPPRQRDIT"
FT   CDS             complement(join(3349941..3349960,3351612..3351693,
FT                   3354234..3354316,3354531..3354618,3354825..3354931,
FT                   3355439..>3355442))
FT                   /codon_start=1
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT189945.0
FT                   protein_id=mCP110947.0 isoform=CRA_c"
FT                   /protein_id="EDL07408.1"
FT                   /translation="AGCQNRMYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKT
FT                   RFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIY
FT                   VIDSTDEERLSESKEAFDLPLHS"
FT   mRNA            complement(join(3354294..3354931,3355439..3355555))
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   transcript variant mCT167919"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT167919.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(3354684..3354917)
FT                   /codon_start=1
FT                   /gene="Arfrp1"
FT                   /locus_tag="mCG_23071"
FT                   /product="ADP-ribosylation factor related protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23071.1 transcript_id=mCT167919.0
FT                   protein_id=mCP90866.0 isoform=CRA_a"
FT                   /protein_id="EDL07406.1"
FT                   /translation="MYTLLSGLYKYMFQKDEYCILILGLDNAGKTVGPCSLTSSHSLPD
FT                   LTPAPRLQVSSHQPPEDQATGRGVHGCMGVKG"
FT   gene            3355148..3371044
FT                   /gene="Zgpat"
FT                   /locus_tag="mCG_140078"
FT                   /note="gene_id=mCG140078.2"
FT   mRNA            join(3355148..3355596,3355865..3356472,3368634..3368767,
FT                   3369002..3369157,3369821..3369940,3370025..3370430,
FT                   3370626..3370978)
FT                   /gene="Zgpat"
FT                   /locus_tag="mCG_140078"
FT                   /product="zinc finger, CCCH-type with G patch domain,
FT                   transcript variant mCT167910"
FT                   /note="gene_id=mCG140078.2 transcript_id=mCT167910.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(<3355643..3356472,3368634..3368767,3369002..3369157,
FT                   3369821..3369940,3370025..3370430,3370626..3371044)
FT                   /gene="Zgpat"
FT                   /locus_tag="mCG_140078"
FT                   /product="zinc finger, CCCH-type with G patch domain,
FT                   transcript variant mCT189958"
FT                   /note="gene_id=mCG140078.2 transcript_id=mCT189958.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3355796..3356472,3368634..3368767,3369002..3369157,
FT                   3369821..3369940,3370025..3370430,3370626..3370764)
FT                   /codon_start=1
FT                   /gene="Zgpat"
FT                   /locus_tag="mCG_140078"
FT                   /product="zinc finger, CCCH-type with G patch domain,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140078.2 transcript_id=mCT189958.0
FT                   protein_id=mCP110933.0 isoform=CRA_a"
FT                   /protein_id="EDL07411.1"
FT                   /translation="RFWGRRCPELFLLLFLLFLSAVKVPNPACWVGMDEDNLETALQTY
FT                   RAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKSKLLSTVDQESPA
FT                   QEDAEYLAFQKAIAEEVEAPGAPCNDSETAPGSEVQPGSTSSALEEEEEDPDLEELSGA
FT                   KVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLYLYPTHKSLKPCPFFLEGKCRFK
FT                   ENCRFSHGQVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITDVDNGYYTVKF
FT                   DSLLLKEAVVEGDSILPPLRTEATESSDSDTGDASDSSYARVVEPSTVDTGTCSSAFAG
FT                   WEVHTRGIGSKLLVKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKKTKR
FT                   GQAGSNRPPKCRRSGSRPEGRPPPRNVFDFLNEKLQSQVPGTPDAGVDTPERRNKDMYH
FT                   ASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGRHNMTTAHLQEKLEGAQRQL
FT                   GQLRAQEADLQRKQRKADTHRKMTEF"
FT   CDS             join(3355892..3356472,3368634..3368767,3369002..3369157,
FT                   3369821..3369940,3370025..3370430,3370626..3370764)
FT                   /codon_start=1
FT                   /gene="Zgpat"
FT                   /locus_tag="mCG_140078"
FT                   /product="zinc finger, CCCH-type with G patch domain,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140078.2 transcript_id=mCT167910.1
FT                   protein_id=mCP90836.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VDM1"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="MGI:MGI:2449939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDM1"
FT                   /protein_id="EDL07412.1"
FT                   /translation="MDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKE
FT                   LIELTEASLLSVRKSKLLSTVDQESPAQEDAEYLAFQKAIAEEVEAPGAPCNDSETAPG
FT                   SEVQPGSTSSALEEEEEDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSAC
FT                   VRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSVDELRPFQDPDLSLLQTGSA
FT                   CLAKHQDGLWHPARITDVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEATESSDSDTG
FT                   DASDSSYARVVEPSTVDTGTCSSAFAGWEVHTRGIGSKLLVKMGYEFGKGLGRHAEGRV
FT                   EPIHAVVLPRGKSLDQCAEILQKKTKRGQAGSNRPPKCRRSGSRPEGRPPPRNVFDFLN
FT                   EKLQSQVPGTPDAGVDTPERRNKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQE
FT                   ALTRNTGRHNMTTAHLQEKLEGAQRQLGQLRAQEADLQRKQRKADTHRKMTEF"
FT   gene            3371486..3373879
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /note="gene_id=mCG23064.2"
FT   mRNA            join(3371486..3372565,3372738..3372795,3372867..3372954,
FT                   3373050..3373411,3373509..3373877)
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1,
FT                   transcript variant mCT23051"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT23051.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(3371606..3371645,3372445..3372795,3372867..3372954,
FT                   3373050..3373411,3373509..3373879)
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1,
FT                   transcript variant mCT167909"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT167909.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(3371606..3371645,3372445..3372565,3372738..3372795,
FT                   3372867..3372954,3373050..3373411,3373509..3373879)
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1,
FT                   transcript variant mCT167908"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT167908.0 created
FT                   on 19-APR-2002"
FT   CDS             join(3372468..3372565,3372738..3372795,3372867..3372954,
FT                   3373050..3373411,3373509..3373712)
FT                   /codon_start=1
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT23051.1
FT                   protein_id=mCP20313.1 isoform=CRA_b"
FT                   /protein_id="EDL07414.1"
FT                   /translation="MRPPVPSAPLALWVLGCFSLLLWLWALCTACHRKRAQRQQTGLQD
FT                   SLVPVEMPLLRQTHLCSLSKSDTRLHELHRGPRSSIAPRPASMDLLHPRWLEMSRGSTR
FT                   SQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLT
FT                   ISCARLGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQMDVLYSRVCKPKRRDPRPVT
FT                   DQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL"
FT   CDS             join(3372468..3372565,3372738..3372795,3372867..3372954,
FT                   3373050..3373411,3373509..3373712)
FT                   /codon_start=1
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT167908.0
FT                   protein_id=mCP90847.0 isoform=CRA_b"
FT                   /protein_id="EDL07415.1"
FT                   /translation="MRPPVPSAPLALWVLGCFSLLLWLWALCTACHRKRAQRQQTGLQD
FT                   SLVPVEMPLLRQTHLCSLSKSDTRLHELHRGPRSSIAPRPASMDLLHPRWLEMSRGSTR
FT                   SQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLT
FT                   ISCARLGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQMDVLYSRVCKPKRRDPRPVT
FT                   DQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL"
FT   CDS             join(3372793..3372795,3372867..3372954,3373050..3373411,
FT                   3373509..3373712)
FT                   /codon_start=1
FT                   /gene="Lime1"
FT                   /locus_tag="mCG_23064"
FT                   /product="Lck interacting transmembrane adaptor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23064.2 transcript_id=mCT167909.0
FT                   protein_id=mCP90863.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3T9B9"
FT                   /db_xref="InterPro:IPR026072"
FT                   /db_xref="MGI:MGI:1919949"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9B9"
FT                   /protein_id="EDL07413.1"
FT                   /translation="MPLLRQTHLCSLSKSDTRLHELHRGPRSSIAPRPASMDLLHPRWL
FT                   EMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPV
FT                   VWAGTQLTISCARLGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQMDVLYSRVCKPK
FT                   RRDPRPVTDQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL"
FT   gene            3375811..>3377293
FT                   /locus_tag="mCG_58991"
FT                   /note="gene_id=mCG58991.1"
FT   mRNA            join(3375811..3375913,3376371..3376560,3376636..3376740,
FT                   3376848..>3377293)
FT                   /locus_tag="mCG_58991"
FT                   /product="mCG58991"
FT                   /note="gene_id=mCG58991.1 transcript_id=mCT59174.2 created
FT                   on 19-APR-2002"
FT   CDS             join(3376704..3376740,3376848..3377293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58991"
FT                   /product="mCG58991"
FT                   /note="gene_id=mCG58991.1 transcript_id=mCT59174.2
FT                   protein_id=mCP40428.2"
FT                   /protein_id="EDL07416.1"
FT                   /translation="MQRHSHLVHLGCGGLHYTELYVGVAVLPNGLFSLTPVSPIVLMPL
FT                   TFPHLELPELLEPPPPRSSQPVTASSLSLPPKLSCSAVPQACHSDHADQPSEATDRDWG
FT                   QVSEHSGEKQYRGCGSFQSCLATWSHRPGPTYQPCLPSSGPIQGVCSLRGWACNTW"
FT   gene            complement(3380306..3449030)
FT                   /gene="Btbd4"
FT                   /locus_tag="mCG_23061"
FT                   /note="gene_id=mCG23061.1"
FT   mRNA            complement(join(3380306..3381714,3385678..3385853,
FT                   3401901..3402185,3413633..3414602,3448858..3449030))
FT                   /gene="Btbd4"
FT                   /locus_tag="mCG_23061"
FT                   /product="BTB (POZ) domain containing 4"
FT                   /note="gene_id=mCG23061.1 transcript_id=mCT23049.1 created
FT                   on 22-APR-2002"
FT   CDS             complement(join(3381310..3381714,3385678..3385853,
FT                   3401901..3402185,3413633..3414569))
FT                   /codon_start=1
FT                   /gene="Btbd4"
FT                   /locus_tag="mCG_23061"
FT                   /product="BTB (POZ) domain containing 4"
FT                   /note="gene_id=mCG23061.1 transcript_id=mCT23049.1
FT                   protein_id=mCP20301.1"
FT                   /protein_id="EDL07417.1"
FT                   /translation="MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDACVVVEGKVFKAH
FT                   KNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIE
FT                   VMSAASFLQMTDIVQACHDFIKAALDISIKSDASDELSEFEIGTPASNSTEALISAVMA
FT                   GRSISPWLARRTSPANSSGDSAIASCHEGGSSYGKEDQEPKADGPDDVSSQSLWPGDVG
FT                   YGSLRIKEEQISPSHYGGSELPSSKDTAIQNSLSEQGSGDGWQPTGRRKNRKNKETVRH
FT                   ITQQVEEDSQAGSPVPSFLPTSGWPFSSRDSNVDLTVTEASSLDSRGERAELYAHIDEG
FT                   LLGGETSYLGPPLTPEKEEALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYL
FT                   PKGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRR
FT                   EHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIKHGSRRHGVCADCAGRGVGTPLDHGG
FT                   GGEGSPEALFAGEGPYLEDPDDPRGEAEEELVEDEDEDVAKWKDDVGLAHEDALLGDDK
FT                   DDEDSPQGPHSPSGEPDKDFAWIS"
FT   gene            3482861..3484563
FT                   /gene="BC050777"
FT                   /locus_tag="mCG_66501"
FT                   /note="gene_id=mCG66501.2"
FT   mRNA            3482861..3484563
FT                   /gene="BC050777"
FT                   /locus_tag="mCG_66501"
FT                   /product="cDNA sequence BC050777"
FT                   /note="gene_id=mCG66501.2 transcript_id=mCT66684.2 created
FT                   on 23-APR-2002"
FT   CDS             3482900..3484324
FT                   /codon_start=1
FT                   /gene="BC050777"
FT                   /locus_tag="mCG_66501"
FT                   /product="cDNA sequence BC050777"
FT                   /note="gene_id=mCG66501.2 transcript_id=mCT66684.2
FT                   protein_id=mCP40430.2"
FT                   /protein_id="EDL07418.1"
FT                   /translation="MCVICFVKALVHVFKIYLTANYSYNFRSWPVDFRWDDLHAPSTGN
FT                   SSQRALTCAAAAAGVWLLHDAALGGDTLTRPPRGARSQVQCLLQQIRELPSQLASYALA
FT                   HSLGRWLVYPGSMFLMTRALMPLLQQGQERLVDRYRGRRAKLVACDGNEIDTMFMDRRQ
FT                   HPGSHGRGLCLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGGSTGAPFPQHDAN
