
ID   CH466624; SV 2; linear; genomic DNA; CON; MUS; 4239997 BP.
AC   CH466624;
PR   Project:PRJNA11785;
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
DE   Mus musculus 232000009798417 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-4239997
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-4239997
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-4239997
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 540bed97ae9622f70ebf5f9c322b5fe7.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000228.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000005864; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031349; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035776; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078317; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035775; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035783; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035784; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035795; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035796; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035797; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035803; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035766; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035767; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035768; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035779; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035780; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035781; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0035784; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035688; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035689; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035690; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035695; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035701; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035702; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035703; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035710; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035745; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035753; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035754; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035755; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035760; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035766; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035767; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035768; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035771; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035456; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035457; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035463; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035469; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035470; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035471; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035477; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036283; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036284; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036285; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036290; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036296; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036297; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036298; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036302; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034748; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034749; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034750; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034755; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034761; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034762; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034763; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035431; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035432; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035433; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035438; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035444; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035445; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035446; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035450; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035584; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035585; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035586; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035597; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035599; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035608; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035535; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035536; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035537; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035542; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035548; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035549; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035550; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035552; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035673; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035674; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035675; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035680; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035686; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035687; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035688; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035694; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035562; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035570; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035572; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035577; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035583; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035584; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035585; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035589; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036296; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036304; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036305; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036306; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036317; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036318; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036319; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036323; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034449; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034450; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034455; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034461; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034462; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034463; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034467; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034881; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034890; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034891; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034892; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034897; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034903; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034904; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034905; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034907; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088874; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164800; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096265; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096299; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096307; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096320; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096332; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096335; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096337; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096347; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096388; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096397; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096413; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096425; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096428; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096430; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0096437; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096329; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096335; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096337; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096351; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096362; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096365; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096367; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0096378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096277; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096312; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096321; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096349; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096352; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096354; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096360; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095863; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095869; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095872; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095887; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095899; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095902; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095904; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096787; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096821; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096827; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096830; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096843; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096854; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096858; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096868; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096457; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096478; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096493; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096495; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096503; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095783; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095789; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095792; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095804; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095816; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095819; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095821; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095829; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095987; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0095993; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0095996; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096029; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0096043; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095833; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095839; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095842; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095855; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095867; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095870; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095872; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095877; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096021; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096027; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096029; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096041; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096053; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096056; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096058; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0096068; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095762; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095796; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095802; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095805; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095821; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095832; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095835; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095837; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095845; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097132; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097165; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097171; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097174; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097190; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097205; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097207; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097215; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095874; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095879; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095882; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095895; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095907; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095910; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095912; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095919; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094805; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094842; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094847; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094849; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094864; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094876; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094881; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094887; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   On Sep 6, 2005 this sequence version replaced gi:70976331.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..4239997
