Dbfetch

ID   CH466623; SV 2; linear; genomic DNA; CON; MUS; 4270007 BP.
XX
AC   CH466623;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009736760 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4270007
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-4270007
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-4270007
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; f7c0f181694eb0b67205d170ff824800.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000220.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000020634; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020635; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020652; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020654; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020668; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020671; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096199; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019555; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019556; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019566; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019573; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019578; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019523; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019532; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019533; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019538; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019540; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019542; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019545; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019493; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019502; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019503; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019508; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019510; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019515; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019497; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019498; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019507; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019513; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019520; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019303; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019304; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019313; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019314; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019319; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019321; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019323; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019326; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019947; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019948; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019956; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019957; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019964; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019966; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018858; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018859; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018869; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018874; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018876; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018878; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019274; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019275; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019284; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019285; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019290; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019292; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019294; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019297; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019387; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019388; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019397; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019398; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019403; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019407; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019410; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019378; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019379; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019387; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019388; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019394; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019396; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019398; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019401; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019458; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019459; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019468; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019469; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019476; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019478; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019481; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019411; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019412; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019421; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019422; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019427; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019429; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019431; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019434; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019985; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019986; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019995; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019996; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020001; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020003; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018624; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018625; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018635; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018640; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018642; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018644; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018910; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018911; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018920; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018925; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018927; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018929; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018932; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021001; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111154; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179139; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034310; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034311; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034373; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034380; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034386; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034388; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034391; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034402; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0034241; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034242; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034305; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034312; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034318; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034321; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0034335; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0034227; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034228; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034290; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034297; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034303; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034305; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034307; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0034318; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034236; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034237; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034300; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034313; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034316; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034319; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034330; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034017; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034018; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034081; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034088; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034094; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034098; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034101; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034737; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034738; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034799; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034806; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034812; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034814; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034817; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034828; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033921; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033922; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033986; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033993; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033999; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034001; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034004; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034015; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0033930; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033931; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0033994; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034007; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034011; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034014; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0034025; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0034070; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034071; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034134; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034141; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034147; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034150; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034153; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0034164; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0034067; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034068; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034130; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034137; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034146; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034149; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0034160; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0034209; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034210; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034280; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034286; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034291; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0034302; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034075; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034076; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034138; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034145; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034151; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034153; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034156; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034167; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034784; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034785; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034848; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034855; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034861; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034866; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034877; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033611; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033613; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033675; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033683; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033689; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033691; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033694; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0033705; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033490; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033491; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033555; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033567; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033569; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033572; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033582; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70976350.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4270007
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3779..5278
FT                   /estimated_length=1500
FT                   /gap_type="unknown"
FT   assembly_gap    8727..9060
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   gene            10172..14621
FT                   /pseudo
FT                   /locus_tag="mCG_1027344"
FT                   /note="gene_id=mCG1027344.0"
FT   mRNA            join(10172..10284,11343..11490,12716..12858,13504..13687,
FT                   14380..14621)
FT                   /pseudo
FT                   /locus_tag="mCG_1027344"
FT                   /note="gene_id=mCG1027344.0 transcript_id=mCT145048.0
FT                   created on 22-APR-2002"
FT   assembly_gap    20714..20733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    39789..39808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<72068..>77991)
FT                   /locus_tag="mCG_66400"
FT                   /note="gene_id=mCG66400.1"
FT   mRNA            complement(join(<72068..72180,77880..>77991))
FT                   /locus_tag="mCG_66400"
FT                   /product="mCG66400"
FT                   /note="gene_id=mCG66400.1 transcript_id=mCT66583.1 created
FT                   on 22-APR-2002"
FT   CDS             complement(join(72068..72180,77880..77991))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66400"
FT                   /product="mCG66400"
FT                   /note="gene_id=mCG66400.1 transcript_id=mCT66583.1
FT                   protein_id=mCP29681.1"
FT                   /protein_id="EDL01408.1"
FT                   /translation="MRYDHPLDNGLKRYCTDSETVEQSAVTLLECRGWTSGVHYHRLDF
FT                   GDNKQVTGKESDVDADSSLLFSGRETQFP"
FT   gene            <99204..128485
FT                   /locus_tag="mCG_140587"
FT                   /note="gene_id=mCG140587.0"
FT   mRNA            join(<99204..99367,103653..103829,105022..105101,
FT                   106795..106912,112831..112963,113348..113451,
FT                   113878..114002,120696..120796,121392..121503,
FT                   123175..123327,124779..124923,126761..126976,