FT                   AMDVVVKYALHRLNFPPAHVVVYGWSIGGFTATWATMTYPELGALVLDATFDDLVPLAL
FT                   KVMPQSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSNHIPSMPSCQV
FT                   EGDVEGNRGNELLLRLLQHRYPSVMAREGRTVVTRWLRASNLAQETALYARYRVDDEWC
FT                   LATLRSYRERCQKELDDAEAWGPHGLSFPWFVGQGLSARRRRQLALFLARRHLKNLEAT
FT                   HCSPLEPEDFQLPWRL"
FT   gene            3486574..3506148
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /note="gene_id=mCG23059.2"
FT   mRNA            join(3486574..3486721,3489237..3489382,3491297..3491445,
FT                   3492268..3492327,3497556..3497657,3502435..3502483,
FT                   3504476..3505294)
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, transcript variant
FT                   mCT168112"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168112.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(3486575..3486721,3488695..3488845,3489237..3489382,
FT                   3491297..3491445,3492268..3492327,3497556..3497657,
FT                   3502435..3502483,3504476..3506148)
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, transcript variant
FT                   mCT168111"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168111.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(3486575..3486721,3489237..3489382,3491297..3491445,
FT                   3492268..3492327,3497556..3497657,3500964..3501005,
FT                   3502435..3502483,3504476..3505294)
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, transcript variant
FT                   mCT22968"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT22968.1 created
FT                   on 23-APR-2002"
FT   mRNA            join(3486575..3486721,3489237..3489382,3491297..3491445,
FT                   3497556..3497657,3500964..3501005,3502435..3502483,
FT                   3504476..3505294)
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, transcript variant
FT                   mCT168113"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168113.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(3486575..3486721,3489237..3489382,3491297..3491445,
FT                   3497556..3497657,3502435..3502483,3504476..3505294)
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, transcript variant
FT                   mCT168110"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168110.0 created
FT                   on 23-APR-2002"
FT   CDS             join(3486703..3486721,3489237..3489382,3491297..3491445,
FT                   3492268..3492327,3497556..3497657,3500964..3501005,
FT                   3502435..3502483,3504476..3504571)
FT                   /codon_start=1
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, isoform CRA_e"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT22968.1
FT                   protein_id=mCP20295.1 isoform=CRA_e"
FT                   /protein_id="EDL07423.1"
FT                   /translation="MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGE
FT                   EEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVST
FT                   AYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMSSYSI
FT                   RHSISMPVMRNSATFKSFEDRVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF"
FT   CDS             join(3486703..3486721,3489237..3489382,3491297..3491445,
FT                   3492268..3492327,3497556..3497657,3502435..3502483,
FT                   3504476..3504571)
FT                   /codon_start=1
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, isoform CRA_c"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168112.0
FT                   protein_id=mCP91041.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TAI4"
FT                   /db_xref="InterPro:IPR007327"
FT                   /db_xref="MGI:MGI:1913564"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TAI4"
FT                   /protein_id="EDL07421.1"
FT                   /translation="MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGE
FT                   EEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVST
FT                   AYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRNSAT
FT                   FKSFEDRVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF"
FT   CDS             join(3486703..3486721,3489237..3489382,3491297..3491445,
FT                   3497556..3497657,3500964..3501005,3502435..3502483,
FT                   3504476..3504571)
FT                   /codon_start=1
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, isoform CRA_d"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168113.0
FT                   protein_id=mCP91047.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8BKP1"
FT                   /db_xref="InterPro:IPR007327"
FT                   /db_xref="MGI:MGI:1913564"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKP1"
FT                   /protein_id="EDL07422.1"
FT                   /translation="MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGE
FT                   EEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVST
FT                   AYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMSSYSIRHSISMPVMRNSATFKSFED
FT                   RVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF"
FT   CDS             join(3486703..3486721,3489237..3489382,3491297..3491445,
FT                   3497556..3497657,3502435..3502483,3504476..3504571)
FT                   /codon_start=1
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168110.0
FT                   protein_id=mCP91045.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TUJ9"
FT                   /db_xref="InterPro:IPR007327"
FT                   /db_xref="MGI:MGI:1913564"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TUJ9"
FT                   /protein_id="EDL07419.1"
FT                   /translation="MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGE
FT                   EEELRAELAKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVST
FT                   AYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGGRE
FT                   NGSDNLPPSPGSGDQTLPDHAPF"
FT   CDS             join(3489281..3489382,3491297..3491445,3492268..3492327,
FT                   3497556..3497657,3502435..3502483,3504476..3504571)
FT                   /codon_start=1
FT                   /gene="Tpd52l2"
FT                   /locus_tag="mCG_23059"
FT                   /product="tumor protein D52-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG23059.2 transcript_id=mCT168111.0
FT                   protein_id=mCP91033.0 isoform=CRA_b"
FT                   /protein_id="EDL07420.1"
FT                   /translation="MTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAKVEEEIVTLRQV
FT                   LAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSTAYVKTSEKLGEWNEKVTQSDL
FT                   YKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGGREN
FT                   GSDNLPPSPGSGDQTLPDHAPF"
FT   gene            3509901..3543656
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /note="gene_id=mCG23060.2"
FT   mRNA            join(3509901..3510093,3535794..3535911,3536763..3536976,
FT                   3538093..3538264,3538696..3543656)
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   transcript variant mCT22969"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT22969.2 created
FT                   on 23-APR-2002"
FT   mRNA            join(3509937..3510093,3535794..3535911,3536763..3536976,
FT                   3538093..3538264,3538349..3538423,3538696..3543656)
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   transcript variant mCT168115"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT168115.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(3509963..3510093,3510631..3510683,3535794..3535911,
FT                   3536763..3536976,3538093..3538264,3538696..3543656)
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   transcript variant mCT168114"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT168114.0 created
FT                   on 23-APR-2002"
FT   CDS             join(3535805..3535911,3536763..3536976,3538093..3538264,
FT                   3538696..3538799)
FT                   /codon_start=1
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT168114.0
FT                   protein_id=mCP91035.0 isoform=CRA_a"
FT                   /protein_id="EDL07424.1"
FT                   /translation="MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPD
FT                   KNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSW
FT                   WAKALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDE
FT                   REATDTPIVIQPASATETTQLTADSHPSYHTDGFN"
FT   CDS             join(3535805..3535911,3536763..3536976,3538093..3538264,
FT                   3538696..3538799)
FT                   /codon_start=1
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT22969.2
FT                   protein_id=mCP20294.0 isoform=CRA_a"
FT                   /protein_id="EDL07426.1"
FT                   /translation="MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPD
FT                   KNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSW
FT                   WAKALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDE
FT                   REATDTPIVIQPASATETTQLTADSHPSYHTDGFN"
FT   CDS             join(3535805..3535911,3536763..3536976,3538093..3538264,
FT                   3538349..3538359)
FT                   /codon_start=1
FT                   /gene="Dnajc5"
FT                   /locus_tag="mCG_23060"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23060.2 transcript_id=mCT168115.0
FT                   protein_id=mCP91042.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8T0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:892995"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8T0"
FT                   /protein_id="EDL07425.1"
FT                   /translation="MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPD
FT                   KNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSW
FT                   WAKALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDE
FT                   RGGH"
FT   gene            complement(3558692..3571531)
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /note="gene_id=mCG140109.0"
FT   mRNA            complement(join(3558692..3558936,3559014..3559170,
FT                   3559242..3559349,3559455..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564303,3564393..3564583,
FT                   3571407..3571531))
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, transcript
FT                   variant mCT168098"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168098.0
FT                   created on 23-APR-2002"
FT   mRNA            complement(join(3558693..3558936,3559014..3559170,
FT                   3559257..3559349,3559455..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564303,3564393..3564583,
FT                   3568093..3568498))
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, transcript
FT                   variant mCT168099"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168099.0
FT                   created on 23-APR-2002"
FT   mRNA            complement(join(3558702..3558936,3559014..3559170,
FT                   3559242..3559349,3559455..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562607..3562681,
FT                   3562761..3562950,3563758..3563829,3563915..3564085,
FT                   3564197..3564303,3564393..3564583,3571407..>3571524))
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, transcript
FT                   variant mCT189943"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT189943.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3558857..3558936,3559014..3559170,
FT                   3559242..3559349,3559455..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564303,3564393..3564583,
FT                   3571407..3571519))
FT                   /codon_start=1
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168098.0
FT                   protein_id=mCP91040.0 isoform=CRA_b"
FT                   /protein_id="EDL07428.1"
FT                   /translation="MAAPPASMSAAPSPLQSAVAPDVPGRQAEQNETACEDRSNAGTLD
FT                   RLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLG
FT                   GGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDFD
FT                   LIISTLKKLKQGRSVQVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDM
FT                   KIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPR
FT                   GSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPQTLSVLKSTPQVRGMHTII
FT                   RDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCTVQTPQGQDYVGKCYAGKQITGVSI
FT                   LRAGETMEPALRAVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVST
FT                   GAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFR
FT                   IIPGIGNFGDRYFGTDAVPDGSDDDEAATVG"
FT   CDS             complement(join(3558857..3558936,3559014..3559170,
FT                   3559257..3559349,3559455..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564303,3564393..3564583,
FT                   3568093..3568160))
FT                   /codon_start=1