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3367..3386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5662..5993
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    15860..15879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17321..17340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25288..25307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26651..27716
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    29431..31248
FT                   /estimated_length=1818
FT                   /gap_type="unknown"
FT   assembly_gap    32308..32327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(59896..60742)
FT                   /pseudo
FT                   /locus_tag="mCG_1034263"
FT                   /note="gene_id=mCG1034263.1"
FT   mRNA            complement(59896..60742)
FT                   /pseudo
FT                   /locus_tag="mCG_1034263"
FT                   /note="gene_id=mCG1034263.1 transcript_id=mCT151967.1
FT                   created on 06-MAY-2002"
FT   assembly_gap    67802..67993
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    74238..74620
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    78785..78995
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    107960..108692
FT                   /estimated_length=733
FT                   /gap_type="unknown"
FT   assembly_gap    117961..117984
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    121130..121149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    125505..125524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            127538..129222
FT                   /locus_tag="mCG_1034281"
FT                   /note="gene_id=mCG1034281.1"
FT   mRNA            join(127538..127599,127644..128301,128778..129222)
FT                   /locus_tag="mCG_1034281"
FT                   /product="mCG1034281"
FT                   /note="gene_id=mCG1034281.1 transcript_id=mCT151985.1
FT                   created on 06-MAY-2002"
FT   CDS             128014..128277
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034281"
FT                   /product="mCG1034281"
FT                   /note="gene_id=mCG1034281.1 transcript_id=mCT151985.1
FT                   protein_id=mCP80571.1"
FT                   /protein_id="EDL26602.1"
FT   assembly_gap    129630..129649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    133355..133398
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    137767..138665
FT                   /estimated_length=899
FT                   /gap_type="unknown"
FT   assembly_gap    145847..145873
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    147579..147598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    150749..150813
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    153017..153036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    166108..166127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    177721..177740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    192449..192468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    193394..193756
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    217507..217526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222546..222571
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    231941..232011
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    234862..234881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    247366..247385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    259850..259869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    282068..282101
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    288920..288977
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    293260..293279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    296657..297673
FT                   /estimated_length=1017
FT                   /gap_type="unknown"
FT   assembly_gap    299435..299454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    310673..310847
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    312534..317780
FT                   /estimated_length=5247
FT                   /gap_type="unknown"
FT   assembly_gap    336441..336520
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    338687..338706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    348405..348424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    358514..359492
FT                   /estimated_length=979
FT                   /gap_type="unknown"
FT   assembly_gap    365358..366520
FT                   /estimated_length=1163
FT                   /gap_type="unknown"
FT   assembly_gap    368243..368262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    374542..374561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    376674..376693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    377377..379384
FT                   /estimated_length=2008
FT                   /gap_type="unknown"
FT   assembly_gap    380179..382880
FT                   /estimated_length=2702
FT                   /gap_type="unknown"
FT   assembly_gap    394345..394931
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    401443..401936
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    410363..410653
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    414615..414678
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    430084..430129
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    431656..431675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    453794..453966
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    457791..457908
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    459864..460046
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    463972..464205
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    469763..470092
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    473573..473618
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    476392..476411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(487083..>491665)
FT                   /locus_tag="mCG_145427"
FT                   /note="gene_id=mCG145427.0"
FT   mRNA            complement(join(487083..488718,489005..489072,
FT                   491544..>491665))
FT                   /locus_tag="mCG_145427"
FT                   /product="mCG145427"
FT                   /note="gene_id=mCG145427.0 transcript_id=mCT184851.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(487135..>487392)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145427"
FT                   /product="mCG145427"
FT                   /note="gene_id=mCG145427.0 transcript_id=mCT184851.0
FT                   protein_id=mCP105784.0"
FT                   /protein_id="EDL26601.1"
FT   assembly_gap    489194..489441
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            490722..987783
FT                   /gene="Aff2"
FT                   /locus_tag="mCG_140242"
FT                   /note="gene_id=mCG140242.1"
FT   mRNA            join(490722..491233,653071..653203,674485..675345,
FT                   809927..809971,840982..841018,841353..841386,
FT                   883220..883316,900834..900871,946493..946652,
FT                   949754..950743,956188..956309,959595..959814,
FT                   964625..964926,965499..965562,968853..968989,
FT                   972528..972599,975141..975193,979666..979856,
FT                   983456..987783)
FT                   /gene="Aff2"
FT                   /locus_tag="mCG_140242"
FT                   /product="AF4/FMR2 family, member 2"
FT                   /note="gene_id=mCG140242.1 transcript_id=mCT168568.1
FT                   created on 24-NOV-2004"
FT   CDS             join(491187..491233,653071..653203,674485..675345,
FT                   809927..809971,840982..841018,841353..841386,
FT                   883220..883316,900834..900871,946493..946652,
FT                   949754..950743,956188..956309,959595..959814,
FT                   964625..964926,965499..965562,968853..968989,
FT                   972528..972599,975141..975183)
FT                   /codon_start=1
FT                   /gene="Aff2"
FT                   /locus_tag="mCG_140242"
FT                   /product="AF4/FMR2 family, member 2"
FT                   /note="gene_id=mCG140242.1 transcript_id=mCT168568.1
FT                   protein_id=mCP91481.1"
FT                   /protein_id="EDL26600.1"
FT   assembly_gap    495660..495679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    512839..512858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    516027..516046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    536842..536861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    556248..556280
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    559564..559583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    572992..573011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    584679..584698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    592724..592743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    594943..598520
FT                   /estimated_length=3578
FT                   /gap_type="unknown"
FT   assembly_gap    603478..603497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    632227..632256
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    636401..636587
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    656953..656972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    658455..659320
FT                   /estimated_length=866
FT                   /gap_type="unknown"
FT   assembly_gap    665244..665947
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    720374..720735
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    729036..730046
FT                   /estimated_length=1011
FT                   /gap_type="unknown"
FT   assembly_gap    750493..751103
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    757277..757296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    775934..775953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    785948..785967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    799340..799499
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    861612..861764
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    878437..878519
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    886082..886170
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    891874..892030
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    893911..893948
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    896986..897005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    910063..910082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    913573..913592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    948369..948431
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    960285..960304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    962747..962766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    970561..970969
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    972976..973027
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    977448..977725
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    984303..984322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    996603..997228
FT                   /estimated_length=626
FT                   /gap_type="unknown"
FT   assembly_gap    998424..998443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1017720..1017903
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    1019490..1019965
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    1023999..1024018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1026836..1026984
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1033161..1033180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1041504..1041523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1044464..1103943)
FT                   /locus_tag="mCG_140243"
FT                   /note="gene_id=mCG140243.0"
FT   mRNA            complement(join(1044464..1044894,1063952..1063996,
FT                   1082318..1082478,1094632..1094707,1095159..1095249,
FT                   1103840..1103943))
FT                   /locus_tag="mCG_140243"
FT                   /product="mCG140243"
FT                   /note="gene_id=mCG140243.0 transcript_id=mCT168569.0
FT                   created on 06-MAY-2002"