FT                   127767..128485)
FT                   /locus_tag="mCG_140587"
FT                   /product="mCG140587"
FT                   /note="gene_id=mCG140587.0 transcript_id=mCT170144.0
FT                   created on 21-JUN-2002"
FT   assembly_gap    118942..119116
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   CDS             join(<121396..121503,123175..123327,124779..124923,
FT                   126761..126976,127767..127978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140587"
FT                   /product="mCG140587"
FT                   /note="gene_id=mCG140587.0 transcript_id=mCT170144.0
FT                   protein_id=mCP93076.0"
FT                   /protein_id="EDL01407.1"
FT                   /translation="FHPGCAYVCMVHRQDSFPALQKLSSGSYKIGSKAIKIAWALNKGV
FT                   KTEYKQFWDVDLGVTYIPWEKVKVDDLDGFAEGSMIDQETVNIPVAPAVPAVSLVPPAF
FT                   PVLMPVPPPGFSPIPPPPFLRASFNPSQPLPALVQPPLSMTPEAVKDVGFGSLVLPDGS
FT                   VAGSLAPSTLPAGNVFNPPSKAEPEEKVPHLIEHQIPSGENTRPVIPNDIPSSAAMLAQ
FT                   PPGASSTSVILCVQRPNVSSNSEILGFCPANVSNSAAIMGAQPPNSLNNSRILGI"
FT   assembly_gap    152568..152587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(156220..157334)
FT                   /pseudo
FT                   /locus_tag="mCG_1027321"
FT                   /note="gene_id=mCG1027321.1"
FT   mRNA            complement(156220..157334)
FT                   /pseudo
FT                   /locus_tag="mCG_1027321"
FT                   /note="gene_id=mCG1027321.1 transcript_id=mCT145025.1
FT                   created on 22-APR-2002"
FT   gene            162922..177799
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /note="gene_id=mCG7948.2"
FT   mRNA            join(162922..163352,164708..164835,165014..165083,
FT                   165452..165535,168945..169001,174775..174861,
FT                   177290..177799)
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, transcript variant
FT                   mCT170148"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT170148.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(163338..163352,164708..164835,165014..165083,
FT                   165452..165535,166257..166432,168945..169001,
FT                   174775..174861,177162..>177367)
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, transcript variant
FT                   mCT180223"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT180223.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(164033..164124,164708..164835,165014..165083,
FT                   165452..165535,166257..166432,168945..169001,
FT                   174775..174861,177162..177508)
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, transcript variant
FT                   mCT7166"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT7166.2 created on
FT                   12-FEB-2003"
FT   mRNA            join(164033..164124,164708..164835,165014..165083,
FT                   165452..165535,168945..169001,174775..174861,
FT                   177162..>177422)
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, transcript variant
FT                   mCT180222"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT180222.0 created
FT                   on 12-FEB-2003"
FT   CDS             join(168994..169001,174775..174861,177162..177489)
FT                   /codon_start=1
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, isoform CRA_d"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT7166.2
FT                   protein_id=mCP7124.1 isoform=CRA_d"
FT                   /protein_id="EDL01406.1"
FT                   /translation="MNAIPSYTVVRSNPPSPTPKINENQTTQLEISKKRTGWWMAADGQ
FT                   ESTQQHLLFQPVTPPPLLISTFSLLGSFTGVCNNTRKQATREKALAWMKTDSLERCKAM
FT                   SGYTTKGNYSHMRECSKSCNLKTVFGCPLVGLLCKL"
FT   CDS             join(168994..169001,174775..174861,177162..>177422)
FT                   /codon_start=1
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, isoform CRA_b"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT180222.0
FT                   protein_id=mCP103144.0 isoform=CRA_b"
FT                   /protein_id="EDL01404.1"
FT                   /translation="MNAIPSYTVVRSNPPSPTPKINENQTTQLEISKKRTGWWMAADGQ
FT                   ESTQQHLLFQPVTPPPLLISTFSLLGSFTGVCNNTRKQATREKALAWMKTDSLERCKAM
FT                   SGYTTKGNYSHMRE"
FT   CDS             join(168994..169001,174775..174861,177162..>177367)
FT                   /codon_start=1
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, isoform CRA_c"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT180223.0
FT                   protein_id=mCP103145.0 isoform=CRA_c"
FT                   /protein_id="EDL01405.1"
FT                   /translation="MNAIPSYTVVRSNPPSPTPKINENQTTQLEISKKRTGWWMAADGQ
FT                   ESTQQHLLFQPVTPPPLLISTFSLLGSFTGVCNNTRKQATREKALAWMKTDSLER"
FT   CDS             join(168994..169001,174775..174861,177290..177326)
FT                   /codon_start=1
FT                   /gene="1700012B15Rik"
FT                   /locus_tag="mCG_7948"
FT                   /product="RIKEN cDNA 1700012B15, isoform CRA_a"
FT                   /note="gene_id=mCG7948.2 transcript_id=mCT170148.0
FT                   protein_id=mCP93077.1 isoform=CRA_a"
FT                   /protein_id="EDL01403.1"
FT                   /translation="MNAIPSYTVVRSNPPSPTPKINENQTTQLEIRGLQQHKEASNP"
FT   gene            complement(174853..237442)
FT                   /gene="Rab10"
FT                   /locus_tag="mCG_7949"
FT                   /note="gene_id=mCG7949.2"
FT   mRNA            complement(join(174853..177293,180035..180136,
FT                   180692..180781,184290..184428,192112..192172,
FT                   236741..237442))
FT                   /gene="Rab10"
FT                   /locus_tag="mCG_7949"
FT                   /product="RAB10, member RAS oncogene family"
FT                   /note="gene_id=mCG7949.2 transcript_id=mCT7167.1 created on
FT                   24-APR-2002"
FT   CDS             complement(join(177210..177293,180035..180136,
FT                   180692..180781,184290..184428,192112..192172,
FT                   236741..236867))
FT                   /codon_start=1
FT                   /gene="Rab10"
FT                   /locus_tag="mCG_7949"
FT                   /product="RAB10, member RAS oncogene family"
FT                   /note="gene_id=mCG7949.2 transcript_id=mCT7167.1
FT                   protein_id=mCP7119.1"
FT                   /db_xref="GOA:Q4FJL0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJL0"
FT                   /protein_id="EDL01402.1"
FT                   /translation="MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGID
FT                   FKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWL
FT                   RNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAF
FT                   LTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC"
FT   assembly_gap    203202..203221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    241077..241198
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    245218..245440
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    247759..247778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    248747..249878
FT                   /estimated_length=1132
FT                   /gap_type="unknown"
FT   assembly_gap    258540..263053
FT                   /estimated_length=4514
FT                   /gap_type="unknown"
FT   assembly_gap    268219..268238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    269309..269482
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            complement(270799..284209)
FT                   /locus_tag="mCG_146996"
FT                   /note="gene_id=mCG146996.0"
FT   mRNA            complement(join(270799..271930,283918..284209))
FT                   /locus_tag="mCG_146996"
FT                   /product="mCG146996"
FT                   /note="gene_id=mCG146996.0 transcript_id=mCT187259.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(271385..271567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146996"