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168099.0
FT                   protein_id=mCP91049.0 isoform=CRA_c"
FT                   /protein_id="EDL07429.1"
FT                   /translation="MSSPPAYPGIRISGCWTLGAESSSNAGTLDRLLPPVGTGRSPRKR
FT                   TTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMII
FT                   EALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDFDLIISTLKKLKQGRSV
FT                   QVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRR
FT                   LRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHV
FT                   HSQLEERELSVRAALASAHQCHPLPQTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSK
FT                   RLMRLLIEHALSFLPFQDCTVQTPQGQDYVGKCYAGKQITGVSILRAGETMEPALRAVC
FT                   KDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMADHDVPEDK
FT                   IFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPD
FT                   GSDDDEAATVG"
FT   mRNA            complement(join(<3559368..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564303,3564393..3564583,
FT                   3570954..3571177))
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, transcript
FT                   variant mCT168097"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168097.0
FT                   created on 23-APR-2002"
FT   CDS             complement(join(3559368..3559577,3559679..3559741,
FT                   3559855..3559948,3560046..3560144,3562016..3562032,
FT                   3562620..3562681,3562761..3562950,3563758..3563829,
FT                   3563915..3564085,3564197..3564259))
FT                   /codon_start=1
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT168097.0
FT                   protein_id=mCP91031.0 isoform=CRA_a"
FT                   /protein_id="EDL07427.1"
FT                   /translation="MIIEALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFD
FT                   FDLIISTLKKLKQGRSVQVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELL
FT                   DMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVV
FT                   PRGSGNTVAIDLIVQHVHSQLEERELSVRAALASAHQCHPLPQTLSVLKSTPQVRGMHT
FT                   IIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCTVQTPQGQDYVGKCYAGKQITGV
FT                   SILRAGETMEPALRAVCKDVRIGTILIQTNQLTGEPEVSSQGGLGVHSNDQHGEGDQKI
FT                   DVGALL"
FT   CDS             complement(join(3562611..3562681,3562761..3562950,
FT                   3563758..3563829,3563915..3564085,3564197..3564303,
FT                   3564393..3564583,3571407..>3571522))
FT                   /codon_start=1
FT                   /gene="Uckl1"
FT                   /locus_tag="mCG_140109"
FT                   /product="uridine-cytidine kinase 1-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG140109.0 transcript_id=mCT189943.0
FT                   protein_id=mCP110934.0 isoform=CRA_d"
FT                   /protein_id="EDL07430.1"
FT                   /translation="AMAAPPASMSAAPSPLQSAVAPDVPGRQAEQNETACEDRSNAGTL
FT                   DRLLPPVGTGRSPRKRTTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGL
FT                   GGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTQQQQEQAACNNFNFDHPDAFDF
FT                   DLIISTLKKLKQGRSVQVPIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLD
FT                   MKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKFVKPAFDQYIQPTMRLADIVVP
FT                   RGSGNTVAIDLIVQHVHSQLEEVS"
FT   gene            3568026..>3574666
FT                   /locus_tag="mCG_140110"
FT                   /note="gene_id=mCG140110.0"
FT   mRNA            join(3568026..3568174,3569989..3570179,3574564..>3574666)
FT                   /locus_tag="mCG_140110"
FT                   /product="mCG140110"
FT                   /note="gene_id=mCG140110.0 transcript_id=mCT168100.0
FT                   created on 23-APR-2002"
FT   CDS             join(3569997..3570179,3574564..>3574666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140110"
FT                   /product="mCG140110"
FT                   /note="gene_id=mCG140110.0 transcript_id=mCT168100.0
FT                   protein_id=mCP91038.0"
FT                   /protein_id="EDL07431.1"
FT                   /translation="MKGLQQRLKRGRLITWTTKEKKGLKIPLLWLNLVKQPIPVLLWNS
FT                   CKRQEAVQSHQSHFYKASRSPGSCVWKTGQLRSGTNSRARKLAIKTEKFG"
FT   gene            complement(3571657..3582317)
FT                   /locus_tag="mCG_140111"
FT                   /note="gene_id=mCG140111.0"
FT   mRNA            complement(join(3571657..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577857,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579516,3579610..3579738,
FT                   3580027..3580169,3580417..3580542,3581971..3582317))
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, transcript variant mCT168101"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT168101.0
FT                   created on 23-APR-2002"
FT   mRNA            complement(join(3571657..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577863,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579738,3580027..3580169,
FT                   3580417..>3580477))
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, transcript variant mCT189975"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT189975.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(3571686..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577863,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579516,3579610..3579738,
FT                   3580027..3580169,3580417..3580542,3581978..>3582018))
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, transcript variant mCT189974"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT189974.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3574373..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577863,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579516,3579610..3579738,
FT                   3580027..3580169,3580417..3580542,3581978..>3582017))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, isoform CRA_b"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT189974.0
FT                   protein_id=mCP110935.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZPW1"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2685478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZPW1"
FT                   /protein_id="EDL07433.1"
FT                   /translation="GASGPGCSPRPASEMTESFCVGGGRRLQGSSKSGPGKGGSRKEAQ
FT                   LPLLQDPPKLGMPVVHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAENQALRDIPL
FT                   SLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAFPCPFCEAA
FT                   FTSKTQLEKHRIWNHMDHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVS
FT                   KPIGISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLVTV
FT                   SKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNK
FT                   KRAADSLDTCPILSKQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPV
FT                   SQPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARVHRSKKQEGSGSE
FT                   EVRKKVLATPVTVSKEAPTPVAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGL
FT                   KKHMEVCHKLQEALKCQHCRKQFKSKAGLNYHTMAEHSAKPTDAEASEGGEQEERERLR
FT                   KVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAG
FT                   HDYHVRSEHTAPPPEDPTDKIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELA
FT                   RDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYA
FT                   SVSGLKAHLASCSKGDHLVGKYRCLLCPKEFSSESGVKYHILKTHGENWFRTSADPSSK
FT                   HKSQDSLMPRKEKKKSLSGGKKRGRKPKERSSEEPASKLPPNRDDWPPGGRDRGSRSST
FT                   GKKAGAGKAPEK"
FT   CDS             complement(join(3574373..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577857,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579516,3579610..3579738,
FT                   3580027..3580169,3580417..3580540))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, isoform CRA_a"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT168101.0
FT                   protein_id=mCP91044.0 isoform=CRA_a"
FT                   /protein_id="EDL07432.1"
FT                   /translation="MTESFCVGGGRRLQGSSKSGPGKGGSRKEAQLPLLQDPPKLGMPV
FT                   VHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHS
FT                   RVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWN
FT                   HMDHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRP
FT                   IPVTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLVTVSKPVPLTKPVPVSR
FT                   PIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKRAADSLDTCPILS
FT                   KQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHRR
FT                   KQKTPKKFTGEQPSISGTFGLKGLAKAEDKARVHRSKKQEGSGSEEVRKKVLATPVTVS
FT                   KEAPTPVAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHKEALKC
FT                   QHCRKQFKSKAGLNYHTMAEHSAKPTDAEASEGGEQEERERLRKVLKQMGRLRCPQEGC
FT                   GAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPED
FT                   PTDKIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPET
FT                   ARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYASVSGLKAHLASCSKGD
FT                   HLVGKYRCLLCPKEFSSESGVKYHILKTHGENWFRTSADPSSKHKSQDSLMPRKEKKKS
FT                   LSGGKKRGRKPKERSSEEPASKLPPNRDDWPPGGRDRGSRSSTGKKAGAGKAPEK"
FT   CDS             complement(join(3574373..3574624,3575224..3575322,
FT                   3575850..3575912,3576270..3576371,3576598..3576792,
FT                   3577286..3577456,3577538..3577636,3577771..3577863,
FT                   3577953..3578077,3578212..3578358,3578463..3578534,
FT                   3578636..3578844,3578930..3579738,3580027..3580169,
FT                   3580417..>3580477))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140111"
FT                   /product="mCG140111, isoform CRA_c"
FT                   /note="gene_id=mCG140111.0 transcript_id=mCT189975.0
FT                   protein_id=mCP110936.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6PHP4"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2685478"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PHP4"
FT                   /protein_id="EDL07434.1"
FT                   /translation="GKGGSRKEAQLPLLQDPPKLGMPVVHSGHTVPSQAPLCFDPGNSA
FT                   SDKTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKY
FT                   HYQRCQGVRGCGPGKRRPGGASGQRPPGPHPTPALPAQGAISDRLAFPCPFCEAAFTSK
FT                   TQLEKHRIWNHMDHPLPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIG
FT                   ISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLVTVSKPV
FT                   PLTKPVPVSRPIVVSKPVPVSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKRAA
FT                   DSLDTCPILSKQARPENGAYGPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPE
FT                   EDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARVHRSKKQEGSGSEEVRK
FT                   KVLATPVTVSKEAPTPVAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHM
FT                   EVCHKLQEALKCQHCRKQFKSKAGLNYHTMAEHSAKPTDAEASEGGEQEERERLRKVLK
FT                   QMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYH
FT                   VRSEHTAPPPEDPTDKIPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWT
FT                   KRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYASVSG
FT                   LKAHLASCSKGDHLVGKYRCLLCPKEFSSESGVKYHILKTHGENWFRTSADPSSKHKSQ
FT                   DSLMPRKEKKKSLSGGKKRGRKPKERSSEEPASKLPPNRDDWPPGGRDRGSRSSTGKKA
FT                   GAGKAPEK"
FT   gene            complement(3584766..3589044)
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /note="gene_id=mCG21540.1"
FT   mRNA            complement(join(3584766..3586154,3586296..3586436,
FT                   3586721..3586892,3586977..3587158,3588481..3589044))
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10,
FT                   transcript variant mCT23027"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT23027.2 created
FT                   on 23-APR-2002"
FT   mRNA            complement(join(3584766..3586154,3586296..3586436,
FT                   3588481..>3588631))
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10,
FT                   transcript variant mCT189946"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT189946.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3584770..3586154,3586296..3586436,
FT                   3586721..3586892,3586977..3587142,3588481..>3588667))
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10,
FT                   transcript variant mCT189947"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT189947.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(3585241..>3585741)
FT                   /codon_start=1
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT189946.0
FT                   protein_id=mCP110940.0 isoform=CRA_a"
FT                   /protein_id="EDL07435.1"
FT                   /translation="VFPLNLSSVSFPGTPRSATQWAKLSWLSFKYICPLALLEYSRPNL
FT                   LSILMVINHHAMCLLGDYETSVYSTHLLEVRLRGVQDAQAANPVSGTDSSAVQVTLCTA
FT                   HQFSNVLNLTFEEVMLLNSFPIPWLLVETILKNVCLCLSVCLCSCAPLWLSQENLFSTK
FT                   KIM"