FT   assembly_gap    1046307..1053851
FT                   /estimated_length=7545
FT                   /gap_type="unknown"
FT   assembly_gap    1054910..1056132
FT                   /estimated_length=1223
FT                   /gap_type="unknown"
FT   gene            1060283..1060962
FT                   /locus_tag="mCG_15151"
FT                   /note="gene_id=mCG15151.0"
FT   mRNA            join(1060283..1060433,1060588..1060962)
FT                   /locus_tag="mCG_15151"
FT                   /product="mCG15151"
FT                   /note="gene_id=mCG15151.0 transcript_id=mCT14324.1 created
FT                   on 06-MAY-2002"
FT   CDS             join(1060329..1060433,1060588..1060821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15151"
FT                   /product="mCG15151"
FT                   /note="gene_id=mCG15151.0 transcript_id=mCT14324.1
FT                   protein_id=mCP12521.1"
FT                   /db_xref="GOA:B1AXU1"
FT                   /db_xref="MGI:MGI:3704138"
FT                   /db_xref="UniProtKB/TrEMBL:B1AXU1"
FT                   /protein_id="EDL26599.1"
FT                   TSYELDSQ"
FT   CDS             complement(join(1063955..1063996,1082318..1082374))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140243"
FT                   /product="mCG140243"
FT                   /note="gene_id=mCG140243.0 transcript_id=mCT168569.0
FT                   protein_id=mCP91480.0"
FT                   /protein_id="EDL26598.1"
FT                   /translation="MVLQFSKAMLTFMDQVFKQEEASLMMAEQCAE"
FT   assembly_gap    1093646..1093838
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    1098234..1098260
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    1115737..1116163
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    1134301..1134320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1152896..1153094
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    1159321..1159340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1167320..1167339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1169502..1169602
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    1170884..1181518
FT                   /estimated_length=10635
FT                   /gap_type="unknown"
FT   assembly_gap    1195987..1196662
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   assembly_gap    1211859..1213283
FT                   /estimated_length=1425
FT                   /gap_type="unknown"
FT   assembly_gap    1215901..1218430
FT                   /estimated_length=2530
FT                   /gap_type="unknown"
FT   assembly_gap    1222110..1222266
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1229032..1229051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1233083..1233128
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1245231..1245250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1267031..1268366
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    1276083..1276102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1281547..1281591
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1296683..1296702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1310603..1311039
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    1322198..1322217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1323937..1324096
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    1332597..1333019
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    1334175..1334602
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    1340479..1340498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1358775..1377693
FT                   /estimated_length=18919
FT                   /gap_type="unknown"
FT   assembly_gap    1395771..1395790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1448282..>1466435)
FT                   /gene="Ids"
FT                   /locus_tag="mCG_1212"
FT                   /note="gene_id=mCG1212.2"
FT   mRNA            complement(join(1448282..1448791,1452382..1452555,
FT                   1454603..1454729,1459721..1459891,1461403..1461603,
FT                   1462497..1462585,1464431..1464608,1465256..1465392,
FT                   1466250..>1466435))
FT                   /gene="Ids"
FT                   /locus_tag="mCG_1212"
FT                   /product="iduronate 2-sulfatase"
FT                   /note="gene_id=mCG1212.2 transcript_id=mCT7973.2 created on
FT                   16-MAY-2002"
FT   CDS             complement(join(1448319..1448791,1452382..1452555,
FT                   1454603..1454729,1459721..1459891,1461403..1461603,
FT                   1462497..1462585,1464431..1464608,1465256..1465392,
FT                   1466250..>1466334))
FT                   /codon_start=1
FT                   /gene="Ids"
FT                   /locus_tag="mCG_1212"
FT                   /product="iduronate 2-sulfatase"
FT                   /note="gene_id=mCG1212.2 transcript_id=mCT7973.2
FT                   protein_id=mCP21058.2"
FT                   /protein_id="EDL26597.1"
FT   assembly_gap    1451169..1451188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1471970..1475464
FT                   /estimated_length=3495
FT                   /gap_type="unknown"
FT   assembly_gap    1481498..1481517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1483641..1530770
FT                   /estimated_length=47130
FT                   /gap_type="unknown"
FT   assembly_gap    1539265..1541055
FT                   /estimated_length=1791
FT                   /gap_type="unknown"
FT   assembly_gap    1543109..1543655
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   gene            complement(1545718..1563068)
FT                   /locus_tag="mCG_1214"
FT                   /note="gene_id=mCG1214.2"
FT   mRNA            complement(join(1545718..1547254,1548154..1548277,
FT                   1550944..1551027,1553095..1553302,1556007..1556183,
FT                   1562864..1563068))
FT                   /locus_tag="mCG_1214"
FT                   /product="mCG1214"
FT                   /note="gene_id=mCG1214.2 transcript_id=mCT7975.2 created on
FT                   06-MAY-2002"
FT   CDS             complement(join(1547010..1547254,1548154..1548277,
FT                   1550944..1551027,1553095..1553302,1556007..1556183,
FT                   1562864..1562901))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1214"
FT                   /product="mCG1214"
FT                   /note="gene_id=mCG1214.2 transcript_id=mCT7975.2
FT                   protein_id=mCP21060.2"
FT                   /protein_id="EDL26596.1"
FT                   PPKLNIEMPD"
FT   assembly_gap    1548811..1549329
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    1559921..1559940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1571847..1571866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1580983..1581611
FT                   /locus_tag="mCG_1034277"
FT                   /note="gene_id=mCG1034277.1"
FT   mRNA            1580983..1581611
FT                   /locus_tag="mCG_1034277"
FT                   /product="mCG1034277"
FT                   /note="gene_id=mCG1034277.1 transcript_id=mCT151981.1
FT                   created on 03-MAY-2002"
FT   gene            <1581214..>1591813
FT                   /locus_tag="mCG_140163"
FT                   /note="gene_id=mCG140163.0"
FT   mRNA            join(<1581214..1581298,1585051..1585199,1585252..1585465,
FT                   1589632..1589705,1590623..1590765,1590826..>1591813)
FT                   /locus_tag="mCG_140163"
FT                   /product="mCG140163"
FT                   /note="gene_id=mCG140163.0 transcript_id=mCT168283.0
FT                   created on 11-JUL-2002"
FT   CDS             1581214..1581435
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034277"
FT                   /product="mCG1034277"
FT                   /note="gene_id=mCG1034277.1 transcript_id=mCT151981.1
FT                   protein_id=mCP80564.1"
FT                   /protein_id="EDL26595.1"
FT   CDS             join(<1589703..1589705,1590623..1590765,1590826..1591813)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140163"
FT                   /product="mCG140163"
FT                   /note="gene_id=mCG140163.0 transcript_id=mCT168283.0
FT                   protein_id=mCP91232.0"
FT                   /protein_id="EDL26594.1"
FT   gene            1595629..1598237
FT                   /locus_tag="mCG_140162"
FT                   /note="gene_id=mCG140162.0"
FT   mRNA            1595629..1598237
FT                   /locus_tag="mCG_140162"
FT                   /product="mCG140162"
FT                   /note="gene_id=mCG140162.0 transcript_id=mCT168282.0
FT                   created on 03-MAY-2002"
FT   CDS             1595902..1596402
FT                   /codon_start=1
FT                   /locus_tag="mCG_140162"
FT                   /product="mCG140162"
FT                   /note="gene_id=mCG140162.0 transcript_id=mCT168282.0
FT                   protein_id=mCP91231.0"
FT                   /protein_id="EDL26593.1"
FT                   PAE"
FT   gene            complement(1615912..1617857)
FT                   /pseudo
FT                   /locus_tag="mCG_113016"
FT                   /note="gene_id=mCG113016.0"
FT   mRNA            complement(1615912..1617857)
FT                   /pseudo
FT                   /locus_tag="mCG_113016"
FT                   /note="gene_id=mCG113016.0 transcript_id=mCT114093.1
FT                   created on 10-JUN-2003"
FT   assembly_gap    1647098..1651520
FT                   /estimated_length=4423
FT                   /gap_type="unknown"
FT   gene            complement(1677432..1677973)
FT                   /pseudo
FT                   /locus_tag="mCG_49375"
FT                   /note="gene_id=mCG49375.1"
FT   mRNA            complement(1677432..1677973)
FT                   /pseudo
FT                   /locus_tag="mCG_49375"
FT                   /note="gene_id=mCG49375.1 transcript_id=mCT49558.2 created
FT                   on 03-MAY-2002"
FT   gene            complement(<1689638..1690544)
FT                   /locus_tag="mCG_1034275"
FT                   /note="gene_id=mCG1034275.1"
FT   mRNA            complement(<1689638..1690544)
FT                   /locus_tag="mCG_1034275"
FT                   /product="mCG1034275"
FT                   /note="gene_id=mCG1034275.1 transcript_id=mCT151979.1
FT                   created on 09-JUN-2003"
FT   CDS             complement(<1689638..1689930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034275"
FT                   /product="mCG1034275"
FT                   /note="gene_id=mCG1034275.1 transcript_id=mCT151979.1
FT                   protein_id=mCP80561.1"
FT                   /protein_id="EDL26592.1"
FT   gene            complement(1729510..1730004)
FT                   /locus_tag="mCG_1034255"
FT                   /note="gene_id=mCG1034255.1"
FT   mRNA            complement(1729510..1730004)
FT                   /locus_tag="mCG_1034255"
FT                   /product="mCG1034255"
FT                   /note="gene_id=mCG1034255.1 transcript_id=mCT151959.1
FT                   created on 01-MAY-2002"
FT   CDS             complement(1729550..1729894)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034255"
FT                   /product="mCG1034255"
FT                   /note="gene_id=mCG1034255.1 transcript_id=mCT151959.1
FT                   protein_id=mCP80582.1"
FT                   /protein_id="EDL26591.1"
FT                   EDGKFFGLFD"
FT   assembly_gap    1736966..1737237
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    1738936..1738955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1740483..1740502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1741530..1742251
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    1753132..1753151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1766469..1766488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1796585..1796804
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    1806052..1806529
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    1809027..1809046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1817747..1820767
FT                   /estimated_length=3021
FT                   /gap_type="unknown"
FT   assembly_gap    1824229..1824326
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    1827582..1827811
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1836890..1836909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1838264..1838875
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    1840592..1840996
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    1848007..1848264
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    1851390..1854601
FT                   /estimated_length=3212
FT                   /gap_type="unknown"
FT   assembly_gap    1859293..1859444
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    1862729..1862748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1880275..1880294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1881601..1881827
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    1896361..1896380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1916048..1916067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1918524..1918543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1928293..1936292
FT                   /estimated_length=8000
FT                   /gap_type="unknown"
FT   gene            1937290..1938112
FT                   /locus_tag="mCG_49954"