FT                   /product="mCG146996"
FT                   /note="gene_id=mCG146996.0 transcript_id=mCT187259.0
FT                   protein_id=mCP109656.0"
FT                   /protein_id="EDL01401.1"
FT                   /translation="MSRKGGVLSPPASLSHILDLTSILISELDFVASSSQTKINLLGFL
FT                   LPLTTETMAHLSCDL"
FT   assembly_gap    275286..275425
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            292393..431074
FT                   /locus_tag="mCG_140115"
FT                   /note="gene_id=mCG140115.0"
FT   mRNA            join(292393..294586,314562..314663,315145..315267,
FT                   316633..316751,317473..317589,328740..328848,
FT                   329491..329663,329846..331123)
FT                   /locus_tag="mCG_140115"
FT                   /product="mCG140115, transcript variant mCT168147"
FT                   /note="gene_id=mCG140115.0 transcript_id=mCT168147.0
FT                   created on 22-APR-2002"
FT   CDS             join(293036..294586,314562..314663,315145..315267,
FT                   316633..316751,317473..317589,328740..328848,
FT                   329491..329663,329846..329942)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140115"
FT                   /product="mCG140115, isoform CRA_a"
FT                   /note="gene_id=mCG140115.0 transcript_id=mCT168147.0
FT                   protein_id=mCP91095.0 isoform=CRA_a"
FT                   /db_xref="GOA:O35066"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107979"
FT                   /db_xref="PDB:5JVM"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35066"
FT                   /protein_id="EDL01397.1"
FT                   /translation="MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLR
FT                   NPRAAPGELPKTFTFDAVYDASSKQADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKT
FT                   YTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKEPGK
FT                   RLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQARAVGSTHMNEVSSRSHAIFVI
FT                   TVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAGPNAAGGPATQPTAGGGSGSGSASG
FT                   SASSGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIM
FT                   VATLGPASHSYDESLSTLRFANRAKNIKNKPRVNEDPKDTLLREFQEEIARLKAQLEKK
FT                   GMLGKRPRRKSSRRKKAVSAPAGYPEGSVIEAWVAEEEDDNNNNHHPPQPILEAALEKN
FT                   MENYLQDQKERLEEEKAAIQDDRSLVSEEKQKLLEEKEKMLEDLRREQQATELLAAKYK
FT                   AMESKLLIGGRNIMDHTNEQQKMLELKRQEIAEQKRREREMQQEMLLRDEETMELRGTY
FT                   SSLQQEVEVKTKKLKKLYAKLQAVKAEIQDQHEEYIRVRQDLEEAQNEQTRELKLKYLI
FT                   IENFIPPEEKNKIMNRLFLDCEEEQWRFQPLVPAGVNNSQMKKRPTSAVGYKRPISQYA
FT                   RVAMAMGSHPRYRAENIMFLELDVSPPAIFEMEFSHDQEQDPRVLHMERLMRLDSFLER
FT                   PSTTKVRKSRSWCQSPQRMPPPSTAHASMTSVPLHPATVVDHD"
FT   assembly_gap    295480..295547
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    313950..314116
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    317366..317385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    322644..322676
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(330940..>353711)
FT                   /locus_tag="mCG_145864"
FT                   /note="gene_id=mCG145864.0"
FT   mRNA            complement(join(330940..333768,334758..334981,
FT                   353566..>353711))
FT                   /locus_tag="mCG_145864"
FT                   /product="mCG145864, transcript variant mCT185972"
FT                   /note="gene_id=mCG145864.0 transcript_id=mCT185972.0
FT                   created on 03-JUL-2003"
FT   mRNA            complement(join(332365..333768,334701..334981,
FT                   353566..>353709))
FT                   /locus_tag="mCG_145864"
FT                   /product="mCG145864, transcript variant mCT189398"
FT                   /note="gene_id=mCG145864.0 transcript_id=mCT189398.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(332833..>333198)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145864"
FT                   /product="mCG145864, isoform CRA_a"
FT                   /note="gene_id=mCG145864.0 transcript_id=mCT185972.0
FT                   protein_id=mCP107726.0 isoform=CRA_a"
FT                   /protein_id="EDL01399.1"
FT                   /translation="DPATSRSPVSRVSYIECSAPCTGEHKHTHKHTHIIPQAGAPLLTT
FT                   PWAQPLAAVLKWGVLCYKTVRVVDQTMWSQCVQVMNGVTHAASSTNDRELRGRSLNAQF
FT                   TSGDFYTQLLFQRKPFL"
FT   CDS             complement(332833..>333198)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145864"
FT                   /product="mCG145864, isoform CRA_a"
FT                   /note="gene_id=mCG145864.0 transcript_id=mCT189398.0
FT                   protein_id=mCP110384.0 isoform=CRA_a"
FT                   /protein_id="EDL01400.1"
FT                   /translation="DPATSRSPVSRVSYIECSAPCTGEHKHTHKHTHIIPQAGAPLLTT
FT                   PWAQPLAAVLKWGVLCYKTVRVVDQTMWSQCVQVMNGVTHAASSTNDRELRGRSLNAQF
FT                   TSGDFYTQLLFQRKPFL"
FT   assembly_gap    340105..340311
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   mRNA            join(353654..353889,353944..354277,369541..369656,
FT                   378742..378850,384142..384289,396649..396725,
FT                   401892..402015,411845..412008,417037..417133,
FT                   421134..421239,423625..424336,427379..429155,
FT                   429360..431074)
FT                   /locus_tag="mCG_140115"
FT                   /product="mCG140115, transcript variant mCT168148"
FT                   /note="gene_id=mCG140115.0 transcript_id=mCT168148.0
FT                   created on 22-APR-2002"
FT   CDS             join(353777..353889,353944..354277,369541..369656,
FT                   378742..378850,384142..384289,396649..396725,
FT                   401892..402015,411845..412008,417037..417133,
FT                   421134..421239,423625..424336,427379..429155,
FT                   429360..429772)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140115"
FT                   /product="mCG140115, isoform CRA_b"
FT                   /note="gene_id=mCG140115.0 transcript_id=mCT168148.0
FT                   protein_id=mCP91096.0 isoform=CRA_b"
FT                   /protein_id="EDL01398.1"
FT                   /translation="MGRPPSCARARCGDTGSAGAWLTAAACRSDAEAGGARKGHVTTEA
FT                   ACTVRTQYGSGGSSGSGSRTGHPVEPPTPATARLRGRLLAELLLGSDFPFLPPFLAPRE
FT                   KQCRAQQARERSRSRGTEASQSVRTDMREKGRRKKGRTWAEAAKTVLEKYPNTPMSHKE
FT                   ILQVIQREGLKEIRQVIKLLLVMIVGTSPLACLNAMLHTNSRGEEGIFYKVPGRMGVYT
FT                   LKKDVPDGVKELSEGSEESSDGQSDSQSSENSSSSDGGSNKEGRKSRWKRKGCPSPTIP
FT                   ASKVISPSQKHSKKALKQALKQQQQKKKQQQCRPSMSISNQHLSLKTVKAASDSVPAKP
FT                   GQMKRTKCADIDVETPDSILVNTNLRALINKHTFSVLPGDCQQRLLLLLPEVDRQVGPD
FT                   GLMKLNGSALNNEFFTSAAQGWKERLSEGEFTPEMQVRIRQEIEKEKKVELWKEQFFEN
FT                   YYGQSSGLSLEDSQKLTASSSDPKAKKTPAEQPKSILPSEASPVRIVPVVPQSECKEEA
FT                   VQIPSPSQKEENQDEARPDSKSPEPVLASASNTNELITMKPIKSPKDEGLLEQKPVACA
FT                   EQESEKENHVTTTSRNNKSENQEALAISPSKSKNAGLQKPIIKPVAEASPLNPDMKMPP
FT                   ATVTDQIQESLKRKSSLTDEEATSSWEKRPRITENRQHQQPFQVSPQPFLNRGDRVQVR
FT                   KVPPLKIPVSRISPMLFSTSQVSPRARFPISITSPYRTGARTLADIKAKAQLVKAQKAA
FT                   AAAAAAAAAAASVGGTIPGPGPGGGQSPREGGERKIAGGGSAGSDPVSTNGKGPTLELA
FT                   GTGSRGGTRELLPCGPQPETNMPGQAQPPGISGAQLQQTSSVPTGLASSGACTSVPLPA
FT                   HIEISNSEKPNLHKATATAASPCHLQDPRSCRLEKALSPTGPPLISGASTVYFVADGTV
FT                   EPKAGSNKNAPKPSALAKTTAPAPLDMTSSPVTTASLEKLPVPQISGTATSTGSAPSSS
FT                   TLPAASSLKTPGTSANMNGPISRTSSSIPANNPLVTQLLQGKDVPLEQILPKPLTKIEM
FT                   KTVPLTTKEEKGIGIFPGISVMESSSREEVNGRQAHLAIPQLGKPLQSKQLSQVPRPVF
FT                   TAKDRKDPCIDTHQYREGLSKTTQDQLFQTLIQRAQRQSVLSFVPPSQFNFAHSGFHLE