FT   CDS             complement(join(3586132..3586154,3586296..3586436,
FT                   3586721..3586892,3586977..3587158,3588481..3588940))
FT                   /codon_start=1
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT23027.2
FT                   protein_id=mCP20307.2 isoform=CRA_c"
FT                   /protein_id="EDL07437.1"
FT                   /translation="MIIPTTTRPRGPRLPTAKALQRVAREAGPRSPTQVRKDAFRSGGH
FT                   PKHTQPRAPPIHLRAPGARLAPRAGRQVLCRADSPAAGTGLGLAGCGGWERGVRCPPAT
FT                   LAAWCSARGVCPSRTSAGSMFTELRSKLSPPRARAGAVRPGFGERPDVDASAHFSFCQT
FT                   LLEHTVSAENIPCHLPRTPGTSLTWHDSRSQRASSSRPIKLLQQPGSEIPQARLYSDHY
FT                   GLYHTSPSLGGLTRPVVLWSQQDVCKWLKKHCPHNYLVYVEAFSQHAITGRALLRLNAD
FT                   KLQRMGLTQEAQRQEVLQQVLHLQVREEGRSLQLLSQASFGNMS"
FT   CDS             complement(join(3586132..3586154,3586296..3586436,
FT                   3586721..3586892,3586977..3587142,3588481..>3588665))
FT                   /codon_start=1
FT                   /gene="Samd10"
FT                   /locus_tag="mCG_21540"
FT                   /product="sterile alpha motif domain containing 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21540.1 transcript_id=mCT189947.0
FT                   protein_id=mCP110941.0 isoform=CRA_b"
FT                   /protein_id="EDL07436.1"
FT                   /translation="RVGTRCALPTGHTGCLVLREGRVPEPHIRGLHVHRAAVQAEPPAS
FT                   SRRGCASGLRGASGCGRFCQTLLEHTVSAENIPCHLPRTPGTSLTWHDSRSQRASSSRP
FT                   IKLLQQPGSEIPQARLYSDHYGLYHTSPSLGGLTRPVVLWSQQDVCKWLKKHCPHNYLV
FT                   YVEAFSQHAITGRALLRLNADKLQRMGLTQEAQRQEVLQQVLHLQVREEGRSLQLLSQA
FT                   SFGNMS"
FT   gene            3590917..3645763
FT                   /gene="Prpf6"
FT                   /locus_tag="mCG_21541"
FT                   /note="gene_id=mCG21541.1"
FT   mRNA            join(3590917..3591082,3597717..3597885,3605565..3605683,
FT                   3610175..3610253,3611420..3611596,3611795..3611950,
FT                   3621038..3621132,3621534..3621690,3622358..3622520,
FT                   3626653..3626771,3627513..3627731,3630705..3630827,
FT                   3635586..3635707,3637405..3637543,3639143..3639262,
FT                   3639539..3639715,3640214..3640347,3641203..3641294,
FT                   3642537..3642651,3644939..3645065,3645525..3645763)
FT                   /gene="Prpf6"
FT                   /locus_tag="mCG_21541"
FT                   /product="PRP6 pre-mRNA splicing factor 6 homolog (yeast)"
FT                   /note="gene_id=mCG21541.1 transcript_id=mCT23030.1 created
FT                   on 23-APR-2002"
FT   CDS             join(3591012..3591082,3597717..3597885,3605565..3605683,
FT                   3610175..3610253,3611420..3611596,3611795..3611950,
FT                   3621038..3621132,3621534..3621690,3622358..3622520,
FT                   3626653..3626771,3627513..3627731,3630705..3630827,
FT                   3635586..3635707,3637405..3637543,3639143..3639262,
FT                   3639539..3639715,3640214..3640347,3641203..3641294,
FT                   3642537..3642651,3644939..3645065,3645525..3645677)
FT                   /codon_start=1
FT                   /gene="Prpf6"
FT                   /locus_tag="mCG_21541"
FT                   /product="PRP6 pre-mRNA splicing factor 6 homolog (yeast)"
FT                   /note="gene_id=mCG21541.1 transcript_id=mCT23030.1
FT                   protein_id=mCP20311.2"
FT                   /db_xref="GOA:Q91YR7"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1922946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YR7"
FT                   /protein_id="EDL07438.1"
FT                   /translation="MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVD
FT                   DRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAI
FT                   YAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEV
FT                   GDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPY
FT                   PGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMI
FT                   PTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCP
FT                   KSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEH
FT                   VPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARE
FT                   NIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAG
FT                   SVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSV
FT                   WLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAF
FT                   QANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAA
FT                   QELCEEALRHYEDFPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLE
FT                   EKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGI
FT                   LWSEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFWSERKITKAREWFHRTVKID
FT                   SDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEIL
FT                   VLVAARIKNTF"
FT   gene            complement(3660187..3661953)
FT                   /gene="Sox18"
FT                   /locus_tag="mCG_21538"
FT                   /note="gene_id=mCG21538.0"
FT   mRNA            complement(join(3660187..3661340,3661526..3661953))
FT                   /gene="Sox18"
FT                   /locus_tag="mCG_21538"
FT                   /product="SRY-box containing gene 18"
FT                   /note="gene_id=mCG21538.0 transcript_id=mCT23028.0 created
FT                   on 23-APR-2002"
FT   CDS             complement(join(3660547..3661340,3661526..3661865))
FT                   /codon_start=1
FT                   /gene="Sox18"
FT                   /locus_tag="mCG_21538"
FT                   /product="SRY-box containing gene 18"
FT                   /note="gene_id=mCG21538.0 transcript_id=mCT23028.0
FT                   protein_id=mCP20289.1"
FT                   /protein_id="EDL07439.1"
FT                   /translation="MQRSPPGYGAQDDPPSRRDCAWAPGIGAAAEARGLPVTNVSPTSP
FT                   ASPSSLPRSPPRSPESGRYGFGRGERQTADELRIRRPMNAFMVWAKDERKRLAQQNPDL
FT                   HNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKVRRLE
FT                   PGLLLPGLVQPSAPPEAFAAASGSARSFRELPTLGAEFDGLGLPTPERSPLDGLEPGEA
FT                   SFFPPPLAPEDCALRAFRAPYAPELARDPSFCYGAPLAEALRTAPPAAPLAGLYYGTLG
FT                   TPGPFPNPLSPPPESPSLEGTEQLEPTADLWADVDLTEFDQYLNCSRTRPDATTLPYHV
FT                   ALAKLGPRAMSCPEESSLISALSDASSAVYYSACISG"
FT   gene            3670654..3678385
FT                   /gene="Tcea2"
FT                   /locus_tag="mCG_21537"
FT                   /note="gene_id=mCG21537.1"
FT   mRNA            join(3670654..3670819,3673557..3673619,3673892..3673997,
FT                   3674786..3674876,3676130..3676260,3676528..3676582,
FT                   3676936..3677089,3677165..3677311,3677948..3678019,
FT                   3678211..3678385)
FT                   /gene="Tcea2"
FT                   /locus_tag="mCG_21537"
FT                   /product="transcription elongation factor A (SII), 2"
FT                   /note="gene_id=mCG21537.1 transcript_id=mCT23026.2 created
FT                   on 23-APR-2002"
FT   CDS             join(3670751..3670819,3673557..3673619,3673892..3673997,
FT                   3674786..3674876,3676130..3676260,3676528..3676582,
FT                   3676936..3677089,3677165..3677311,3677948..3678019,
FT                   3678211..3678219)
FT                   /codon_start=1
FT                   /gene="Tcea2"
FT                   /locus_tag="mCG_21537"
FT                   /product="transcription elongation factor A (SII), 2"
FT                   /note="gene_id=mCG21537.1 transcript_id=mCT23026.2
FT                   protein_id=mCP20284.1"
FT                   /protein_id="EDL07440.1"
FT                   /translation="MGKEEEIARIARRLDKMVTRKNAEGAMDLLRELKNMPITLHLLQS
FT                   TRVGMSVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRNQGRGTPLPTSSSKDAS
FT                   RTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLALQTDHDHVAVGVNC
FT                   EHLSSQIEDIFLDVGNTDMKYKNRVRSRISNLKDAKNPGLRRNVLCGAITPQQIAVMTS
FT                   EEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCNKCRKKNCTYTQVQTRSSDEP
FT                   MTTYVVCNECGNRWKFC"
FT   gene            complement(3678755..3684228)
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /note="gene_id=mCG21536.1"
FT   mRNA            complement(join(3678755..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3681767..3681872,
FT                   3684156..3684228))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT23025"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT23025.2 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3678761..3679929,3680020..3680094,
FT                   3681510..3681631,3681767..3681872,3684156..3684228))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT168102"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT168102.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3678772..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3684156..3684210))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT185563"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185563.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3678801..3679610,3679695..3679929,
FT                   3680020..3680094,3684156..3684224))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT185562"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185562.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3678803..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3681767..3681872,
FT                   3683640..3683888))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT185561"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185561.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3679381..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3683640..>3684087))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT189957"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT189957.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3679422..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3683640..>3683732))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT189957.0
FT                   protein_id=mCP110939.0 isoform=CRA_c"
FT                   /protein_id="EDL07443.1"
FT                   /translation="IPTALEHAPSAARVGPSPNLALPPPSAFRSLHTGPEEADRPPSMS
FT                   SHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEE
FT                   VQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLI
FT                   YEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPT
FT                   YRSLLLQGAPQSSEA"
FT   CDS             complement(join(3679422..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3681767..3681796))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT23025.2
FT                   protein_id=mCP20279.2 isoform=CRA_d"
FT                   /protein_id="EDL07444.1"
FT                   /translation="MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCC
FT                   CCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVF
FT                   RAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVRE
FT                   GINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA"
FT   CDS             complement(join(3679422..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681631,3681767..3681796))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185561.0
FT                   protein_id=mCP106821.0 isoform=CRA_d"
FT                   /protein_id="EDL07447.1"
FT                   /translation="MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCC
FT                   CCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVF
FT                   RAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVRE
FT                   GINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA"
FT   CDS             complement(join(3679422..3679610,3679695..3679929,
FT                   3680020..3680094,3681510..3681595))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185563.0
FT                   protein_id=mCP106820.0 isoform=CRA_f"
FT                   /protein_id="EDL07446.1"
FT                   /translation="MSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKL
FT                   QPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEEL
FT                   KAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIY
FT                   TLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA"
FT   CDS             complement(join(3679422..3679610,3679695..3679874))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT185562.0
FT                   protein_id=mCP106819.0 isoform=CRA_b"
FT                   /protein_id="EDL07442.1"
FT                   /translation="MHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKA
FT                   RLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLT
FT                   SPTYRSLLLQGAPQSSEA"
FT   mRNA            complement(join(3679654..3680094,3681510..3681631,
FT                   3683640..3683908))
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, transcript
FT                   variant mCT168103"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT168103.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(3679674..3679929,3680020..3680094,