FT                   /note="gene_id=mCG49954.2"
FT   mRNA            1937290..1938112
FT                   /locus_tag="mCG_49954"
FT                   /product="mCG49954, transcript variant mCT168310"
FT                   /note="gene_id=mCG49954.2 transcript_id=mCT168310.0 created
FT                   on 01-MAY-2002"
FT   mRNA            join(1937291..1937391,1937467..1938112)
FT                   /locus_tag="mCG_49954"
FT                   /product="mCG49954, transcript variant mCT50137"
FT                   /note="gene_id=mCG49954.2 transcript_id=mCT50137.2 created
FT                   on 01-MAY-2002"
FT   CDS             1937493..1937927
FT                   /codon_start=1
FT                   /locus_tag="mCG_49954"
FT                   /product="mCG49954, isoform CRA_a"
FT                   /note="gene_id=mCG49954.2 transcript_id=mCT50137.2
FT                   protein_id=mCP39104.2 isoform=CRA_a"
FT                   /protein_id="EDL26589.1"
FT   CDS             1937493..1937927
FT                   /codon_start=1
FT                   /locus_tag="mCG_49954"
FT                   /product="mCG49954, isoform CRA_a"
FT                   /note="gene_id=mCG49954.2 transcript_id=mCT168310.0
FT                   protein_id=mCP91235.0 isoform=CRA_a"
FT                   /protein_id="EDL26590.1"
FT   assembly_gap    1938653..1938976
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    1955356..1955451
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    1959893..1959961
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    1963296..1964176
FT                   /estimated_length=881
FT                   /gap_type="unknown"
FT   assembly_gap    1971516..1971535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1973421..1973440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1974953..1975032
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1977539..1977558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1986006..1986025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1987507..1987767
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    1993772..1993849
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    1998018..1998046
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1999278..1999649
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    2002548..2002567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2013557..2013576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2030817..2030836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2032110..2032461
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    2047310..2047633
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   gene            2050125..2050793
FT                   /pseudo
FT                   /locus_tag="mCG_1034259"
FT                   /note="gene_id=mCG1034259.1"
FT   mRNA            2050125..2050793
FT                   /pseudo
FT                   /locus_tag="mCG_1034259"
FT                   /note="gene_id=mCG1034259.1 transcript_id=mCT151963.1
FT                   created on 01-MAY-2002"
FT   assembly_gap    2057280..2057299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2058279..2062603
FT                   /estimated_length=4325
FT                   /gap_type="unknown"
FT   assembly_gap    2063450..2063644
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    2070088..2070107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2076915..2076934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2086318..2086337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2087502..2088298
FT                   /estimated_length=797
FT                   /gap_type="unknown"
FT   assembly_gap    2089480..2090107
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    2091120..2091870
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    2094491..2094510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2099338..2099412
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    2111885..2112743
FT                   /estimated_length=859
FT                   /gap_type="unknown"
FT   assembly_gap    2125074..2125415
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    2126877..2126956
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            2127081..2231630
FT                   /locus_tag="mCG_48887"
FT                   /note="gene_id=mCG48887.2"
FT   mRNA            join(2127081..2127135,2178205..2178363,2194189..2196105,
FT                   2198069..2198179,2222903..2223156,2228905..2228989,
FT                   2231452..2231630)
FT                   /locus_tag="mCG_48887"
FT                   /product="mCG48887"
FT                   /note="gene_id=mCG48887.2 transcript_id=mCT49070.2 created
FT                   on 01-MAY-2002"
FT   assembly_gap    2128484..2129223
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    2130827..2130949
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   CDS             join(2178268..2178363,2194189..2196105,2198069..2198179,
FT                   2222903..2223156,2228905..2228938)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48887"
FT                   /product="mCG48887"
FT                   /note="gene_id=mCG48887.2 transcript_id=mCT49070.2
FT                   protein_id=mCP39106.2"
FT                   /protein_id="EDL26588.1"
FT   assembly_gap    2252722..2252741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2273559..2274709
FT                   /pseudo
FT                   /locus_tag="mCG_113781"
FT                   /note="gene_id=mCG113781.1"
FT   mRNA            2273559..2274709
FT                   /pseudo
FT                   /locus_tag="mCG_113781"
FT                   /note="gene_id=mCG113781.1 transcript_id=mCT114868.1
FT                   created on 15-MAY-2002"
FT   gene            <2291403..2397085
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /note="gene_id=mCG113778.1"
FT   mRNA            join(<2291403..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2360949..2361032,2363489..2363638,
FT                   2373543..2373731,2377958..2380655)
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, transcript
FT                   variant mCT192270"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192270.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<2291408..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2379374)
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, transcript
FT                   variant mCT192271"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192271.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<2291422..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378143,2381362..2381568,2383528..2383620,
FT                   2384295..2384408,2389498..2389674,2395442..2397085)
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, transcript
FT                   variant mCT192272"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192272.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<2291450..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378143,2381362..2381568,2383528..2383620,
FT                   2384295..2384408,2389498..2389674,2395442..2395609)
FT                   /codon_start=1
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192272.0
FT                   protein_id=mCP113229.0 isoform=CRA_d"
FT                   /protein_id="EDL26586.1"
FT   CDS             join(<2291450..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378158)
FT                   /codon_start=1
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192271.0
FT                   protein_id=mCP113228.0 isoform=CRA_c"
FT                   /protein_id="EDL26585.1"
FT   CDS             join(<2291450..2291456,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2360949..2361032,2363489..2363638,
FT                   2373543..2373731,2377958..2378158)
FT                   /codon_start=1
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192270.0
FT                   protein_id=mCP113227.0 isoform=CRA_b"
FT                   /protein_id="EDL26584.1"
FT                   EHIKASIL"
FT   mRNA            join(2291455..2291521,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378147,2381330..2381568,2383528..2383620,
FT                   2384295..2384408,2389498..2389674,2395442..2397061)
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, transcript
FT                   variant mCT114865"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT114865.1
FT                   created on 01-MAY-2002"
FT   mRNA            join(<2291455..2291521,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378143,2381362..2381568,2383528..2383620,
FT                   2384295..2384408,2389498..2389674,2395442..2397061)
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, transcript
FT                   variant mCT192269"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192269.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<2291479..2291521,2307761..2307831,2309443..2309515,
FT                   2311222..2311316,2330600..2330710,2336074..2336175,
FT                   2360949..2361032,2363489..2363638,2373543..2373731,
FT                   2377958..2378143,2381362..2381568,2383528..2383620,
FT                   2384295..2384408,2389498..2389674,2395442..2395609)
FT                   /codon_start=1
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT192269.0
FT                   protein_id=mCP113226.0 isoform=CRA_a"
FT                   /protein_id="EDL26583.1"
FT   CDS             join(2307769..2307831,2309443..2309515,2311222..2311316,
FT                   2330600..2330710,2336074..2336175,2360949..2361032,
FT                   2363489..2363638,2373543..2373731,2377958..2378147,
FT                   2381330..2381568,2383528..2383620,2384295..2384408,
FT                   2389498..2389674,2395442..2395609)
FT                   /codon_start=1
FT                   /gene="Mtm1"
FT                   /locus_tag="mCG_113778"
FT                   /product="X-linked myotubular myopathy gene 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG113778.1 transcript_id=mCT114865.1
FT                   protein_id=mCP80601.1 isoform=CRA_e"
FT                   /protein_id="EDL26587.1"
FT   assembly_gap    2326981..2327000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2368312..2372863
FT                   /estimated_length=4552
FT                   /gap_type="unknown"
FT   assembly_gap    2403439..2403826
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    2419380..2419545
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            2446835..2501275
FT                   /gene="Mtmr1"
FT                   /locus_tag="mCG_113775"
FT                   /note="gene_id=mCG113775.0"
FT   mRNA            join(2446835..2447117,2451846..2451951,2465248..2465323,
FT                   2470309..2470403,2470739..2470846,2473765..2473866,
FT                   2474572..2474655,2475365..2475514,2476346..2476534,
FT                   2482610..2482795,2483801..2484007,2486963..2487055,
FT                   2492794..2492907,2494271..2494447,2498641..2501275)
FT                   /gene="Mtmr1"
FT                   /locus_tag="mCG_113775"
FT                   /product="myotubularin related protein 1"
FT                   /note="gene_id=mCG113775.0 transcript_id=mCT114862.0
FT                   created on 01-MAY-2002"
FT   CDS             join(2446960..2447117,2451846..2451951,2465248..2465323,
FT                   2470309..2470403,2470739..2470846,2473765..2473866,
FT                   2474572..2474655,2475365..2475514,2476346..2476534,
FT                   2482610..2482795,2483801..2484007,2486963..2487055,
FT                   2492794..2492907,2494271..2494447,2498641..2498805)
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /locus_tag="mCG_113775"
FT                   /product="myotubularin related protein 1"
FT                   /note="gene_id=mCG113775.0 transcript_id=mCT114862.0
FT                   protein_id=mCP80598.1"
FT                   /protein_id="EDL26582.1"
FT   gene            complement(2502149..2574955)
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /note="gene_id=mCG113782.0"
FT   mRNA            complement(join(2502149..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532711..2532773,
FT                   2574832..2574955))
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, transcript variant
FT                   mCT114869"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT114869.1
FT                   created on 15-MAY-2002"
FT   mRNA            complement(join(2502151..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532039..2532107,
FT                   2532711..2532773,2574832..2574955))
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, transcript variant
FT                   mCT168955"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT168955.0
FT                   created on 15-MAY-2002"
FT   gene            2503551..>2504852
FT                   /locus_tag="mCG_1034273"
FT                   /note="gene_id=mCG1034273.0"
FT   mRNA            join(2503551..2504323,2504642..>2504852)
FT                   /locus_tag="mCG_1034273"
FT                   /product="mCG1034273"
FT                   /note="gene_id=mCG1034273.0 transcript_id=mCT151977.0
FT                   created on 01-MAY-2002"
FT   CDS             join(2504280..2504323,2504642..2504852)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034273"
FT                   /product="mCG1034273"