FT                   DISTSQKFMLGFAGRRTSKPAMAGHYLLNISTYGRGTENIKRTHSVNPDDRFCLSSPTE
FT                   ALRMGHADYKNTTGEISSKEDESDEDRVGDEQEPISVKEEPWASQSSGRHPHHGEASST
FT                   NDCLASKNDSPTHQPLLLPPLQTPKLYGSPTQIGPSYRGMINVSTSSDMDHNSAIPGSQ
FT                   VSSNVGDVMSFSVTVTTIPASQAMNPSSHGQTIPVQTFPDDNSIEDTPSKCYCRLKAMI
FT                   MCKGCGAFCHDDCIGPSKLCVSCLVVR"
FT   assembly_gap    374250..374332
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    377151..377520
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    395905..396048
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    397454..397934
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    398661..398855
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            <433186..434195
FT                   /locus_tag="mCG_1027314"
FT                   /note="gene_id=mCG1027314.1"
FT   mRNA            join(<433186..433728,433775..433856,433942..434195)
FT                   /locus_tag="mCG_1027314"
FT                   /product="mCG1027314"
FT                   /note="gene_id=mCG1027314.1 transcript_id=mCT145018.1
FT                   created on 21-APR-2002"
FT   CDS             join(<433822..433856,433942..434143)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027314"
FT                   /product="mCG1027314"
FT                   /note="gene_id=mCG1027314.1 transcript_id=mCT145018.1
FT                   protein_id=mCP89798.0"
FT                   /protein_id="EDL01396.1"
FT                   /translation="GLTVKAQIISKEILTYLAQAIFPSLVIRFVQTGLVNAKFLSFAFL
FT                   KELLPLELRVCTEKLVSMPFNKSYFFTNKEKSF"
FT   assembly_gap    439173..439347
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            complement(449158..450737)
FT                   /pseudo
FT                   /locus_tag="mCG_7953"
FT                   /note="gene_id=mCG7953.2"
FT   mRNA            complement(join(449158..449844,449924..450737))
FT                   /pseudo
FT                   /locus_tag="mCG_7953"
FT                   /note="gene_id=mCG7953.2 transcript_id=mCT7156.2 created on
FT                   21-APR-2002"
FT   assembly_gap    476583..476602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    491000..491162
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            <500330..>709552
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /note="gene_id=mCG48625.3"
FT   mRNA            join(<500330..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,702607..702647,
FT                   707656..707691,709141..709402)
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, transcript variant mCT189400"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT189400.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<500330..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,702607..702629)
FT                   /codon_start=1
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, isoform CRA_c"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT189400.0
FT                   protein_id=mCP110386.0 isoform=CRA_c"
FT                   /protein_id="EDL01393.1"
FT                   /translation="GAGSLRVPGGEAARAGAVPFAAGAAPGPEWAPPPQSLLAASAASA
FT                   EGAGLEEAAAAGEPRDGPSAPAGKRARMIEEGGNKRKTMAEKRQLFIEMRAQNFDVIRL
FT                   STYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQ
FT                   LNKRLPSTHQISVEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRY
FT                   IFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQQKKIMLNMF
FT                   LDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQ
FT                   NCFWRGHASGAHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKP
FT                   LDLAHLVPPRPLTNMNDTVVSHMSSGVPTPTKRLQYSQDMPNLLADEHALIASYVARLQ
FT                   HCTRVLDSPSRLDEEHRLIARYAARLAAEAGNMTRPPTDASFNFDANKQQRQLIAELEN
FT                   KNREILQEIQRLRLEHEQASQPTPEKAQQNPMLLAELRLLRQRKDELEQRMSALQESRR
FT                   ELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGVGG
FT                   DVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSGEVTPVS"
FT   mRNA            join(<500369..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576327,614645..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,709181..>709552)
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, transcript variant mCT48808"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT48808.2 created
FT                   on 14-FEB-2003"
FT   CDS             join(<500369..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576327,614645..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,709181..>709552)
FT                   /codon_start=1
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, isoform CRA_e"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT48808.2
FT                   protein_id=mCP29682.2 isoform=CRA_e"
FT                   /protein_id="EDL01395.1"
FT                   /translation="RAGAVPFAAGAAPGPEWAPPPQSLLAASAASAEGAGLEEAAAAGE
FT                   PRDGPSAPAGKRARMIEEGGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQ
FT                   KRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQISV
FT                   EQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMM
FT                   FGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQQKKIMLNMFLDTMMADPPPQCL
FT                   VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHS
FT                   NQHQMKEHSSWVTHFLSSITSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAH
FT                   LVPPRPLTNMNDTVVSHMSSGVPTPTKRLQYSQDMPNLLADEHALIASYVARLQHCTRV
FT                   LDSPSRLDEEHRLIARYAARLAAEAGNMTRPPTDASFNFDANKQQRQLIAELENKNREI
FT                   LQEIQRLRLEHEQASQPTPEKAQQNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQ
FT                   LEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGVGGDVQEA
FT                   FAQGTRRNLRNDLLVAADSITNTMSSLVKELHSGKVFPPEAHSCPSFCCTPGPSLQAAR
FT                   LTQPPERGAKPMGSGEGLPEAAAGGPPACTSIRIPPSGHGLISASGIYQEMEKNRKSPE
FT                   PVCVPSGTWPAWRALPSPSVCTCSSFLPSTFNNIFCLCK"
FT   mRNA            join(<500420..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   682085..682105,700624..700783,701588..701677,
FT                   702607..702647,707656..707691,709141..709540)
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, transcript variant mCT179734"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT179734.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(<500420..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   682085..682105,700624..700783,701588..701677,
FT                   702607..702629)
FT                   /codon_start=1
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, isoform CRA_a"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT179734.0
FT                   protein_id=mCP102656.0 isoform=CRA_a"
FT                   /protein_id="EDL01391.1"
FT                   /translation="APPPQSLLAASAASAEGAGLEEAAAAGEPRDGPSAPAGKRARMIE
FT                   EGGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAF
FT                   RDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMVAAYDS
FT                   EGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTA
FT                   VFEGPSFGYTEHAVRTCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFH
FT                   PVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAHSNQHQMKEHSSWKSPAKK
FT                   LSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHLVPPRPLTNMNDTVVSHMSSGVPTP
FT                   TKRLQYSQDMPNLLADEHALIASYVARLQHCTRVLDSPSRLDEEHRLIARYAARLAAEA
FT                   GNMTRPPTDASFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQN
FT                   PMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHT
FT                   SPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAAD
FT                   SITNTMSSLVKELHSGEVTPVS"
FT   mRNA            join(<500479..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,709141..709433)