FT                   3681510..3681631,3681767..3681796))
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT168102.0
FT                   protein_id=mCP91046.0 isoform=CRA_a"
FT                   /protein_id="EDL07441.1"
FT                   /translation="MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCC
FT                   CCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLMHSPTGRSVF
FT                   RAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVGQMQG"
FT   CDS             complement(3679674..3679985)
FT                   /codon_start=1
FT                   /gene="Rgs19"
FT                   /locus_tag="mCG_21536"
FT                   /product="regulator of G-protein signaling 19, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG21536.1 transcript_id=mCT168103.0
FT                   protein_id=mCP91051.0 isoform=CRA_e"
FT                   /protein_id="EDL07445.1"
FT                   /translation="MCTCVHVSGLIWSGPNACSTPPSPEEVQSWAQSFDKLMHSPTGRS
FT                   VFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVGQMQG"
FT   gene            complement(3687072..3688720)
FT                   /gene="4930526D03Rik"
FT                   /locus_tag="mCG_1030246"
FT                   /note="gene_id=mCG1030246.2"
FT   mRNA            complement(join(3687072..3687206,3687282..3687404,
FT                   3687519..3687940,3688684..3688720))
FT                   /gene="4930526D03Rik"
FT                   /locus_tag="mCG_1030246"
FT                   /product="RIKEN cDNA 4930526D03, transcript variant
FT                   mCT147950"
FT                   /note="gene_id=mCG1030246.2 transcript_id=mCT147950.2
FT                   created on 10-JUN-2003"
FT   mRNA            complement(join(3687072..3687206,3687282..3687404,
FT                   3687519..3687940,3688053..3688093))
FT                   /gene="4930526D03Rik"
FT                   /locus_tag="mCG_1030246"
FT                   /product="RIKEN cDNA 4930526D03, transcript variant
FT                   mCT185539"
FT                   /note="gene_id=mCG1030246.2 transcript_id=mCT185539.0
FT                   created on 10-JUN-2003"
FT   CDS             complement(join(3687147..3687206,3687282..3687404,
FT                   3687519..3687940,3688053..3688077))
FT                   /codon_start=1
FT                   /gene="4930526D03Rik"
FT                   /locus_tag="mCG_1030246"
FT                   /product="RIKEN cDNA 4930526D03, isoform CRA_b"
FT                   /note="gene_id=mCG1030246.2 transcript_id=mCT185539.0
FT                   protein_id=mCP106797.0 isoform=CRA_b"
FT                   /protein_id="EDL07449.1"
FT                   /translation="MAYCRYAQDRSMPTLGVKGARERDKNSASGAGAGAGAGAGAGEKH
FT                   RKGPRTTDPPKTGWALTKQRLVALSPTLRQRHLLFGDFLDDIGKVASMFPRESVELPYD
FT                   MPDPRTWSQALNLPSEHQNRFLGLIKAAEARGRVHTLRLRYTRMRAEEISLLIQKQSSA
FT                   RAAIRLELFLPPQLKPTKIPDPLDRHERRRVETILEEEVDGNIFPR"
FT   CDS             complement(join(3687147..3687206,3687282..3687404,
FT                   3687519..3687932))
FT                   /codon_start=1
FT                   /gene="4930526D03Rik"
FT                   /locus_tag="mCG_1030246"
FT                   /product="RIKEN cDNA 4930526D03, isoform CRA_a"
FT                   /note="gene_id=mCG1030246.2 transcript_id=mCT147950.2
FT                   protein_id=mCP66790.1 isoform=CRA_a"
FT                   /protein_id="EDL07448.1"
FT                   /translation="MPTLGVKGARERDKNSASGAGAGAGAGAGAGEKHRKGPRTTDPPK
FT                   TGWALTKQRLVALSPTLRQRHLLFGDFLDDIGKVASMFPRESVELPYDMPDPRTWSQAL
FT                   NLPSEHQNRFLGLIKAAEARGRVHTLRLRYTRMRAEEISLLIQKQSSARAAIRLELFLP
FT                   PQLKPTKIPDPLDRHERRRVETILEEEVDGNIFPR"
FT   gene            <3705509..3711535
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /note="gene_id=mCG21542.1"
FT   mRNA            join(3705509..3705773,3706234..3706490,3708546..3708643,
FT                   3708927..3709282,3709364..3709918,3710037..3711535)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168105"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168105.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705509..3705773,3706234..3706490,3708927..3709282,
FT                   3709364..3711522)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT23031"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT23031.1 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705509..3705773,3706234..3706490,3707046..3707079,
FT                   3708505..3708643,3708927..3709282,3709364..3709918,
FT                   3710037..3711195)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168107"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168107.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705509..3705773,3706234..3706490,3707046..3707079,
FT                   3708927..3709282,3709364..3709918,3710037..3711195)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168108"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168108.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705509..3705773,3706234..3706490,3708505..3708643,
FT                   3708927..3709282,3709364..3711195)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168104"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168104.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(<3705509..3705773,3706234..3706490,3708927..3709282,
FT                   3709364..3709918,3710037..3711195)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT189952"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189952.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(3705509..3705773,3706234..3706490,3709364..3709953)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168106"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168106.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705509..3705773,3706234..3706490,3708927..3709923)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT168109"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168109.0 created
FT                   on 06-JUN-2003"
FT   mRNA            join(3705610..3705773,3706234..3706490,3707046..3707079,
FT                   3708927..3709282,3709364..3711524)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT189954"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189954.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(3705626..3705773,3706234..3706475,3707046..3707079,
FT                   3708927..3709282,3709364..3711522)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT189953"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189953.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<3705890..3706033,3706234..3706490,3708927..3709282,
FT                   3709364..3711524)
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, transcript variant
FT                   mCT189955"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189955.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3706246..3706490,3708927..3709282,3709364..3709887)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_g"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189952.0
FT                   protein_id=mCP110942.0 isoform=CRA_g"
FT                   /protein_id="EDL07456.1"
FT                   /translation="VALQGDSMESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNAS
FT                   HSAFLPLGLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLV
FT                   LLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRAL
FT                   DVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAIC
FT                   IFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWT
FT                   PVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCA
FT                   SALHREMQVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   CDS             join(<3706246..3706490,3708927..3709282,3709364..3709887)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_g"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189955.0
FT                   protein_id=mCP110945.0 isoform=CRA_g"
FT                   /protein_id="EDL07459.1"
FT                   /translation="VALQGDSMESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNAS
FT                   HSAFLPLGLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLV
FT                   LLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRAL
FT                   DVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAIC
FT                   IFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWT
FT                   PVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCA
FT                   SALHREMQVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   CDS             join(3706267..3706490,3708927..3709282,3709364..3709887)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_j"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT23031.1
FT                   protein_id=mCP20277.1 isoform=CRA_j"
FT                   /db_xref="GOA:Q542U1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/TrEMBL:Q542U1"
FT                   /protein_id="EDL07460.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   CDS             join(3706267..3706490,3709364..3709655)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168106.0
FT                   protein_id=mCP91043.0 isoform=CRA_c"
FT                   /protein_id="EDL07452.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRDRVPGGDPRPSGLLGPCICHLHLPFFLHH
FT                   PGSDHLCLLQPHDSTTSWCPAAFRLPREGPEPATHHTAGTGSCGCVCGLLDTCAGLCPG
FT                   SRTGCSAR"
FT   CDS             join(3706267..3706490,3708927..3709344)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_f"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168109.0
FT                   protein_id=mCP91039.0 isoform=CRA_f"
FT                   /protein_id="EDL07455.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEGQWAVLLPDQSVPHGSCRPL"
FT   CDS             join(3706267..3706490,3707046..3707079,3708927..3708968)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_e"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168108.0
FT                   protein_id=mCP91032.0 isoform=CRA_e"
FT                   /protein_id="EDL07454.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILSWEGIEGNWRQQAHQDEDCYQHLHI"
FT   CDS             join(3706267..3706490,3707046..3707079,3708505..3708643,
FT                   3708927..3708940)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168107.0
FT                   protein_id=mCP91048.0 isoform=CRA_d"
FT                   /protein_id="EDL07453.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILSWEGIEGNWRQQTTLCTWKIFDELYRQCPE
FT                   NPLRGVLRETEERRQHLSLLIPSTNSHSGTPR"
FT   CDS             join(3706267..3706490,3708546..3708643,3708927..3708940)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168105.0
FT                   protein_id=mCP91034.0 isoform=CRA_b"
FT                   /protein_id="EDL07451.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRQCPENPLRGVLRETEERRQHLSLLIPSTN
FT                   SHSGTPR"
FT   CDS             join(3706267..3706490,3708505..3708568)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT168104.0
FT                   protein_id=mCP91050.0 isoform=CRA_a"
FT                   /protein_id="EDL07450.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRQHCALGRSLMNFTGSALKTL"
FT   CDS             join(3706343..3706490,3707046..3707079,3708927..3709282,
FT                   3709364..3709887)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_i"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189954.0
FT                   protein_id=mCP110944.0 isoform=CRA_i"
FT                   /db_xref="GOA:B0R0C0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/TrEMBL:B0R0C0"
FT                   /protein_id="EDL07458.1"
FT                   /translation="MRPYPITCSSMLATVPSCPLDSRSPSWGSTWLCASGGSWGTASSC
FT                   MSSSAGRALRGTGDSRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNA
FT                   LCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
FT                   VGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMI
FT                   RRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAV
FT                   AILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVG
FT                   LGCKTSETVPRPA"
FT   CDS             join(3706343..3706475,3707046..3707079,3708927..3709282,
FT                   3709364..3709887)
FT                   /codon_start=1
FT                   /gene="Oprl1"
FT                   /locus_tag="mCG_21542"
FT                   /product="opioid receptor-like 1, isoform CRA_h"
FT                   /note="gene_id=mCG21542.1 transcript_id=mCT189953.0
FT                   protein_id=mCP110943.0 isoform=CRA_h"
FT                   /protein_id="EDL07457.1"
FT                   /translation="MRPYPITCSSMLATVPSCPLDSRSPSWGSTWLCASGGSWGTASSS
FT                   GRALRGTGDSRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTV
FT                   IAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPV
FT                   AIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRG
FT                   VRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRF
FT                   CTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVGLGCKT
FT                   SETVPRPA"
FT   gene            complement(3714584..3715485)
FT                   /pseudo
FT                   /locus_tag="mCG_64042"
FT                   /note="gene_id=mCG64042.2"
FT   mRNA            complement(3714584..3715485)
FT                   /pseudo
FT                   /locus_tag="mCG_64042"
FT                   /note="gene_id=mCG64042.2 transcript_id=mCT64225.2 created
FT                   on 23-APR-2002"
FT   gene            <3779369..3811546
FT                   /gene="Myt1"
FT                   /locus_tag="mCG_122004"
FT                   /note="gene_id=mCG122004.2"
FT   mRNA            join(<3779369..3779620,3780810..3781709,3784778..3784912,
FT                   3785578..3785668,3786679..3786792,3788690..3788904,
FT                   3790280..3790404,3791155..3791424,3794009..3794163,
FT                   3794929..3794991,3795119..3795187,3798812..3798874,
FT                   3799293..3799376,3803778..3803999,3805703..3805794,
FT                   3806421..3806524,3809174..3809317,3809680..3811543)
FT                   /gene="Myt1"
FT                   /locus_tag="mCG_122004"
FT                   /product="myelin transcription factor 1, transcript variant
FT                   mCT189973"
FT                   /note="gene_id=mCG122004.2 transcript_id=mCT189973.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3779371..3779620,3780810..3781709,3784778..3784912,
FT                   3785578..3785668,3786679..3786792,3788690..3788904,
FT                   3790280..3790404,3791155..3791424,3794009..3794163,
FT                   3794929..3794991,3795119..3795187,3798812..3798874,
FT                   3799293..3799376,3803778..3803999,3805703..3805794,
FT                   3806421..3806524,3809174..3809317,3809680..3809820)
FT                   /codon_start=1
FT                   /gene="Myt1"
FT                   /locus_tag="mCG_122004"
FT                   /product="myelin transcription factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG122004.2 transcript_id=mCT189973.0
FT                   protein_id=mCP110930.0 isoform=CRA_b"
FT                   /protein_id="EDL07462.1"
FT                   /translation="SLQSCPLAKKRKLEDAETEHLVSKRKSHPLRLALDEGYRMDSDGS
FT                   EDAEVKDVSVSDESEGPLEEAEAEMSGQEEIHHPQTAEGKSLIKPHFDSNPTSSPSGFS
FT                   KSSYSSYQGIIATSLLNLGQIAEEALVKEDSVSVAKLSPTVVHQLQDEAAMGVNSDEGE
FT                   KDLFIQPEDVEEVIEVTSERSQEPCPQSLKDMVSEESSKQKGVLGHEEEGEEEEEDEEE
FT                   EDEEEEEEGEEGEEEEEEEEEEEEEEDEEEEEEEEEAAPNVIFGEDTSHTSVQKASPEF
FT                   RGPELSSPKPEYSVIVEVRSDDDKDEDSRSQKSAVTDESEMYDMMTRGNLGLLEQAIAL
FT                   KAEQVRAVCESGCPPAEQGHLGPGEPGKMAKPLDVVRKSCYSKDPSRVEKREIKCPTPG
FT                   CDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHR
FT                   SLSGCPIAAAEKLAKSHEKQQLQTGDPPKNNSNSDRILRPMCFVKQLEVPPYGSYRPNV
FT                   APATPRANLAKELEKFSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSHDA
FT                   EAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKAVDIEVDENGTLDLSMHKHRKRENT
FT                   FPSSSSCSSSPGVKSPDVSQRQSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLR
FT                   EEEPEESEPAAHSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTC
FT                   PTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNY
FT                   ASHRSLSGCPRAKKSGLKVAPTKDDKEDPELMKCPVPGCVGLGHISGKYASHRSASGCP
FT                   LAARRQKEGALNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAG
FT                   KKGKLSGDEILSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSME
FT                   KNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVNTLT
FT                   DMYSNQDCYQNPENKGLLETIKQAVRGIQV"
FT   mRNA            join(3780031..3781709,3784778..3784912,3785578..3785668,
FT                   3786679..3786792,3788690..3788904,3790280..3790404,
FT                   3791155..3791424,3794009..3794163,3794929..3794991,
FT                   3795119..3795187,3798812..3798874,3799293..3799376,
FT                   3803778..3803999,3805703..3805794,3806421..3806524,
FT                   3809174..3809317,3809680..3811546)
FT                   /gene="Myt1"
FT                   /locus_tag="mCG_122004"
FT                   /product="myelin transcription factor 1, transcript variant
FT                   mCT123218"
FT                   /note="gene_id=mCG122004.2 transcript_id=mCT123218.1
FT                   created on 23-APR-2002"
FT   CDS             join(3780770..3781709,3784778..3784912,3785578..3785668,
FT                   3786679..3786792,3788690..3788904,3790280..3790404,
FT                   3791155..3791424,3794009..3794163,3794929..3794991,
FT                   3795119..3795187,3798812..3798874,3799293..3799376,
FT                   3803778..3803999,3805703..3805794,3806421..3806524,
FT                   3809174..3809317,3809680..3809820)
FT                   /codon_start=1
FT                   /gene="Myt1"
FT                   /locus_tag="mCG_122004"
FT                   /product="myelin transcription factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG122004.2 transcript_id=mCT123218.1
FT                   protein_id=mCP66845.1 isoform=CRA_a"
FT                   /protein_id="EDL07461.1"
FT                   /translation="MLSSRPRCFLFYAGKSLIKPHFDSNPTSSPSGFSKSSYSSYQGII
FT                   ATSLLNLGQIAEEALVKEDSVSVAKLSPTVVHQLQDEAAMGVNSDEGEKDLFIQPEDVE
FT                   EVIEVTSERSQEPCPQSLKDMVSEESSKQKGVLGHEEEGEEEEEDEEEEDEEEEEEGEE
FT                   GEEEEEEEEEEEEEEDEEEEEEEEEAAPNVIFGEDTSHTSVQKASPEFRGPELSSPKPE
FT                   YSVIVEVRSDDDKDEDSRSQKSAVTDESEMYDMMTRGNLGLLEQAIALKAEQVRAVCES
FT                   GCPPAEQGHLGPGEPGKMAKPLDVVRKSCYSKDPSRVEKREIKCPTPGCDGTGHVTGLY
FT                   PHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAE
FT                   KLAKSHEKQQLQTGDPPKNNSNSDRILRPMCFVKQLEVPPYGSYRPNVAPATPRANLAK
FT                   ELEKFSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSHDAEAAHMAATAIL
FT                   NLSTRCWEMPENLSTKPQDLPSKAVDIEVDENGTLDLSMHKHRKRENTFPSSSSCSSSP
FT                   GVKSPDVSQRQSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEPAA
FT                   HSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHI
FT                   TGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPR
FT                   AKKSGLKVAPTKDDKEDPELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGAL
FT                   NGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEIL
FT                   SPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENK
FT                   LIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVNTLTDMYSNQDCYQN
FT                   PENKGLLETIKQAVRGIQV"
FT   gene            3821672..3841235
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /note="gene_id=mCG140108.0"
FT   mRNA            join(3821672..3821757,3824931..3825114,3826151..3826481,
FT                   3828183..3828285,3830255..3830426,3835369..3835492,
FT                   3838723..3841235)
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, transcript variant
FT                   mCT168096"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT168096.0
FT                   created on 06-JUN-2003"
FT   mRNA            join(3821672..3821757,3824931..3825114,3826151..3826239,
FT                   3835469..3835492,3838723..3841235)
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, transcript variant
FT                   mCT168095"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT168095.0
FT                   created on 06-JUN-2003"
FT   CDS             join(3826175..3826481,3828183..3828285,3830255..3830426,
FT                   3835369..3835492,3838723..3839096)
FT                   /codon_start=1
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT168096.0
FT                   protein_id=mCP91036.0 isoform=CRA_b"
FT                   /protein_id="EDL07464.1"
FT                   /translation="MGGAVSAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEE
FT                   FKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGP
FT                   FGVNHGVELHSDVTEYAKQKLDVFIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRV
FT                   YCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLVQP
FT                   CRSESGQSRLVQLPPPAVRSLQDLARLAIRGSIKRAMRQEATRGGGLKNTPMFKRRRVR
FT                   RRRMETIVFLDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV
FT                   LRLPLPDPLKYYLLYYREK"
FT   CDS             join(3826175..3826239,3835469..3835492,3838723..3838843)
FT                   /codon_start=1
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT168095.0
FT                   protein_id=mCP91030.0 isoform=CRA_a"
FT                   /protein_id="EDL07463.1"
FT                   /translation="MGGAVSAGEDNDELIDNLKEAQTVQTCPATTTSRAQPTGPGPACY
FT                   PWQHQEGYATGSHKRRWPEEHTYV"
FT   mRNA            join(3834741..3834801,3835365..3835492,3838723..3839387)
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, transcript variant
FT                   mCT185166"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT185166.0
FT                   created on 06-JUN-2003"
FT   CDS             3838791..3839096
FT                   /codon_start=1
FT                   /gene="Pcmtd2"
FT                   /locus_tag="mCG_140108"
FT                   /product="protein-L-isoaspartate (D-aspartate)
FT                   O-methyltransferase domain containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG140108.0 transcript_id=mCT185166.0
FT                   protein_id=mCP106424.0 isoform=CRA_c"
FT                   /protein_id="EDL07465.1"
FT                   /translation="MRQEATRGGGLKNTPMFKRRRVRRRRMETIVFLDKEVFASRISNP
FT                   SDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRVLRLPLPDPLKYYLLYYREK"
FT   gene            3848191..3854605
FT                   /gene="Polr3k"
FT                   /locus_tag="mCG_122011"
FT                   /note="gene_id=mCG122011.1"
FT   mRNA            join(3848191..3848355,3849732..3849819,3851988..3854605)
FT                   /gene="Polr3k"
FT                   /locus_tag="mCG_122011"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   K"
FT                   /note="gene_id=mCG122011.1 transcript_id=mCT123225.1
FT                   created on 23-APR-2002"
FT   CDS             join(3848245..3848355,3849732..3849819,3851988..3852115)
FT                   /codon_start=1
FT                   /gene="Polr3k"
FT                   /locus_tag="mCG_122011"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   K"
FT                   /note="gene_id=mCG122011.1 transcript_id=mCT123225.1
FT                   protein_id=mCP66782.1"
FT                   /protein_id="EDL07466.1"
FT                   /translation="MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPK
FT                   LKEVDDVLGGAAAWENVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGH
FT                   RWRD"
FT   gene            complement(3859742..3861586)
FT                   /locus_tag="mCG_1030251"
FT                   /note="gene_id=mCG1030251.0"
FT   mRNA            complement(join(3859742..3860023,3861230..3861586))
FT                   /locus_tag="mCG_1030251"
FT                   /product="mCG1030251"
FT                   /note="gene_id=mCG1030251.0 transcript_id=mCT147955.0
FT                   created on 23-APR-2002"
FT   CDS             complement(join(3859961..3860023,3861230..3861322))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030251"
FT                   /product="mCG1030251"
FT                   /note="gene_id=mCG1030251.0 transcript_id=mCT147955.0
FT                   protein_id=mCP66836.1"
FT                   /protein_id="EDL07467.1"
FT                   /translation="MHVKLCSDSKNSDASTLQCKSPQMFYNIQYNLIYGVRRMCLDSML
FT                   LLHNFT"
FT   gene            3880493..3882891
FT                   /locus_tag="mCG_122018"
FT                   /note="gene_id=mCG122018.0"
FT   mRNA            join(3880493..3880624,3882450..3882891)
FT                   /locus_tag="mCG_122018"
FT                   /product="mCG122018"
FT                   /note="gene_id=mCG122018.0 transcript_id=mCT123232.1
FT                   created on 23-APR-2002"
FT   CDS             3882499..3882573
FT                   /codon_start=1
FT                   /locus_tag="mCG_122018"
FT                   /product="mCG122018"
FT                   /note="gene_id=mCG122018.0 transcript_id=mCT123232.1
FT                   protein_id=mCP66842.1"
FT                   /protein_id="EDL07468.1"
FT                   /translation="MPRKKLPRRWALLLLLPLRQEKKS"
FT   gene            complement(<3930006..3936678)
FT                   /locus_tag="mCG_122019"
FT                   /note="gene_id=mCG122019.1"
FT   mRNA            complement(join(<3930006..3931627,3932982..3933163,
FT                   3936593..3936678))
FT                   /locus_tag="mCG_122019"
FT                   /product="mCG122019"
FT                   /note="gene_id=mCG122019.1 transcript_id=mCT123233.1
FT                   created on 23-APR-2002"
FT   CDS             complement(join(3930006..3931627,3932982..3933163,