FT                   /note="gene_id=mCG1034273.0 transcript_id=mCT151977.0
FT                   protein_id=mCP80556.1"
FT                   /protein_id="EDL26581.1"
FT   mRNA            complement(join(2504703..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532039..2532107,
FT                   2574832..>2574898))
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, transcript variant
FT                   mCT192275"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT192275.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2504764..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532039..2532107,
FT                   2574832..2574898))
FT                   /codon_start=1
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, isoform CRA_c"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT192275.0
FT                   protein_id=mCP113230.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2AP74"
FT                   /db_xref="InterPro:IPR022078"
FT                   /db_xref="MGI:MGI:2177151"
FT                   /db_xref="UniProtKB/TrEMBL:A2AP74"
FT                   /protein_id="EDL26580.1"
FT   CDS             complement(join(2504764..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532711..2532773,
FT                   2574832..2574898))
FT                   /codon_start=1
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT114869.1
FT                   protein_id=mCP80576.1 isoform=CRA_a"
FT                   /protein_id="EDL26578.1"
FT   CDS             complement(join(2504764..2504828,2506103..2506168,
FT                   2511126..2511245,2512391..2512429,2520216..2520281,
FT                   2522613..2522699,2523162..2523233,2532039..2532107,
FT                   2532711..2532773,2574832..2574898))
FT                   /codon_start=1
FT                   /gene="Cd99l2"
FT                   /locus_tag="mCG_113782"
FT                   /product="Cd99 antigen-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG113782.0 transcript_id=mCT168955.0
FT                   protein_id=mCP91716.0 isoform=CRA_b"
FT                   /protein_id="EDL26579.1"
FT                   ETQSAEPPPPEPPRI"
FT   gene            complement(2580646..2580947)
FT                   /pseudo
FT                   /locus_tag="mCG_10150"
FT                   /note="gene_id=mCG10150.2"
FT   mRNA            complement(2580646..2580947)
FT                   /pseudo
FT                   /locus_tag="mCG_10150"
FT                   /note="gene_id=mCG10150.2 transcript_id=mCT10006.2 created
FT                   on 01-MAY-2002"
FT   assembly_gap    2596942..2596961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2638142..2642886
FT                   /locus_tag="mCG_10155"
FT                   /note="gene_id=mCG10155.2"
FT   mRNA            join(2638142..2638422,2640285..2640439,2640665..2640764,
FT                   2642480..2642578)
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, transcript variant mCT168279"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168279.0 created
FT                   on 01-MAY-2002"
FT   mRNA            join(2638149..2638422,2640285..2640439,2640665..2640804,
FT                   2641330..2641504,2641899..2642886)
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, transcript variant mCT10011"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT10011.2 created
FT                   on 01-MAY-2002"
FT   mRNA            join(2638173..2638240,2638396..2638422,2640285..2640439,
FT                   2640665..2640804,2641330..2641504,2641899..2642886)
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, transcript variant mCT168278"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168278.0 created
FT                   on 01-MAY-2002"
FT   mRNA            join(<2638186..2638240,2640285..2640439,2640665..2640804,
FT                   2641330..2641504,2641899..2642879)
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, transcript variant mCT192274"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT192274.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2638186..2638240,2640285..2640439,2640665..2640804,
FT                   2641330..2641504,2641899..2642036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, isoform CRA_d"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT192274.0
FT                   protein_id=mCP113225.0 isoform=CRA_d"
FT                   /protein_id="EDL26577.1"
FT   mRNA            join(2640015..2640439,2640665..2640804,2641330..2641504,
FT                   2641899..2642886)
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, transcript variant mCT168277"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168277.0 created
FT                   on 01-MAY-2002"
FT   CDS             join(2640272..2640439,2640665..2640804,2641330..2641504,
FT                   2641899..2642036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, isoform CRA_b"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168277.0
FT                   protein_id=mCP91234.0 isoform=CRA_b"
FT                   /protein_id="EDL26574.1"
FT   CDS             join(2640290..2640439,2640665..2640764,2642480..2642535)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, isoform CRA_c"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168279.0
FT                   protein_id=mCP91237.0 isoform=CRA_c"
FT                   /protein_id="EDL26576.1"
FT   CDS             join(2640290..2640439,2640665..2640804,2641330..2641504,
FT                   2641899..2642036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, isoform CRA_a"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT10011.2
FT                   protein_id=mCP4136.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q544R9"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR017967"
FT                   /db_xref="MGI:MGI:1098219"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R9"
FT                   /protein_id="EDL26573.1"
FT   CDS             join(2640290..2640439,2640665..2640804,2641330..2641504,
FT                   2641899..2642036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10155"
FT                   /product="mCG10155, isoform CRA_a"
FT                   /note="gene_id=mCG10155.2 transcript_id=mCT168278.0
FT                   protein_id=mCP91233.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544R9"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR017967"
FT                   /db_xref="MGI:MGI:1098219"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R9"
FT                   /protein_id="EDL26575.1"
FT   assembly_gap    2720405..2720518
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            2745903..>2750231
FT                   /gene="Gpr50"
FT                   /locus_tag="mCG_10154"
FT                   /note="gene_id=mCG10154.1"
FT   mRNA            join(2745903..2746138,2748667..>2750231)
FT                   /gene="Gpr50"
FT                   /locus_tag="mCG_10154"
FT                   /product="G-protein-coupled receptor 50"
FT                   /note="gene_id=mCG10154.1 transcript_id=mCT10010.1 created
FT                   on 01-MAY-2002"
FT   CDS             join(2745928..2746138,2748667..2750231)
FT                   /codon_start=1
FT                   /gene="Gpr50"
FT                   /locus_tag="mCG_10154"
FT                   /product="G-protein-coupled receptor 50"
FT                   /note="gene_id=mCG10154.1 transcript_id=mCT10010.1
FT                   protein_id=mCP4135.2"
FT                   /db_xref="GOA:O88495"
FT                   /db_xref="InterPro:IPR000025"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002280"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333877"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88495"
FT                   /protein_id="EDL26572.1"
FT                   DDDSDDSDCSDEMAV"
FT   assembly_gap    2771395..2771636
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    2784013..2786587
FT                   /estimated_length=2575
FT                   /gap_type="unknown"
FT   assembly_gap    2838808..2838827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2856394..2856413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2873221..2873240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2884947..2885414
FT                   /locus_tag="mCG_10153"
FT                   /note="gene_id=mCG10153.0"
FT   mRNA            2884947..2885414
FT                   /locus_tag="mCG_10153"
FT                   /product="mCG10153"
FT                   /note="gene_id=mCG10153.0 transcript_id=mCT10009.0 created
FT                   on 01-MAY-2002"
FT   CDS             2885017..2885364
FT                   /codon_start=1
FT                   /locus_tag="mCG_10153"
FT                   /product="mCG10153"
FT                   /note="gene_id=mCG10153.0 transcript_id=mCT10009.0
FT                   protein_id=mCP4134.1"
FT                   /protein_id="EDL26571.1"
FT                   IRSMPEQTGEK"
FT   assembly_gap    2888207..2888510
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    2892521..2892540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2898038..2906858
FT                   /locus_tag="mCG_10148"
FT                   /note="gene_id=mCG10148.2"
FT   mRNA            join(2898038..2898447,2898584..2898812,2902323..2902387,
FT                   2903015..2903564,2903667..2906858)
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, transcript variant mCT10004"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT10004.2 created
FT                   on 01-MAY-2002"
FT   CDS             join(2898703..2898812,2902323..2902387,2903015..2903157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, isoform CRA_a"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT10004.2
FT                   protein_id=mCP4138.2 isoform=CRA_a"
FT                   /protein_id="EDL26568.1"
FT                   D"
FT   mRNA            join(2898929..2899053,2902323..2902387,2903015..2903564)
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, transcript variant mCT168276"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT168276.0 created
FT                   on 01-MAY-2002"
FT   mRNA            join(2898968..2899180,2902323..2902387,2903015..2903564)
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, transcript variant mCT168275"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT168275.0 created
FT                   on 01-MAY-2002"
FT   CDS             join(2899001..2899053,2902323..2902387,2903015..2903157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, isoform CRA_c"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT168276.0
FT                   protein_id=mCP91239.0 isoform=CRA_c"
FT                   /protein_id="EDL26570.1"
FT   CDS             join(2899029..2899180,2902323..2902387,2903015..2903157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10148"
FT                   /product="mCG10148, isoform CRA_b"
FT                   /note="gene_id=mCG10148.2 transcript_id=mCT168275.0
FT                   protein_id=mCP91238.0 isoform=CRA_b"
FT                   /protein_id="EDL26569.1"
FT                   AWNEGSRQWREGKQD"
FT   assembly_gap    2901642..2902320
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    2903565..2903666
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    2918925..2919005
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    2934682..2934994
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    2938798..2939392
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    2942197..2942755
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    2943462..2943721
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    2949019..2949214
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    2951922..2952708
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    3023011..3023200
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            3046594..>3047676
FT                   /locus_tag="mCG_113783"
FT                   /note="gene_id=mCG113783.0"
FT   mRNA            join(3046594..3046758,3047129..>3047676)
FT                   /locus_tag="mCG_113783"
FT                   /product="mCG113783"
FT                   /note="gene_id=mCG113783.0 transcript_id=mCT114870.1
FT                   created on 01-MAY-2002"
FT   CDS             join(3046695..3046758,3047129..3047676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113783"
FT                   /product="mCG113783"
FT                   /note="gene_id=mCG113783.0 transcript_id=mCT114870.1
FT                   protein_id=mCP80577.1"
FT                   /protein_id="EDL26567.1"
FT   gene            3052149..>3052925
FT                   /locus_tag="mCG_1034268"
FT                   /note="gene_id=mCG1034268.1"
FT   mRNA            3052149..>3052925
FT                   /locus_tag="mCG_1034268"
FT                   /product="mCG1034268"
FT                   /note="gene_id=mCG1034268.1 transcript_id=mCT151972.1
FT                   created on 01-MAY-2002"
FT   CDS             3052620..3052925
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034268"
FT                   /product="mCG1034268"
FT                   /note="gene_id=mCG1034268.1 transcript_id=mCT151972.1
FT                   protein_id=mCP80547.1"
FT                   /protein_id="EDL26566.1"
FT   gene            3053081..3070122
FT                   /gene="Fate1"
FT                   /locus_tag="mCG_11484"
FT                   /note="gene_id=mCG11484.1"
FT   mRNA            join(3053081..3053151,3064239..3064347,3068710..3068816,