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, transcript variant mCT189399"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT189399.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<500480..500544,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,709141..709316)
FT                   /codon_start=1
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, isoform CRA_b"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT189399.0
FT                   protein_id=mCP110385.0 isoform=CRA_b"
FT                   /protein_id="EDL01392.1"
FT                   /translation="EEAAAAGEPRDGPSAPAGKRARMIEEGGNKRKTMAEKRQLFIEMR
FT                   AQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLE
FT                   TVISSIYYQLNKRLPSTHQISVEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCG
FT                   GKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQ
FT                   QKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQ
FT                   QCHNYQLCQNCFWRGHASGAHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPSREPPHP
FT                   VFPEQPEKPLDLAHLVPPRPLTNMNDTVVSHMSSGVPTPTKRLQYSQDMPNLLADEHAL
FT                   IASYVARLQHCTRVLDSPSRLDEEHRLIARYAARLAAEAGNMTRPPTDASFNFDANKQQ
FT                   RQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPMLLAELRLLRQRKDELEQR
FT                   MSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGP
FT                   QDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSGAEAEEQAGTEK
FT                   TREGLPPRGTFLSVFLLHTWTKLAGCQTHSTSRERSQAYGKWGGTA"
FT   mRNA            join(<500938..501129,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,707656..707691,
FT                   709141..709421)
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, transcript variant mCT180271"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT180271.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(<501128..501129,517101..517168,519832..519912,
FT                   524575..524788,545503..545588,560745..560899,
FT                   571829..571934,576135..576301,614643..614767,
FT                   646317..646394,660553..660642,662874..662961,
FT                   676414..676499,677459..677572,679800..679896,
FT                   700624..700783,701588..701677,707656..707660)
FT                   /codon_start=1
FT                   /gene="Dtnb"
FT                   /locus_tag="mCG_48625"
FT                   /product="dystrobrevin, beta, isoform CRA_d"
FT                   /note="gene_id=mCG48625.3 transcript_id=mCT180271.0
FT                   protein_id=mCP103193.0 isoform=CRA_d"
FT                   /protein_id="EDL01394.1"
FT                   /translation="KMIEEGGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFV
FT                   QKRCNLHLVDIWNMIEAFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQIS
FT                   VEQSISLLLNFMVAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLM
FT                   MFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQQKKIMLNMFLDTMMADPPPQC
FT                   LVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHASGAH
FT                   SNQHQMKEHSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHLVPPRPL
FT                   TNMNDTVVSHMSSGVPTPTKRLQYSQDMPNLLADEHALIASYVARLQHCTRVLDSPSRL
FT                   DEEHRLIARYAARLAAEAGNMTRPPTDASFNFDANKQQRQLIAELENKNREILQEIQRL
FT                   RLEHEQASQPTPEKAQQNPMLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKL
FT                   LKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHGPQDSLSGVGGDVQEAFAQGTRR
FT                   NLRNDLLVAADSITNTMSSLVKELHSG"
FT   assembly_gap    513227..513246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    532407..532426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    546817..546836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    593074..593218
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    647697..647716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    652638..652714
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    670173..670318
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    686873..686925
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    709895..710059
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    718828..718888
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            complement(731433..>733729)
FT                   /locus_tag="mCG_1027341"
FT                   /note="gene_id=mCG1027341.1"
FT   mRNA            complement(join(731433..731848,732019..732474,
FT                   732664..733168,733382..>733729))
FT                   /locus_tag="mCG_1027341"
FT                   /product="mCG1027341"
FT                   /note="gene_id=mCG1027341.1 transcript_id=mCT145045.1
FT                   created on 19-APR-2002"
FT   CDS             complement(join(731795..731848,732019..>732168))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027341"
FT                   /product="mCG1027341"
FT                   /note="gene_id=mCG1027341.1 transcript_id=mCT145045.1
FT                   protein_id=mCP89810.1"
FT                   /protein_id="EDL01390.1"
FT                   /translation="AQASTPPTLVLDILDRGCSIHSNREGYPHGTYSHISVPYLSGLKT
FT                   PSSRVVWGSLSYICRLCLTQTG"
FT   gene            734068..842110
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /note="gene_id=mCG7959.2"
FT   mRNA            join(734068..734293,763162..763395,777377..777481,
FT                   793762..794029,800610..800653,801057..801203,
FT                   823403..823618,823850..824008,824438..824545,
FT                   824746..824902,825158..825307,825425..825469,
FT                   827053..827132,827447..827559,827724..827907,
FT                   828137..828221,829218..829363,830050..830140,
FT                   830335..830483,831809..831894,833262..833331,
FT                   834434..834552,835275..842110)
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, transcript variant
FT                   mCT7147"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT7147.3 created on
FT                   24-NOV-2004"
FT   mRNA            join(734068..734293,763162..766964)
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, transcript variant
FT                   mCT194593"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT194593.0 created
FT                   on 24-NOV-2004"
FT   assembly_gap    734596..736031
FT                   /estimated_length=1436
FT                   /gap_type="unknown"
FT   assembly_gap    737445..737464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    740088..740339
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    759247..759266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    762577..762596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(763333..763395,777377..777481,793762..794029,
FT                   800610..800653,801057..801203,823403..823618,
FT                   823850..824008,824438..824545,824746..824902,
FT                   825158..825307,825425..825469,827053..827132,
FT                   827447..827559,827724..827907,828137..828221,
FT                   829218..829363,830050..830140,830335..830483,
FT                   831809..831894,833262..833331,834434..834552,
FT                   835275..835416)
FT                   /codon_start=1
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, isoform CRA_a"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT7147.3
FT                   protein_id=mCP7127.3 isoform=CRA_a"
FT                   /protein_id="EDL01387.1"
FT                   /translation="MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKV
FT                   GRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPA
FT                   AGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSR
FT                   GRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNA
FT                   VEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYE
FT                   DGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKL
FT                   MPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQN
FT                   KQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTT
FT                   EKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCF
FT                   LECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDP
FT                   WNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSL
FT                   FDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEW
FT                   GPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFEN
FT                   VVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQ
FT                   ECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYT
FT                   DVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV"
FT   CDS             763333..763407
FT                   /codon_start=1
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, isoform CRA_c"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT194593.0
FT                   protein_id=mCP115622.0 isoform=CRA_c"
FT                   /protein_id="EDL01389.1"
FT                   /translation="MPSSGPGDTSSSSLEREDDRKVSN"
FT   assembly_gap    772015..772034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    782996..783068
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    792453..792472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    814367..814464
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    818676..819559
FT                   /estimated_length=884
FT                   /gap_type="unknown"
FT   mRNA            join(819603..819720,823403..823618,823850..824008,
FT                   824438..824545,824746..824902,825158..825307,
FT                   825425..825469,827053..827132,827447..827559,
FT                   827724..827907,828137..828221,829218..829363,
FT                   830050..830140,830335..830483,831809..831894,
FT                   833262..833331,834434..834552,835275..842110)
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, transcript variant
FT                   mCT194592"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT194592.0 created
FT                   on 24-NOV-2004"
FT   CDS             join(823433..823618,823850..824008,824438..824545,
FT                   824746..824902,825158..825307,825425..825469,
FT                   827053..827132,827447..827559,827724..827907,
FT                   828137..828221,829218..829363,830050..830140,
FT                   830335..830483,831809..831894,833262..833331,
FT                   834434..834552,835275..835416)
FT                   /codon_start=1
FT                   /gene="Dnmt3a"
FT                   /locus_tag="mCG_7959"
FT                   /product="DNA methyltransferase 3A, isoform CRA_b"
FT                   /note="gene_id=mCG7959.2 transcript_id=mCT194592.0
FT                   protein_id=mCP115621.0 isoform=CRA_b"
FT                   /protein_id="EDL01388.1"
FT                   /translation="MNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGD
FT                   AGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRW
FT                   VMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPA
FT                   CHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEA
FT                   AAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTL
FT                   EHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECV
FT                   DLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKV
FT                   YPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKI
FT                   MYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHD
FT                   ARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLP
FT                   GMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDI
FT                   LWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV"
FT   assembly_gap    850505..850524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    855244..855664
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   gene            complement(859171..859760)
FT                   /pseudo
FT                   /locus_tag="mCG_7950"
FT                   /note="gene_id=mCG7950.1"
FT   mRNA            complement(859171..859760)
FT                   /pseudo
FT                   /locus_tag="mCG_7950"
FT                   /note="gene_id=mCG7950.1 transcript_id=mCT7160.2 created on
FT                   19-APR-2002"
FT   assembly_gap    870914..870933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            882692..888369
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /note="gene_id=mCG7946.1"
FT   mRNA            join(882692..882789,885815..885999,887632..888369)
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, transcript variant
FT                   mCT7164"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT7164.1 created on
FT                   12-FEB-2003"
FT   mRNA            join(882693..882789,885845..885999,887632..888357)
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, transcript variant
FT                   mCT180352"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180352.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(<882693..882789,884562..884672,885845..885999,
FT                   887632..888314)
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, transcript variant
FT                   mCT189395"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT189395.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(882713..882789,883131..883306,885815..885999,
FT                   887632..>887651)
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, transcript variant
FT                   mCT180353"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180353.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(882717..882789,884562..884672,885815..885999,
FT                   887632..>887737)
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, transcript variant
FT                   mCT180354"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180354.0 created
FT                   on 12-FEB-2003"
FT   CDS             join(<884627..884672,885845..885999,887632..888207)
FT                   /codon_start=1
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, isoform CRA_c"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT189395.0
FT                   protein_id=mCP110387.0 isoform=CRA_c"
FT                   /protein_id="EDL01384.1"
FT                   /translation="TQRSSCLYFLGAGIKETRPDTWKMPRFCYSRSGALLLALLLQTSI
FT                   DVWSWCLESSQCQDLTTESNLLACIRACKLDLSLETPVFPGNGDEQPLTENPRKYVMGH
FT                   FRWDRFGPRNSSSAGSAAQRRAEEEAVWGDGSPEPSPREGKRSYSMEHFRWGKPVGKKR
FT                   RPVKVYPNVAENESAEAFPLEFKRELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNP
FT                   PKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ"
FT   CDS             join(885868..885999,887632..888207)
FT                   /codon_start=1
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, isoform CRA_a"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180352.0
FT                   protein_id=mCP103276.0 isoform=CRA_a"
FT                   /protein_id="EDL01382.1"
FT                   /translation="MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLA
FT                   CIRACKLDLSLETPVFPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAE
FT                   EEAVWGDGSPEPSPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFK
FT                   RELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLF
FT                   KNAIIKNAHKKGQ"
FT   CDS             join(885868..885999,887632..888207)
FT                   /codon_start=1
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, isoform CRA_a"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT7164.1
FT                   protein_id=mCP7130.2 isoform=CRA_a"