FT                   3936593..3936672))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122019"
FT                   /product="mCG122019"
FT                   /note="gene_id=mCG122019.1 transcript_id=mCT123233.1
FT                   protein_id=mCP66844.1"
FT                   /protein_id="EDL07469.1"
FT                   /translation="MGLWAVLLVLPLDAVDCAQASSEVATWNILTYDDVHVNFTLEEWA
FT                   SLNPSQKRLYKDKMLETYRNLNVVGKTVNFPSLLKIRKQLFLSFVCHSYPPRHERIHNG
FT                   ENLYEGIQYGEAFLHHSSLQMHKVIHIGEKQYKYNQCDKAYSRQSIVQIHKRTHTREKL
FT                   YECNHCGKAFAYHSTLRVHKKIHTGEKLHECKQCNKSFASQLHLQSHQRSHTGETPLKC
FT                   NQCNKAFARRRYLKRHVITHTGEKPYKCDQCGKALGHYSSLQEHKRAHTGEKPYKCNQC
FT                   GKAFAYHSSLQVHKKTHTGEKLHECKQCGKSFACQGYLQSHQRAHTGEKPFKYNQCDKA
FT                   FAQRRDLKRHLITHTGEKPYKCDQYDKAFRGLSHLKMHKILHTGEKPYKCDQCGKTFAY
FT                   HSTLQVHKRIHTGEKLHECKQCGKSFARQGHLQSHQRTHTGEKPFKCNQCDKAFAQQHN
FT                   LKRHLITHTREKPYKCGQCGKAFACHITLQVHKTVHTGEKFYKCNQCGKAFANQRYFKV
FT                   YKIMHTRDKPYECNQCGKAFANQNYIKVHKRIHTGEKPYECNQCGKAFANQSYIKVHKR
FT                   IHTEEKPYKCNQCGKAFAQNSDLLTHQRIHTGKKPYKCNHCGKAFVRNDNL"
FT   gene            <3974738..>3984603
FT                   /locus_tag="mCG_122032"
FT                   /note="gene_id=mCG122032.1"
FT   mRNA            join(<3974738..3974943,3978469..3978751,3979140..3979943,
FT                   3980928..3981152,3982276..3982399,3983699..>3984603)
FT                   /locus_tag="mCG_122032"
FT                   /product="mCG122032"
FT                   /note="gene_id=mCG122032.1 transcript_id=mCT123246.1
FT                   created on 23-APR-2002"
FT   CDS             join(3974738..3974943,3978469..3978751,3979140..3979943,
FT                   3980928..3981152,3982276..3982399,3983699..3984603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122032"
FT                   /product="mCG122032"
FT                   /note="gene_id=mCG122032.1 transcript_id=mCT123246.1
FT                   protein_id=mCP66869.1"
FT                   /protein_id="EDL07470.1"
FT                   /translation="MKQLCAFTISFLLLKFSLILCCLTEPICFWRIKNSEDDDRDLQRE
FT                   CHFYLWAIDKPIEDDFYNIVYNFRIAASEYEILLIMFFATDEINKNPYLLPNITLIFTI
FT                   IGGHCHDLLGGLDEAYTQINGRVKFVNYFCYSDDSCLIGLTGPSWKTSLKLAMDSSMPM
FT                   VFFGPFNPNLCDHDRLPHVHQVAPKDSHLSHGMVSLMFHFTWTWIGLVISDDNQGIQFL
FT                   SDLRKEMQRHGICLAFVNMIPENMQIYMTRATIYDKQIMTSSAKVVIIYGDMNSTLEIS
FT                   FRRWEDLGAQRIWITTSQWDVITNKKDFTLNLFHGTVTFAHYKGEIPKFRNFMQTINTD
FT                   KYPVDISHTILEWNYFNCSSSKNSSKMDHFTFNNTLEWTALHKYDMALSEEGYNLYNAV
FT                   YAAAHTYHEHFLQQAESQKRADPKRDFTECQQVSSLLKTRVFTNPVGELVNMMHGENEC
FT                   TEYDIFIIWNFPQGLGLKVKIGSYLPCFPQSQQLHISDDLEWAMGGTSVPSSMCSMTCT
FT                   AGFRKIHQKETADCCFNCVPCPENEVSNETDMEQCVMCPDDKYANIEQTHCLQRTVSFL
FT                   AYEDPLGMALGCMALSFSAITTLVLVTFVKYKDTPIVKANNRILSYILLISLDFCFLCS
FT                   LLFIGHPTQVTCILQQTTFGVFFTVAVSTVLAKTITVVMAFKLTTPGRRMRGMMMTGAP
FT                   KLVIPICTLIQLVLCGIWLVTSPPFIDRDIKSEHGKTVILCNKGSVIAFHFVLGYLGFL
FT                   ALGSFTVAFLARNLPDRFNEAKFLTFSMLMFCSVWITFLPVYHSTRGKVMVAVEVFSIL
FT                   ASCAGLVGCIFFPKCYVILIRSDSIFIQKYKDELHY"
FT   assembly_gap    21442..25531
FT                   /estimated_length=4090
FT                   /gap_type="unknown"
FT   assembly_gap    27967..29176
FT                   /estimated_length=1210
FT                   /gap_type="unknown"
FT   assembly_gap    30650..30935
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    53653..54275
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    84753..85168
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    91174..91269
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    91913..91953
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    104535..104627
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    107569..108297
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    134529..134548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    135634..135653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    173679..173825
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    178902..179315
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    204150..204295
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    209174..209193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222657..222676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    225626..226038
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    234546..234565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    251862..252139
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    281639..281888
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    293205..293683
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    301006..301111
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    416901..416920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    429738..429757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    434146..434343
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    440458..440724
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    447354..447405
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    548391..548535
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    586925..587199
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    601697..601716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    605698..605717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    606749..606768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    610133..610152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623895..624434
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    632399..633278
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    640980..641079
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    650990..651156
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    683405..683511
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    684733..684752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    686136..687868
FT                   /estimated_length=1733
FT                   /gap_type="unknown"
FT   assembly_gap    700441..700535
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    718416..718435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    743447..743524
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    747318..747561
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    748670..748892
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    755792..755992
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    757342..757361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    758446..758465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    767608..767676
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    769719..774483
FT                   /estimated_length=4765
FT                   /gap_type="unknown"
FT   assembly_gap    779579..779598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    788121..788145
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    810985..811188
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    832194..832311
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    843770..843799
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    857546..857759
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    878879..879119
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    886780..886819
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    887376..887853
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    889384..889465
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    905535..905554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    908748..908884
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    971861..971880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    981526..981739
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    984031..984065
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1002403..1002634
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    1009899..1009927
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1013799..1014088
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    1026533..1026733
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1028432..1028624
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    1043559..1043657
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    1052566..1052625
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1059213..1059361
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1079622..1079683
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    1097627..1097646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108103..1108122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1112721..1112793
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1126320..1126597
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    1147348..1147498
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1155125..1155273
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1166899..1166918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1182748..1182767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1219432..1219451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1268051..1268070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1279764..1279783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1281877..1282300
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    1295088..1295439
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    1305337..1307915
FT                   /estimated_length=2579
FT                   /gap_type="unknown"
FT   assembly_gap    1349403..1349422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1351894..1351913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1366666..1366685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1398838..1398857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1432570..1432714
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1436424..1436443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1440163..1440208
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1449773..1449985
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    1470529..1470767
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    1472555..1472991
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    1477343..1478012
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    1514729..1514748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1516321..1516431
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1523939..1524065
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    1529975..1530004
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1535723..1535858
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    1573793..1573812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1575847..1575934
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    1579680..1580883
FT                   /estimated_length=1204
FT                   /gap_type="unknown"
FT   assembly_gap    1585297..1585316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1589333..1589362
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1590435..1590454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1628802..1630804
FT                   /estimated_length=2003
FT                   /gap_type="unknown"
FT   assembly_gap    1636917..1637295
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    1644946..1649871
FT                   /estimated_length=4926
FT                   /gap_type="unknown"
FT   assembly_gap    1655527..1655546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1678424..1678581
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1685814..1685833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1695225..1695244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1696296..1696315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1737574..1737774
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1749417..1749451
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1767440..1767459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1773000..1773019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1832417..1832436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1865296..1865390
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1878848..1878905
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    1897226..1899626
FT                   /estimated_length=2401
FT                   /gap_type="unknown"
FT   assembly_gap    1907943..1908135
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    1937284..1937303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1951074..1951093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1967808..1969098
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   assembly_gap    1983187..1983460
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    1992089..1992603
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    1999375..1999394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2003680..2003699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2009465..2009700