FT                   3069093..3069168,3069546..3070122)
FT                   /gene="Fate1"
FT                   /locus_tag="mCG_11484"
FT                   /product="fetal and adult testis expressed 1"
FT                   /note="gene_id=mCG11484.1 transcript_id=mCT11309.1 created
FT                   on 01-MAY-2002"
FT   assembly_gap    3059863..3060501
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   CDS             join(3068725..3068816,3069093..3069168,3069546..3069677)
FT                   /codon_start=1
FT                   /gene="Fate1"
FT                   /locus_tag="mCG_11484"
FT                   /product="fetal and adult testis expressed 1"
FT                   /note="gene_id=mCG11484.1 transcript_id=mCT11309.1
FT                   protein_id=mCP10946.2"
FT                   /protein_id="EDL26565.1"
FT   gene            3084346..3091290
FT                   /gene="Cnga2"
FT                   /locus_tag="mCG_11483"
FT                   /note="gene_id=mCG11483.1"
FT   mRNA            join(3084346..3084484,3084994..3085089,3085928..3086098,
FT                   3087166..3087273,3088787..3088893,3089171..3091290)
FT                   /gene="Cnga2"
FT                   /locus_tag="mCG_11483"
FT                   /product="cyclic nucleotide gated channel alpha 2"
FT                   /note="gene_id=mCG11483.1 transcript_id=mCT11308.1 created
FT                   on 01-MAY-2002"
FT   CDS             join(3084372..3084484,3084994..3085089,3085928..3086098,
FT                   3087166..3087273,3088787..3088893,3089171..3090570)
FT                   /codon_start=1
FT                   /gene="Cnga2"
FT                   /locus_tag="mCG_11483"
FT                   /product="cyclic nucleotide gated channel alpha 2"
FT                   /note="gene_id=mCG11483.1 transcript_id=mCT11308.1
FT                   protein_id=mCP10945.2"
FT                   /db_xref="GOA:Q62398"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR032406"
FT                   /db_xref="MGI:MGI:108040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62398"
FT                   /protein_id="EDL26564.1"
FT   assembly_gap    3108508..3109049
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    3110531..3111370
FT                   /estimated_length=840
FT                   /gap_type="unknown"
FT   assembly_gap    3115891..3115910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3132128..3132352
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    3158647..3163793
FT                   /estimated_length=5147
FT                   /gap_type="unknown"
FT   assembly_gap    3177175..3177194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3187183..3187406
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    3192352..3196073
FT                   /estimated_length=3722
FT                   /gap_type="unknown"
FT   assembly_gap    3206472..3206495
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3210616..3214417
FT                   /estimated_length=3802
FT                   /gap_type="unknown"
FT   assembly_gap    3220236..3220255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3221508..3221527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3240766..3242356
FT                   /estimated_length=1591
FT                   /gap_type="unknown"
FT   assembly_gap    3244064..3244826
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   assembly_gap    3245171..3245264
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    3247883..3253508
FT                   /estimated_length=5626
FT                   /gap_type="unknown"
FT   assembly_gap    3256084..3259688
FT                   /estimated_length=3605
FT                   /gap_type="unknown"
FT   assembly_gap    3261407..3261993
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    3271389..3271748
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    3274534..3274969
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    3289399..3289418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3292434..>3293381
FT                   /gene="Magea4"
FT                   /locus_tag="mCG_114260"
FT                   /note="gene_id=mCG114260.0"
FT   mRNA            <3292434..>3293381
FT                   /gene="Magea4"
FT                   /locus_tag="mCG_114260"
FT                   /product="melanoma antigen, family A, 4"
FT                   /note="gene_id=mCG114260.0 transcript_id=mCT115357.0
FT                   created on 01-MAY-2002"
FT   CDS             3292434..3293381
FT                   /codon_start=1
FT                   /gene="Magea4"
FT                   /locus_tag="mCG_114260"
FT                   /product="melanoma antigen, family A, 4"
FT                   /note="gene_id=mCG114260.0 transcript_id=mCT115357.0
FT                   protein_id=mCP80548.0"
FT                   /protein_id="EDL26563.1"
FT   assembly_gap    3295407..3295819
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    3312426..3313274
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    3322608..3322627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3327410..3345216)
FT                   /gene="Gabre"
FT                   /locus_tag="mCG_3694"
FT                   /note="gene_id=mCG3694.2"
FT   mRNA            complement(join(3327410..3328242,3328495..3328694,
FT                   3328824..3328976,3332856..3332993,3334154..3334236,
FT                   3334930..3335150,3339641..3339708,3340097..3341547,
FT                   3345058..3345216))
FT                   /gene="Gabre"
FT                   /locus_tag="mCG_3694"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit epsilon"
FT                   /note="gene_id=mCG3694.2 transcript_id=mCT3182.2 created on
FT                   01-MAY-2002"
FT   CDS             complement(join(3327862..3328242,3328495..3328694,
FT                   3328824..3328976,3332856..3332993,3334154..3334236,
FT                   3334930..3335150,3339641..3339708,3340097..3341547,
FT                   3345058..3345113))
FT                   /codon_start=1
FT                   /gene="Gabre"
FT                   /locus_tag="mCG_3694"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit epsilon"
FT                   /note="gene_id=mCG3694.2 transcript_id=mCT3182.2
FT                   protein_id=mCP20424.2"
FT                   /protein_id="EDL26562.1"
FT   assembly_gap    3376582..3376601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3430610..3432543
FT                   /estimated_length=1934
FT                   /gap_type="unknown"
FT   gene            complement(3449134..>3450652)
FT                   /locus_tag="mCG_61352"
FT                   /note="gene_id=mCG61352.1"
FT   mRNA            complement(3449134..>3450652)
FT                   /locus_tag="mCG_61352"
FT                   /product="mCG61352"
FT                   /note="gene_id=mCG61352.1 transcript_id=mCT61535.1 created
FT                   on 01-MAY-2002"
FT   CDS             complement(3449675..3450652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61352"
FT                   /product="mCG61352"
FT                   /note="gene_id=mCG61352.1 transcript_id=mCT61535.1
FT                   protein_id=mCP34725.1"
FT                   /protein_id="EDL26561.1"
FT   assembly_gap    3457746..3457953
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    3461558..3461764
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    3468197..3477021
FT                   /estimated_length=8825
FT                   /gap_type="unknown"
FT   assembly_gap    3485382..3485448
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3494861..3495901
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    3497235..3497254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3502779..3702315)
FT                   /gene="Gabra3"
FT                   /locus_tag="mCG_51849"
FT                   /note="gene_id=mCG51849.2"
FT   mRNA            complement(join(3502779..3505082,3515249..3515460,
FT                   3521578..3521730,3529664..3529807,3546269..3546351,
FT                   3571135..3571355,3581361..3581428,3605186..3605307,
FT                   3617758..3617932,3702135..3702315))
FT                   /gene="Gabra3"
FT                   /locus_tag="mCG_51849"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit alpha 3"
FT                   /note="gene_id=mCG51849.2 transcript_id=mCT52032.2 created
FT                   on 01-MAY-2002"
FT   CDS             complement(join(3504747..3505082,3515249..3515460,
FT                   3521578..3521730,3529664..3529807,3546269..3546351,
FT                   3571135..3571355,3581361..3581428,3605186..3605307,
FT                   3617758..3617897))
FT                   /codon_start=1
FT                   /gene="Gabra3"
FT                   /locus_tag="mCG_51849"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit alpha 3"
FT                   /note="gene_id=mCG51849.2 transcript_id=mCT52032.2
FT                   protein_id=mCP32427.2"
FT                   /protein_id="EDL26560.1"
FT   assembly_gap    3510127..3510196
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    3531382..3531401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3539713..3539732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3594954..3594973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3610154..3610173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3638619..3638638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3668154..3668283
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3671616..3671778
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    3682836..3682855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3702334..3702612
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    3707361..3707380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3712390..3712505
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    3722665..3722684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3725608..3732249
FT                   /estimated_length=6642
FT                   /gap_type="unknown"
FT   assembly_gap    3734457..3734492
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    3742796..3742815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3749934..3749953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3755311..3756017
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    3764700..3765052
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    3765823..3766033
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    3775551..3775601
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    3776572..3777232
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    3779446..3780139
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    3788543..3793897
FT                   /estimated_length=5355
FT                   /gap_type="unknown"
FT   assembly_gap    3797507..3797526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3798669..3800566
FT                   /estimated_length=1898
FT                   /gap_type="unknown"
FT   assembly_gap    3813997..3814016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3842792..3842811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3846662..3846681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3862710..3862729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3870888..3884262
FT                   /gene="Gabrq"
FT                   /locus_tag="mCG_114256"
FT                   /note="gene_id=mCG114256.0"
FT   mRNA            join(3870888..3871056,3873002..3873090,3877294..3877334,
FT                   3878818..3879038,3880811..3880893,3881375..3881509,
FT                   3881874..3882026,3882519..3882775,3883438..3884262)
FT                   /gene="Gabrq"
FT                   /locus_tag="mCG_114256"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit theta"
FT                   /note="gene_id=mCG114256.0 transcript_id=mCT115348.1
FT                   created on 01-MAY-2002"
FT   CDS             join(3870908..3871056,3873002..3873090,3877294..3877334,
FT                   3878818..3879038,3880811..3880893,3881375..3881509,
FT                   3881874..3882026,3882519..3882775,3883438..3884199)
FT                   /codon_start=1
FT                   /gene="Gabrq"
FT                   /locus_tag="mCG_114256"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit theta"
FT                   /note="gene_id=mCG114256.0 transcript_id=mCT115348.1
FT                   protein_id=mCP80542.1"
FT                   /protein_id="EDL26559.1"
FT   assembly_gap    3873411..3873513
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    3877124..3877291
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    3880141..3880507
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    3897091..3897276
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    3903049..3903068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3930387..3930406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3950702..3955542)
FT                   /gene="Cetn2"
FT                   /locus_tag="mCG_1245"
FT                   /note="gene_id=mCG1245.1"
FT   mRNA            complement(join(3950702..3951430,3951977..3952114,
FT                   3953402..3953530,3953825..3953983,3955450..3955542))
FT                   /gene="Cetn2"
FT                   /locus_tag="mCG_1245"
FT                   /product="centrin 2"
FT                   /note="gene_id=mCG1245.1 transcript_id=mCT8510.2 created on
FT                   01-MAY-2002"
FT   CDS             complement(join(3951341..3951430,3951977..3952114,
FT                   3953402..3953530,3953825..3953983,3955450..3955452))
FT                   /codon_start=1
FT                   /gene="Cetn2"
FT                   /locus_tag="mCG_1245"
FT                   /product="centrin 2"
FT                   /note="gene_id=mCG1245.1 transcript_id=mCT8510.2
FT                   protein_id=mCP5012.2"
FT                   /db_xref="GOA:Q9R1K9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1347085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R1K9"
FT                   /protein_id="EDL26558.1"
FT                   RIMKKTSLY"
FT   gene            3955657..3983882
FT                   /gene="Nsdhl"
FT                   /locus_tag="mCG_1246"
FT                   /note="gene_id=mCG1246.2"
FT   mRNA            join(3955657..3955829,3963430..3963546,3966764..3966922,
FT                   3974518..3974664,3978196..3978324,3980425..3980567,
FT                   3981690..3981792,3982635..3983882)
FT                   /gene="Nsdhl"
FT                   /locus_tag="mCG_1246"
FT                   /product="NAD(P) dependent steroid dehydrogenase-like"
FT                   /note="gene_id=mCG1246.2 transcript_id=mCT8511.2 created on
FT                   01-MAY-2002"
FT   CDS             join(3963472..3963546,3966764..3966922,3974518..3974664,
FT                   3978196..3978324,3980425..3980567,3981690..3981792,
FT                   3982635..3982967)
FT                   /codon_start=1
FT                   /gene="Nsdhl"
FT                   /locus_tag="mCG_1246"
FT                   /product="NAD(P) dependent steroid dehydrogenase-like"
FT                   /note="gene_id=mCG1246.2 transcript_id=mCT8511.2
FT                   protein_id=mCP5013.1"
FT                   /db_xref="GOA:Q3US15"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1099438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3US15"
FT                   /protein_id="EDL26557.1"
FT   assembly_gap    3969773..3969792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3969953..3969972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3988677..4007702
FT                   /locus_tag="mCG_140171"
FT                   /note="gene_id=mCG140171.0"
FT   mRNA            join(3988677..3988716,4007181..4007228,4007628..4007702)
FT                   /locus_tag="mCG_140171"
FT                   /product="mCG140171"
FT                   /note="gene_id=mCG140171.0 transcript_id=mCT168299.0
FT                   created on 01-MAY-2002"
FT   CDS             join(3988707..3988716,4007181..4007228,4007628..4007671)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140171"
FT                   /product="mCG140171"
FT                   /note="gene_id=mCG140171.0 transcript_id=mCT168299.0
FT                   protein_id=mCP91236.0"
FT                   /protein_id="EDL26556.1"
FT   gene            <4012717..4057688
FT                   /gene="Zfp185"
FT                   /locus_tag="mCG_1244"
FT                   /note="gene_id=mCG1244.3"
FT   mRNA            join(<4012717..4012877,4023143..4023220,4023390..4023513,
FT                   4023846..4023911,4024644..4024682,4024777..4024854,
FT                   4025359..4025445,4026125..4026208,4027096..4027179,
FT                   4027516..4027554,4028683..4028766,4029481..4029567,
FT                   4038548..4038736,4041847..4041957,4042803..4042883,
FT                   4044482..4044550,4046976..4047078,4054990..4055088,
FT                   4055818..4057688)
FT                   /gene="Zfp185"
FT                   /locus_tag="mCG_1244"
FT                   /product="zinc finger protein 185, transcript variant
FT                   mCT192273"
FT                   /note="gene_id=mCG1244.3 transcript_id=mCT192273.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4012741..4012877,4023143..4023220,4023390..4023513,
FT                   4023846..4023911,4024644..4024682,4024777..4024854,
FT                   4025359..4025445,4026125..4026208,4027096..4027179,
FT                   4027513..4027554,4028683..4028766,4029481..4029567,
FT                   4038548..4038736,4041847..4041957,4042803..4042883,
FT                   4044482..4044550,4046976..4047078,4054990..4055088,
FT                   4055818..4057655)
FT                   /gene="Zfp185"
FT                   /locus_tag="mCG_1244"
FT                   /product="zinc finger protein 185, transcript variant
FT                   mCT8509"
FT                   /note="gene_id=mCG1244.3 transcript_id=mCT8509.2 created on
FT                   01-MAY-2002"
FT   assembly_gap    4015957..4015976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<4023175..4023220,4023390..4023513,4023846..4023911,
FT                   4024644..4024682,4024777..4024854,4025359..4025445,
FT                   4026125..4026208,4027096..4027179,4027516..4027554,
FT                   4028683..4028766,4029481..4029567,4038548..4038736,
FT                   4041847..4041957,4042803..4042883,4044482..4044550,
FT                   4046976..4047078,4054990..4055088)
FT                   /codon_start=1
FT                   /gene="Zfp185"
FT                   /locus_tag="mCG_1244"
FT                   /product="zinc finger protein 185, isoform CRA_a"
FT                   /note="gene_id=mCG1244.3 transcript_id=mCT192273.0
FT                   protein_id=mCP113232.0 isoform=CRA_a"
FT                   /protein_id="EDL26554.1"
FT   CDS             join(4023187..4023220,4023390..4023513,4023846..4023911,
FT                   4024644..4024682,4024777..4024854,4025359..4025445,
FT                   4026125..4026208,4027096..4027179,4027513..4027554,
FT                   4028683..4028766,4029481..4029567,4038548..4038736,
FT                   4041847..4041957,4042803..4042883,4044482..4044550,
FT                   4046976..4047078,4054990..4055088)
FT                   /codon_start=1
FT                   /gene="Zfp185"
FT                   /locus_tag="mCG_1244"
FT                   /product="zinc finger protein 185, isoform CRA_b"
FT                   /note="gene_id=mCG1244.3 transcript_id=mCT8509.2
FT                   protein_id=mCP5014.2 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8W8"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR030637"
FT                   /db_xref="MGI:MGI:108095"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8W8"
FT                   /protein_id="EDL26555.1"
FT   gene            complement(4060133..>4063222)
FT                   /locus_tag="mCG_58254"
FT                   /note="gene_id=mCG58254.2"
FT   mRNA            complement(join(4060133..4060472,4061308..>4063222))
FT                   /locus_tag="mCG_58254"
FT                   /product="mCG58254"
FT                   /note="gene_id=mCG58254.2 transcript_id=mCT58437.2 created
FT                   on 01-MAY-2002"
FT   CDS             complement(4061366..4063222)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58254"
FT                   /product="mCG58254"
FT                   /note="gene_id=mCG58254.2 transcript_id=mCT58437.2
FT                   protein_id=mCP27883.1"
FT                   /protein_id="EDL26553.1"
FT   assembly_gap    4086018..4086037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4091322..4094585
FT                   /locus_tag="mCG_1034264"
FT                   /note="gene_id=mCG1034264.2"
FT   mRNA            join(4091322..4093482,4093539..4094585)
FT                   /locus_tag="mCG_1034264"
FT                   /product="mCG1034264"
FT                   /note="gene_id=mCG1034264.2 transcript_id=mCT151968.2
FT                   created on 10-JUN-2003"
FT   CDS             4091357..4092757
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034264"
FT                   /product="mCG1034264"
FT                   /note="gene_id=mCG1034264.2 transcript_id=mCT151968.2
FT                   protein_id=mCP80595.1"
FT                   /protein_id="EDL26552.1"
FT                   SHPKPKTK"
FT   assembly_gap    4093508..4093527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4100350..>4107037)
FT                   /locus_tag="mCG_114266"
FT                   /note="gene_id=mCG114266.1"
FT   mRNA            complement(join(4100350..4101113,4104266..4104366,
FT                   4105218..4105335,4106962..>4107037))
FT                   /locus_tag="mCG_114266"
FT                   /product="mCG114266"
FT                   /note="gene_id=mCG114266.1 transcript_id=mCT115362.1
FT                   created on 01-MAY-2002"
FT   CDS             complement(join(4101001..4101113,4104266..4104366,
FT                   4105218..4105335,4106962..>4107037))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114266"
FT                   /product="mCG114266"
FT                   /note="gene_id=mCG114266.1 transcript_id=mCT115362.1
FT                   protein_id=mCP80580.0"
FT                   /protein_id="EDL26551.1"
FT   assembly_gap    4101264..4103377
FT                   /estimated_length=2114
FT                   /gap_type="unknown"
FT   assembly_gap    4107360..4107379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4110137..4120862)
FT                   /locus_tag="mCG_114264"
FT                   /note="gene_id=mCG114264.1"
FT   mRNA            complement(join(4110137..4111025,4111119..4111214,
FT                   4113242..4113340,4114701..4114800,4115616..4115733,
FT                   4117112..4117146,4118025..4118094,4118788..4118924,
FT                   4120822..4120862))
FT                   /locus_tag="mCG_114264"
FT                   /product="mCG114264, transcript variant mCT115361"
FT                   /note="gene_id=mCG114264.1 transcript_id=mCT115361.1
FT                   created on 01-MAY-2002"
FT   mRNA            complement(join(4110810..4111025,4111119..4111214,
FT                   4113242..4113340,4114701..4114800,4115616..4115733,
FT                   4117112..4117146,4118025..4118094,4118803..4118924,
FT                   4120822..>4120859))
FT                   /locus_tag="mCG_114264"
FT                   /product="mCG114264, transcript variant mCT192268"
FT                   /note="gene_id=mCG114264.1 transcript_id=mCT192268.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4110969..4111025,4111119..4111214,
FT                   4113242..4113340,4114701..4114800,4115616..4115733,
FT                   4117112..4117146,4118025..4118094,4118803..>4118911))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114264"
FT                   /product="mCG114264, isoform CRA_b"
FT                   /note="gene_id=mCG114264.1 transcript_id=mCT192268.0
FT                   protein_id=mCP113231.0 isoform=CRA_b"
FT                   /protein_id="EDL26550.1"
FT                   DVLFS"
FT   CDS             complement(join(4110969..4111025,4111119..4111214,
FT                   4113242..4113340,4114701..4114800,4115616..4115733,
FT                   4117112..4117146,4118025..4118094,4118788..4118893))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114264"
FT                   /product="mCG114264, isoform CRA_a"
FT                   /note="gene_id=mCG114264.1 transcript_id=mCT115361.1
FT                   protein_id=mCP80557.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR006888"
FT                   /db_xref="MGI:MGI:109506"
FT                   /db_xref="UniProtKB/TrEMBL:Q78PE0"
FT                   /protein_id="EDL26549.1"
FT                   VLFS"
FT   gene            complement(4131903..>4138412)
FT                   /locus_tag="mCG_114263"
FT                   /note="gene_id=mCG114263.1"
FT   mRNA            complement(join(4131903..4132313,4132409..4132513,
FT                   4133725..4133823,4135211..4135310,4135987..4136107,
FT                   4137141..4137175,4138343..>4138412))
FT                   /locus_tag="mCG_114263"
FT                   /product="mCG114263"
FT                   /note="gene_id=mCG114263.1 transcript_id=mCT115360.1
FT                   created on 01-MAY-2002"
FT   CDS             complement(join(4132239..4132313,4132409..4132513,
FT                   4133725..4133823,4135211..4135310,4135987..4136107,
FT                   4137141..4137175,4138343..>4138410))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114263"
FT                   /product="mCG114263"
FT                   /note="gene_id=mCG114263.1 transcript_id=mCT115360.1
FT                   protein_id=mCP80554.1"
FT                   /protein_id="EDL26548.1"
FT   assembly_gap    4138429..4231193
FT                   /estimated_length=92765
FT                   /gap_type="unknown"
FT   gene            4235351..4237122
FT                   /gene="F8a"
FT                   /locus_tag="mCG_114257"
FT                   /note="gene_id=mCG114257.0"
FT   mRNA            4235351..4237122
FT                   /gene="F8a"
FT                   /locus_tag="mCG_114257"
FT                   /product="factor 8-associated gene A"
FT                   /note="gene_id=mCG114257.0 transcript_id=mCT115350.0
FT                   created on 01-MAY-2002"
FT   CDS             4235649..4236794
FT                   /codon_start=1
FT                   /gene="F8a"
FT                   /locus_tag="mCG_114257"
FT                   /product="factor 8-associated gene A"
FT                   /note="gene_id=mCG114257.0 transcript_id=mCT115350.0
FT                   protein_id=mCP80543.1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="MGI:MGI:95474"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JJQ6"
FT                   /protein_id="EDL26547.1"