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    2017595..2017733
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    2043873..2043892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2065199..2065886
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    2084700..2085920
FT                   /estimated_length=1221
FT                   /gap_type="unknown"
FT   assembly_gap    2086446..2086515
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    2094283..2094500
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    2095664..2095801
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2142070..2142450
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    2187074..2187093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2222905..2222924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264207..2264237
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    2300106..2300125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2315859..2315878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2444569..2444588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2479204..2480618
FT                   /estimated_length=1415
FT                   /gap_type="unknown"
FT   assembly_gap    2523540..2523620
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    2524806..2525536
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    2527809..2527828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2538466..2538523
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    2560754..2560773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2636380..2636399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2649313..2650106
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    2660022..2660410
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    2691525..2691544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2719701..2719762
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2732499..2732687
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2737212..2737437
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    2762318..2762561
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    2777060..2777079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2777882..2777909
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2812751..2812770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2821580..2821648
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2827677..2827696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2862123..2862335
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    2863501..2863747
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    2865050..2865153
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2883731..2883919
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2892566..2892724
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    2901722..2901741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2934309..2934328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3165047..3165066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3222288..3222336
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3234497..3234521
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3258385..3258775
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    3274357..3274376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3278317..3278561
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    3362359..3362528
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    3417951..3418036
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    3425674..3425693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3429339..3429450
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    3516369..3516388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3551234..3551253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3553521..3554191
FT                   /estimated_length=671
FT                   /gap_type="unknown"
FT   assembly_gap    3610933..3610952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3613715..3613734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623916..3623935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3655454..3655522
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3697420..3697574
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3699434..3699453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3735110..3735129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3750751..3750770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3765962..3765981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3782471..3782490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3806333..3806356
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3855432..3855451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3877035..3877054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3886208..3886227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3888108..3888237
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3900659..3900847
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    3904330..3905022
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    3906369..3914406
FT                   /estimated_length=8038
FT                   /gap_type="unknown"
XX
CO   join(AAHY01013263.1:1..21441,gap(4090),AAHY01013264.1:1..2435,gap(1210),
CO   AAHY01013265.1:1..1473,gap(286),AAHY01013266.1:1..22717,gap(623),
CO   AAHY01013267.1:1..30477,gap(416),AAHY01013268.1:1..6005,gap(96),
CO   complement(AAHY01013269.1:1..643),gap(41),AAHY01013270.1:1..12581,gap(93),
CO   complement(AAHY01013271.1:1..2941),gap(729),AAHY01013272.1:1..26231,
CO   gap(20),AAHY01013273.1:1..1085,gap(20),AAHY01013274.1:1..38025,gap(147),
CO   AAHY01013275.1:1..5076,gap(414),AAHY01013276.1:1..24834,gap(146),
CO   AAHY01013277.1:1..4878,gap(20),AAHY01013278.1:1..13463,gap(20),
CO   AAHY01013279.1:1..2949,gap(413),AAHY01013280.1:1..8507,gap(20),
CO   AAHY01013281.1:1..17296,gap(278),AAHY01013282.1:1..29499,gap(250),
CO   complement(AAHY01013283.1:1..11316),gap(479),AAHY01013284.1:1..7322,
CO   gap(106),AAHY01013285.1:1..115789,gap(20),AAHY01013286.1:1..12817,gap(20),
CO   complement(AAHY01013287.1:1..4388),gap(198),AAHY01013288.1:1..6114,
CO   gap(267),AAHY01013289.1:1..6629,gap(52),AAHY01013290.1:1..100985,gap(145),
CO   AAHY01013291.1:1..38389,gap(275),AAHY01013292.1:1..14497,gap(20),
CO   AAHY01013293.1:1..3981,gap(20),AAHY01013294.1:1..1031,gap(20),
CO   complement(AAHY01013295.1:1..3364),gap(20),
CO   complement(AAHY01013296.1:1..13742),gap(540),
CO   complement(AAHY01013297.1:1..7964),gap(880),AAHY01013298.1:1..7701,
CO   gap(100),complement(AAHY01013299.1:1..9910),gap(167),
CO   AAHY01013300.1:1..32248,gap(107),complement(AAHY01013301.1:1..1221),
CO   gap(20),AAHY01013302.1:1..1383,gap(1733),AAHY01013303.1:1..12572,gap(95),
CO   AAHY01013304.1:1..17880,gap(20),complement(AAHY01013305.1:1..25011),
CO   gap(78),AAHY01013306.1:1..3793,gap(244),AAHY01013307.1:1..1108,gap(223),
CO   AAHY01013308.1:1..6899,gap(201),AAHY01013309.1:1..1349,gap(20),
CO   AAHY01013310.1:1..1084,gap(20),AAHY01013311.1:1..9142,gap(69),
CO   AAHY01013312.1:1..2042,gap(4765),AAHY01013313.1:1..5095,gap(20),
CO   complement(AAHY01013314.1:1..8522),gap(25),AAHY01013315.1:1..22839,
CO   gap(204),complement(AAHY01013316.1:1..21005),gap(118),
CO   AAHY01013317.1:1..11458,gap(30),complement(AAHY01013318.1:1..13746),
CO   gap(214),AAHY01013319.1:1..21119,gap(241),
CO   complement(AAHY01013320.1:1..7660),gap(40),
CO   complement(AAHY01013321.1:1..556),gap(478),AAHY01013322.1:1..1530,gap(82),
CO   complement(AAHY01013323.1:1..16069),gap(20),AAHY01013324.1:1..3193,
CO   gap(137),complement(AAHY01013325.1:1..62976),gap(20),
CO   AAHY01013326.1:1..9645,gap(214),AAHY01013327.1:1..2291,gap(35),
CO   AAHY01013328.1:1..18337,gap(232),AAHY01013329.1:1..7264,gap(29),
CO   AAHY01013330.1:1..3871,gap(290),complement(AAHY01013331.1:1..12444),
CO   gap(201),AAHY01013332.1:1..1698,gap(193),AAHY01013333.1:1..14934,gap(99),
CO   AAHY01013334.1:1..8908,gap(60),complement(AAHY01013335.1:1..6587),gap(149),
CO   complement(AAHY01013336.1:1..20260),gap(62),AAHY01013337.1:1..17943,
CO   gap(20),AAHY01013338.1:1..10456,gap(20),AAHY01013339.1:1..4598,gap(73),
CO   complement(AAHY01013340.1:1..13526),gap(278),
CO   complement(AAHY01013341.1:1..20750),gap(151),AAHY01013342.1:1..7626,
CO   gap(149),AAHY01013343.1:1..11625,gap(20),
CO   complement(AAHY01013344.1:1..15829),gap(20),AAHY01013345.1:1..36664,
CO   gap(20),AAHY01013346.1:1..48599,gap(20),AAHY01013347.1:1..11693,gap(20),
CO   AAHY01013348.1:1..2093,gap(424),AAHY01013349.1:1..12787,gap(352),
CO   AAHY01013350.1:1..9897,gap(2579),AAHY01013351.1:1..41487,gap(20),
CO   AAHY01013352.1:1..2471,gap(20),AAHY01013353.1:1..14752,gap(20),
CO   AAHY01013354.1:1..32152,gap(20),AAHY01013355.1:1..33712,gap(145),
CO   AAHY01013356.1:1..3709,gap(20),complement(AAHY01013357.1:1..3719),gap(46),
CO   AAHY01013358.1:1..9564,gap(213),AAHY01013359.1:1..20543,gap(239),
CO   complement(AAHY01013360.1:1..1787),gap(437),AAHY01013361.1:1..4351,
CO   gap(670),AAHY01013362.1:1..36716,gap(20),
CO   complement(AAHY01013363.1:1..1572),gap(111),AAHY01013364.1:1..7507,
CO   gap(127),AAHY01013365.1:1..5909,gap(30),AAHY01013366.1:1..5718,gap(136),
CO   AAHY01013367.1:1..37934,gap(20),AAHY01013368.1:1..2034,gap(88),
CO   complement(AAHY01013369.1:1..3745),gap(1204),AAHY01013370.1:1..4413,
CO   gap(20),AAHY01013371.1:1..4016,gap(30),complement(AAHY01013372.1:1..1072),
CO   gap(20),AAHY01013373.1:1..38347,gap(2003),
CO   complement(AAHY01013374.1:1..6112),gap(379),AAHY01013375.1:1..7650,
CO   gap(4926),AAHY01013376.1:1..5655,gap(20),AAHY01013377.1:1..22877,gap(158),
CO   AAHY01013378.1:1..7232,gap(20),AAHY01013379.1:1..9391,gap(20),
CO   complement(AAHY01013380.1:1..1051),gap(20),AAHY01013381.1:1..41258,
CO   gap(201),complement(AAHY01013382.1:1..11642),gap(35),
CO   AAHY01013383.1:1..17988,gap(20),AAHY01013384.1:1..5540,gap(20),
CO   AAHY01013385.1:1..59397,gap(20),AAHY01013386.1:1..32859,gap(95),
CO   AAHY01013387.1:1..13457,gap(58),AAHY01013388.1:1..18320,gap(2401),
CO   AAHY01013389.1:1..8316,gap(193),complement(AAHY01013390.1:1..29148),
CO   gap(20),complement(AAHY01013391.1:1..13770),gap(20),
CO   AAHY01013392.1:1..16714,gap(1291),AAHY01013393.1:1..14088,gap(274),
CO   AAHY01013394.1:1..8628,gap(515),complement(AAHY01013395.1:1..6771),gap(20),
CO   AAHY01013396.1:1..4285,gap(20),AAHY01013397.1:1..5765,gap(236),
CO   AAHY01013398.1:1..7894,gap(139),complement(AAHY01013399.1:1..26139),
CO   gap(20),AAHY01013400.1:1..21306,gap(688),AAHY01013401.1:1..18813,gap(1221),
CO   AAHY01013402.1:1..525,gap(70),AAHY01013403.1:1..7767,gap(218),
CO   complement(AAHY01013404.1:1..1163),gap(138),
CO   complement(AAHY01013405.1:1..46268),gap(381),AAHY01013406.1:1..44623,
CO   gap(20),AAHY01013407.1:1..35811,gap(20),AAHY01013408.1:1..41282,gap(31),
CO   AAHY01013409.1:1..35868,gap(20),AAHY01013410.1:1..15733,gap(20),
CO   complement(AAHY01013411.1:1..128690),gap(20),AAHY01013412.1:1..34615,
CO   gap(1415),AAHY01013413.1:1..42921,gap(81),
CO   complement(AAHY01013414.1:1..1185),gap(731),
CO   complement(AAHY01013415.1:1..2272),gap(20),AAHY01013416.1:1..10637,gap(58),
CO   AAHY01013417.1:1..22230,gap(20),AAHY01013418.1:1..75606,gap(20),
CO   AAHY01013419.1:1..12913,gap(794),AAHY01013420.1:1..9915,gap(389),
CO   AAHY01013421.1:1..31114,gap(20),AAHY01013422.1:1..28156,gap(62),
CO   AAHY01013423.1:1..12736,gap(189),AAHY01013424.1:1..4524,gap(226),
CO   AAHY01013425.1:1..24880,gap(244),complement(AAHY01013426.1:1..14498),
CO   gap(20),AAHY01013427.1:1..802,gap(28),AAHY01013428.1:1..34841,gap(20),
CO   complement(AAHY01013429.1:1..8809),gap(69),
CO   complement(AAHY01013430.1:1..6028),gap(20),AAHY01013431.1:1..34426,
CO   gap(213),AAHY01013432.1:1..1165,gap(247),
CO   complement(AAHY01013433.1:1..1302),gap(104),AAHY01013434.1:1..18577,
CO   gap(189),complement(AAHY01013435.1:1..8646),gap(159),
CO   AAHY01013436.1:1..8997,gap(20),complement(AAHY01013437.1:1..32567),gap(20),
CO   AAHY01013438.1:1..230718,gap(20),AAHY01013439.1:1..57221,gap(49),
CO   AAHY01013440.1:1..12160,gap(25),complement(AAHY01013441.1:1..23863),
CO   gap(391),complement(AAHY01013442.1:1..15581),gap(20),
CO   complement(AAHY01013443.1:1..3940),gap(245),AAHY01013444.1:1..83797,
CO   gap(170),AAHY01013445.1:1..55422,gap(86),AAHY01013446.1:1..7637,gap(20),
CO   complement(AAHY01013447.1:1..3645),gap(112),AAHY01013448.1:1..86918,
CO   gap(20),AAHY01013449.1:1..34845,gap(20),AAHY01013450.1:1..2267,gap(671),
CO   AAHY01013451.1:1..56741,gap(20),AAHY01013452.1:1..2762,gap(20),
CO   complement(AAHY01013453.1:1..10181),gap(20),
CO   complement(AAHY01013454.1:1..31518),gap(69),AAHY01013455.1:1..41897,
CO   gap(155),complement(AAHY01013456.1:1..1859),gap(20),
CO   AAHY01013457.1:1..35656,gap(20),AAHY01013458.1:1..15621,gap(20),
CO   complement(AAHY01013459.1:1..15191),gap(20),AAHY01013460.1:1..16489,
CO   gap(20),AAHY01013461.1:1..23842,gap(24),
CO   complement(AAHY01013462.1:1..49075),gap(20),
CO   complement(AAHY01013463.1:1..21583),gap(20),AAHY01013464.1:1..9153,gap(20),
CO   AAHY01013465.1:1..1880,gap(130),AAHY01013466.1:1..12421,gap(189),
CO   complement(AAHY01013467.1:1..3482),gap(693),AAHY01013468.1:1..1346,
CO   gap(8038),AAHY01013469.1:1..77484)
//


spacer
spacer