CO   join(complement(AAHY01212401.1:1..3366),gap(20),AAHY01212402.1:1..2275,
CO   gap(332),complement(AAHY01212403.1:1..9866),gap(20),AAHY01212404.1:1..1441,
CO   gap(20),complement(AAHY01212405.1:1..7947),gap(20),AAHY01212406.1:1..1343,
CO   gap(1066),complement(AAHY01212407.1:1..1714),gap(1818),
CO   complement(AAHY01212408.1:1..1059),gap(20),
CO   complement(AAHY01212409.1:1..35474),gap(192),
CO   complement(AAHY01212410.1:1..6244),gap(383),
CO   complement(AAHY01212411.1:1..4164),gap(211),
CO   complement(AAHY01212412.1:1..28964),gap(733),AAHY01212413.1:1..9268,
CO   gap(24),complement(AAHY01212414.1:1..3145),gap(20),AAHY01212415.1:1..4355,
CO   gap(20),complement(AAHY01212416.1:1..4105),gap(20),AAHY01212417.1:1..3705,
CO   gap(44),complement(AAHY01212418.1:1..4368),gap(899),
CO   complement(AAHY01212419.1:1..7181),gap(27),
CO   complement(AAHY01212420.1:1..1705),gap(20),
CO   complement(AAHY01212421.1:1..3150),gap(65),AAHY01212422.1:1..2203,gap(20),
CO   AAHY01212423.1:1..13071,gap(20),complement(AAHY01212424.1:1..11593),
CO   gap(20),complement(AAHY01212425.1:1..14708),gap(20),AAHY01212426.1:1..925,
CO   gap(363),complement(AAHY01212427.1:1..23750),gap(20),
CO   complement(AAHY01212428.1:1..5019),gap(26),AAHY01212429.1:1..9369,gap(71),
CO   complement(AAHY01212430.1:1..2850),gap(20),
CO   complement(AAHY01212431.1:1..12484),gap(20),AAHY01212432.1:1..12464,
CO   gap(20),complement(AAHY01212433.1:1..22198),gap(34),AAHY01212434.1:1..6818,
CO   gap(58),complement(AAHY01212435.1:1..4282),gap(20),
CO   complement(AAHY01212436.1:1..3377),gap(1017),
CO   complement(AAHY01212437.1:1..1761),gap(20),
CO   complement(AAHY01212438.1:1..11218),gap(175),
CO   complement(AAHY01212439.1:1..1686),gap(5247),
CO   complement(AAHY01212440.1:1..18660),gap(80),AAHY01212441.1:1..2166,gap(20),
CO   complement(AAHY01212442.1:1..9698),gap(20),AAHY01212443.1:1..10089,
CO   gap(979),AAHY01212444.1:1..5865,gap(1163),AAHY01212445.1:1..1722,gap(20),
CO   AAHY01212446.1:1..6279,gap(20),complement(AAHY01212447.1:1..2112),gap(20),
CO   AAHY01212448.1:1..683,gap(2008),complement(AAHY01212449.1:1..794),
CO   gap(2702),complement(AAHY01212450.1:1..11464),gap(587),
CO   complement(AAHY01212451.1:1..6511),gap(494),AAHY01212452.1:1..8426,
CO   gap(291),AAHY01212453.1:1..3961,gap(64),AAHY01212454.1:1..15405,gap(46),
CO   AAHY01212455.1:1..1526,gap(20),AAHY01212456.1:1..22118,gap(173),
CO   complement(AAHY01212457.1:1..3824),gap(118),AAHY01212458.1:1..1955,
CO   gap(183),AAHY01212459.1:1..3925,gap(234),AAHY01212460.1:1..5557,gap(330),
CO   AAHY01212461.1:1..3480,gap(46),complement(AAHY01212462.1:1..2773),gap(20),
CO   AAHY01212463.1:1..12782,gap(248),AAHY01212464.1:1..6218,gap(20),
CO   AAHY01212465.1:1..17159,gap(20),complement(AAHY01212466.1:1..3168),gap(20),
CO   AAHY01212467.1:1..20795,gap(20),complement(AAHY01212468.1:1..19386),
CO   gap(33),complement(AAHY01212469.1:1..3283),gap(20),
CO   complement(AAHY01212470.1:1..13408),gap(20),
CO   complement(AAHY01212471.1:1..11667),gap(20),
CO   complement(AAHY01212472.1:1..8025),gap(20),
CO   complement(AAHY01212473.1:1..2199),gap(3578),
CO   complement(AAHY01212474.1:1..4957),gap(20),
CO   complement(AAHY01212475.1:1..28729),gap(30),
CO   complement(AAHY01212476.1:1..4144),gap(187),
CO   complement(AAHY01212477.1:1..20365),gap(20),AAHY01212478.1:1..1482,
CO   gap(866),complement(AAHY01212479.1:1..5923),gap(704),
CO   complement(AAHY01212480.1:1..54426),gap(362),AAHY01212481.1:1..8300,
CO   gap(1011),AAHY01212482.1:1..20446,gap(611),AAHY01212483.1:1..6173,gap(20),
CO   complement(AAHY01212484.1:1..18637),gap(20),
CO   complement(AAHY01212485.1:1..9994),gap(20),
CO   complement(AAHY01212486.1:1..13372),gap(160),
CO   complement(AAHY01212487.1:1..62112),gap(153),
CO   complement(AAHY01212488.1:1..16672),gap(83),AAHY01212489.1:1..7562,gap(89),
CO   AAHY01212490.1:1..5703,gap(157),complement(AAHY01212491.1:1..1880),gap(38),
CO   AAHY01212492.1:1..3037,gap(20),complement(AAHY01212493.1:1..13057),gap(20),
CO   AAHY01212494.1:1..3490,gap(20),AAHY01212495.1:1..34776,gap(63),
CO   AAHY01212496.1:1..11853,gap(20),complement(AAHY01212497.1:1..2442),gap(20),
CO   AAHY01212498.1:1..7794,gap(409),complement(AAHY01212499.1:1..2006),gap(52),
CO   AAHY01212500.1:1..4420,gap(278),AAHY01212501.1:1..6577,gap(20),
CO   complement(AAHY01212502.1:1..12280),gap(626),AAHY01212503.1:1..1195,
CO   gap(20),AAHY01212504.1:1..19276,gap(184),AAHY01212505.1:1..1586,gap(476),
CO   AAHY01212506.1:1..4033,gap(20),AAHY01212507.1:1..2817,gap(149),
CO   AAHY01212508.1:1..6176,gap(20),complement(AAHY01212509.1:1..8323),gap(20),
CO   complement(AAHY01212510.1:1..4783),gap(7545),
CO   complement(AAHY01212511.1:1..1058),gap(1223),
CO   complement(AAHY01212512.1:1..37513),gap(193),
CO   complement(AAHY01212513.1:1..4395),gap(27),AAHY01212514.1:1..17476,
CO   gap(427),AAHY01212515.1:1..18137,gap(20),AAHY01212516.1:1..18575,gap(199),
CO   AAHY01212517.1:1..6226,gap(20),AAHY01212518.1:1..7979,gap(20),
CO   complement(AAHY01212519.1:1..2162),gap(101),
CO   complement(AAHY01212520.1:1..1281),gap(10635),AAHY01212521.1:1..14468,
CO   gap(676),AAHY01212522.1:1..15196,gap(1425),AAHY01212523.1:1..2617,
CO   gap(2530),complement(AAHY01212524.1:1..3679),gap(157),
CO   AAHY01212525.1:1..6765,gap(20),AAHY01212526.1:1..4031,gap(46),
CO   AAHY01212527.1:1..12102,gap(20),complement(AAHY01212528.1:1..21780),
CO   gap(1336),complement(AAHY01212529.1:1..7716),gap(20),
CO   AAHY01212530.1:1..5444,gap(45),complement(AAHY01212531.1:1..15091),gap(20),
CO   complement(AAHY01212532.1:1..13900),gap(437),
CO   complement(AAHY01212533.1:1..11158),gap(20),
CO   complement(AAHY01212534.1:1..1719),gap(160),
CO   complement(AAHY01212535.1:1..8500),gap(423),
CO   complement(AAHY01212536.1:1..1155),gap(428),AAHY01212537.1:1..5876,gap(20),
CO   complement(AAHY01212538.1:1..18276),gap(18919),AAHY01212539.1:1..18077,
CO   gap(20),AAHY01212540.1:1..55378,gap(20),
CO   complement(AAHY01212541.1:1..20781),gap(3495),
CO   complement(AAHY01212542.1:1..6033),gap(20),AAHY01212543.1:1..2123,
CO   gap(47130),complement(AAHY01212544.1:1..8494),gap(1791),
CO   complement(AAHY01212545.1:1..2053),gap(547),
CO   complement(AAHY01212546.1:1..5155),gap(519),
CO   complement(AAHY01212547.1:1..10591),gap(20),
CO   complement(AAHY01212548.1:1..11906),gap(20),
CO   complement(AAHY01212549.1:1..75231),gap(4423),
CO   complement(AAHY01212550.1:1..85445),gap(272),AAHY01212551.1:1..1698,
CO   gap(20),complement(AAHY01212552.1:1..1527),gap(20),
CO   complement(AAHY01212553.1:1..1027),gap(722),
CO   complement(AAHY01212554.1:1..10880),gap(20),
CO   complement(AAHY01212555.1:1..13317),gap(20),AAHY01212556.1:1..30096,
CO   gap(220),AAHY01212557.1:1..9247,gap(478),AAHY01212558.1:1..2497,gap(20),
CO   complement(AAHY01212559.1:1..8700),gap(3021),
CO   complement(AAHY01212560.1:1..3461),gap(98),
CO   complement(AAHY01212561.1:1..3255),gap(230),AAHY01212562.1:1..9078,gap(20),
CO   AAHY01212563.1:1..1354,gap(612),AAHY01212564.1:1..1716,gap(405),
CO   AAHY01212565.1:1..7010,gap(258),complement(AAHY01212566.1:1..3125),
CO   gap(3212),complement(AAHY01212567.1:1..4691),gap(152),
CO   complement(AAHY01212568.1:1..3284),gap(20),
CO   complement(AAHY01212569.1:1..17526),gap(20),
CO   complement(AAHY01212570.1:1..1306),gap(227),
CO   complement(AAHY01212571.1:1..14533),gap(20),
CO   complement(AAHY01212572.1:1..19667),gap(20),AAHY01212573.1:1..2456,gap(20),
CO   AAHY01212574.1:1..9749,gap(8000),complement(AAHY01212575.1:1..2360),
CO   gap(324),complement(AAHY01212576.1:1..16379),gap(96),
CO   AAHY01212577.1:1..4441,gap(69),AAHY01212578.1:1..3334,gap(881),
CO   AAHY01212579.1:1..7339,gap(20),AAHY01212580.1:1..1885,gap(20),
CO   AAHY01212581.1:1..1512,gap(80),AAHY01212582.1:1..2506,gap(20),
CO   complement(AAHY01212583.1:1..8447),gap(20),AAHY01212584.1:1..1481,gap(261),
CO   AAHY01212585.1:1..6004,gap(78),AAHY01212586.1:1..4168,gap(29),
CO   AAHY01212587.1:1..1231,gap(372),complement(AAHY01212588.1:1..2898),gap(20),
CO   complement(AAHY01212589.1:1..10989),gap(20),
CO   complement(AAHY01212590.1:1..17240),gap(20),AAHY01212591.1:1..1273,
CO   gap(352),complement(AAHY01212592.1:1..14848),gap(324),
CO   complement(AAHY01212593.1:1..9646),gap(20),
CO   complement(AAHY01212594.1:1..979),gap(4325),
CO   complement(AAHY01212595.1:1..846),gap(195),
CO   complement(AAHY01212596.1:1..6443),gap(20),
CO   complement(AAHY01212597.1:1..6807),gap(20),
CO   complement(AAHY01212598.1:1..9383),gap(20),AAHY01212599.1:1..1164,gap(797),
CO   complement(AAHY01212600.1:1..1181),gap(628),
CO   complement(AAHY01212601.1:1..1012),gap(751),
CO   complement(AAHY01212602.1:1..2620),gap(20),
CO   complement(AAHY01212603.1:1..4827),gap(75),
CO   complement(AAHY01212604.1:1..12472),gap(859),
CO   complement(AAHY01212605.1:1..12330),gap(342),
CO   complement(AAHY01212606.1:1..1461),gap(80),AAHY01212607.1:1..1527,gap(740),
CO   complement(AAHY01212608.1:1..1603),gap(123),
CO   complement(AAHY01212609.1:1..121772),gap(20),
CO   complement(AAHY01212610.1:1..74239),gap(20),
CO   complement(AAHY01212611.1:1..41311),gap(4552),
CO   complement(AAHY01212612.1:1..30575),gap(388),
CO   complement(AAHY01212613.1:1..15553),gap(166),AAHY01212614.1:1..177396,
CO   gap(20),complement(AAHY01212615.1:1..123443),gap(114),
CO   complement(AAHY01212616.1:1..50876),gap(242),
CO   complement(AAHY01212617.1:1..12376),gap(2575),
CO   complement(AAHY01212618.1:1..52220),gap(20),AAHY01212619.1:1..17566,
CO   gap(20),AAHY01212620.1:1..16807,gap(20),
CO   complement(AAHY01212621.1:1..14966),gap(304),AAHY01212622.1:1..4010,
CO   gap(20),AAHY01212623.1:1..9101,gap(679),complement(AAHY01212624.1:1..1244),
CO   gap(102),complement(AAHY01212625.1:1..15258),gap(81),
CO   complement(AAHY01212626.1:1..15676),gap(313),
CO   complement(AAHY01212627.1:1..3803),gap(595),AAHY01212628.1:1..2804,
CO   gap(559),AAHY01212629.1:1..706,gap(260),complement(AAHY01212630.1:1..5297),
CO   gap(196),complement(AAHY01212631.1:1..2707),gap(787),
CO   complement(AAHY01212632.1:1..70302),gap(190),
CO   complement(AAHY01212633.1:1..36662),gap(639),
CO   complement(AAHY01212634.1:1..48006),gap(542),
CO   complement(AAHY01212635.1:1..1481),gap(840),
CO   complement(AAHY01212636.1:1..4520),gap(20),
CO   complement(AAHY01212637.1:1..16217),gap(225),
CO   complement(AAHY01212638.1:1..26294),gap(5147),AAHY01212639.1:1..13381,
CO   gap(20),complement(AAHY01212640.1:1..9988),gap(224),AAHY01212641.1:1..4945,
CO   gap(3722),AAHY01212642.1:1..10398,gap(24),
CO   complement(AAHY01212643.1:1..4120),gap(3802),
CO   complement(AAHY01212644.1:1..5818),gap(20),AAHY01212645.1:1..1252,gap(20),
CO   complement(AAHY01212646.1:1..19238),gap(1591),AAHY01212647.1:1..1707,
CO   gap(763),AAHY01212648.1:1..344,gap(94),AAHY01212649.1:1..2618,gap(5626),
CO   AAHY01212650.1:1..2575,gap(3605),complement(AAHY01212651.1:1..1718),
CO   gap(587),complement(AAHY01212652.1:1..9395),gap(360),
CO   complement(AAHY01212653.1:1..2785),gap(436),
CO   complement(AAHY01212654.1:1..14429),gap(20),
CO   complement(AAHY01212655.1:1..5988),gap(413),
CO   complement(AAHY01212656.1:1..16606),gap(849),
CO   complement(AAHY01212657.1:1..9333),gap(20),
CO   complement(AAHY01212658.1:1..53954),gap(20),
CO   complement(AAHY01212659.1:1..54008),gap(1934),
CO   complement(AAHY01212660.1:1..25202),gap(208),
CO   complement(AAHY01212661.1:1..3604),gap(207),
CO   complement(AAHY01212662.1:1..6432),gap(8825),
CO   complement(AAHY01212663.1:1..8360),gap(67),
CO   complement(AAHY01212664.1:1..9412),gap(1041),
CO   complement(AAHY01212665.1:1..1333),gap(20),
CO   complement(AAHY01212666.1:1..12872),gap(70),
CO   complement(AAHY01212667.1:1..21185),gap(20),
CO   complement(AAHY01212668.1:1..8311),gap(20),
CO   complement(AAHY01212669.1:1..55221),gap(20),
CO   complement(AAHY01212670.1:1..15180),gap(20),
CO   complement(AAHY01212671.1:1..28445),gap(20),
CO   complement(AAHY01212672.1:1..29515),gap(130),
CO   complement(AAHY01212673.1:1..3332),gap(163),
CO   complement(AAHY01212674.1:1..11057),gap(20),AAHY01212675.1:1..19478,
CO   gap(279),AAHY01212676.1:1..4748,gap(20),AAHY01212677.1:1..5009,gap(116),
CO   AAHY01212678.1:1..10159,gap(20),complement(AAHY01212679.1:1..2923),
CO   gap(6642),AAHY01212680.1:1..2207,gap(36),AAHY01212681.1:1..8303,gap(20),
CO   complement(AAHY01212682.1:1..7118),gap(20),
CO   complement(AAHY01212683.1:1..5357),gap(707),
CO   complement(AAHY01212684.1:1..8682),gap(353),AAHY01212685.1:1..770,gap(211),
CO   complement(AAHY01212686.1:1..9517),gap(51),
CO   complement(AAHY01212687.1:1..970),gap(661),AAHY01212688.1:1..2213,gap(694),
CO   complement(AAHY01212689.1:1..8403),gap(5355),
CO   complement(AAHY01212690.1:1..3609),gap(20),
CO   complement(AAHY01212691.1:1..1142),gap(1898),
CO   complement(AAHY01212692.1:1..13430),gap(20),AAHY01212693.1:1..28775,
CO   gap(20),complement(AAHY01212694.1:1..3850),gap(20),
CO   complement(AAHY01212695.1:1..16028),gap(20),
CO   complement(AAHY01212696.1:1..10681),gap(103),AAHY01212697.1:1..3610,
CO   gap(168),complement(AAHY01212698.1:1..2849),gap(367),
CO   AAHY01212699.1:1..16583,gap(186),complement(AAHY01212700.1:1..5772),
CO   gap(20),complement(AAHY01212701.1:1..27318),gap(20),
CO   complement(AAHY01212702.1:1..39366),gap(20),AAHY01212703.1:1..160,gap(20),
CO   complement(AAHY01212704.1:1..45984),gap(20),
CO   complement(AAHY01212705.1:1..70041),gap(20),AAHY01212706.1:1..7470,gap(20),
CO   complement(AAHY01212707.1:1..7736),gap(2114),
CO   complement(AAHY01212708.1:1..3982),gap(20),
CO   complement(AAHY01212709.1:1..31049),gap(92765),
CO   complement(AAHY01212710.1:1..8804))