FT                   /protein_id="EDL01385.1"
FT                   /translation="MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLA
FT                   CIRACKLDLSLETPVFPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAE
FT                   EEAVWGDGSPEPSPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFK
FT                   RELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLF
FT                   KNAIIKNAHKKGQ"
FT   CDS             join(885868..885999,887632..>887737)
FT                   /codon_start=1
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, isoform CRA_b"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180354.0
FT                   protein_id=mCP103274.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR013593"
FT                   /db_xref="MGI:MGI:97742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1W2P7R2"
FT                   /protein_id="EDL01383.1"
FT                   /translation="MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLA
FT                   CIRACKLDLSLETPVFPGNGDEQPLTENPRKYVM"
FT   CDS             join(885868..885999,887632..>887651)
FT                   /codon_start=1
FT                   /gene="Pomc1"
FT                   /locus_tag="mCG_7946"
FT                   /product="pro-opiomelanocortin-alpha, isoform CRA_d"
FT                   /note="gene_id=mCG7946.1 transcript_id=mCT180353.0
FT                   protein_id=mCP103275.0 isoform=CRA_d"
FT                   /protein_id="EDL01386.1"
FT                   /translation="MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLA
FT                   CIRAC"
FT   gene            complement(<896275..>966761)
FT                   /locus_tag="mCG_7958"
FT                   /note="gene_id=mCG7958.2"
FT   mRNA            complement(join(<896275..896372,898684..898806,
FT                   899505..899632,901347..901414,903075..903206,
FT                   904454..904615,904858..904933,905652..905824,
FT                   907881..907932,908190..908301,909393..909554,
FT                   909709..909844,911256..911382,912398..912547,
FT                   913294..913415,920771..920921,927462..927589,
FT                   928752..928828,966736..>966761))
FT                   /locus_tag="mCG_7958"
FT                   /product="mCG7958"
FT                   /note="gene_id=mCG7958.2 transcript_id=mCT7161.2 created on
FT                   15-MAY-2002"
FT   CDS             complement(join(<896275..896372,898684..898806,
FT                   899505..899632,901347..901414,903075..903206,
FT                   904454..904615,904858..904933,905652..905824,
FT                   907881..907932,908190..908301,909393..909554,
FT                   909709..909844,911256..911382,912398..912547,
FT                   913294..913415,920771..920921,927462..927589,
FT                   928752..928828,966736..>966760))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7958"
FT                   /product="mCG7958"
FT                   /note="gene_id=mCG7958.2 transcript_id=mCT7161.2
FT                   protein_id=mCP7125.2"
FT                   /protein_id="EDL01381.1"
FT                   /translation="GALPAEMYGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKL
FT                   TFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVES
FT                   FLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDL
FT                   EIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPS
FT                   PLQAPEKEKENPAELAERCLRELLGRAAFGNIKNAIKPPQHSHLVIQQLLSHLDANSRS
FT                   AATVRAGIVEVLSEAAIIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGAVSLGS
FT                   KIIKEHEECMFQEAVIKTIGSFASTLPTYQRSEVILFIMSKVPLPSVHHPVETGRTGEN
FT                   RNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLSTALMEDAEIRLFVLEILISF
FT                   IDRHGNRHKFSTISTLGDISVLKLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNIQ
FT                   KHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPTYNRCALYALGAAY
FT                   LNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVEKPRLSQNLDGVVIEFLFRQS
FT                   KISEVLGGSGYNSDRLCLPYIPQLTDEDRLSKRKSIGETISLQVEVESRNSPEKEEVSV
FT                   LVSTWVLMDSVAVEEQERERQRQVVEKFQKAPFEEIAAHC"
FT   assembly_gap    910600..910918
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    926120..926139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    929151..929337
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    945782..945801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    948346..948365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    967051..967122
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    974334..974844
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    1007969..1008107
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            1011016..1039181
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /note="gene_id=mCG7954.1"
FT   mRNA            join(1011016..1011200,1011236..1011332,1014413..1014495,
FT                   1017701..1017770,1024790..1024954,1025801..1025923,
FT                   1031631..1031791,1035379..1035507,1038549..1039181)
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, transcript variant
FT                   mCT7157"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT7157.1 created on
FT                   22-APR-2002"
FT   mRNA            join(<1011087..1011332,1014413..1014495,1017701..1017770,
FT                   1024790..1024954,1025801..1025923,1031631..1031791,
FT                   1035379..1035620,1035736..1035925,1036127..1037781)
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, transcript variant
FT                   mCT189396"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT189396.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1011118..1011332,1014413..1014495,1017701..1017770,
FT                   1024790..1024954,1025801..1025923,1031631..1031791,
FT                   1035379..1039180)
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, transcript variant
FT                   mCT189397"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT189397.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1011144..1011332,1014413..1014495,1017701..1017770,
FT                   1024790..1024954,1025801..1025923,1031631..1031791,
FT                   1035379..1035511)
FT                   /codon_start=1
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, isoform CRA_a"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT189396.0
FT                   protein_id=mCP110388.0 isoform=CRA_a"
FT                   /protein_id="EDL01378.1"
FT                   /translation="RAQRLRHWARRPEGLQAGWVRKDTTTRGPGRARAMETNVPKRKEP
FT                   AKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIF
FT                   DMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVF
FT                   VVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCEN
FT                   GGKRPTASSSASFTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPD
FT                   KCVAPGSEDAFKAVVNARTALLKNIK"
FT   CDS             join(<1011144..1011332,1014413..1014495,1017701..1017770,
FT                   1024790..1024954,1025801..1025923,1031631..1031791,
FT                   1035379..1035511)
FT                   /codon_start=1
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, isoform CRA_a"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT189397.0
FT                   protein_id=mCP110389.0 isoform=CRA_a"
FT                   /protein_id="EDL01379.1"
FT                   /translation="RAQRLRHWARRPEGLQAGWVRKDTTTRGPGRARAMETNVPKRKEP
FT                   AKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIF
FT                   DMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVF
FT                   VVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCEN
FT                   GGKRPTASSSASFTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPD
FT                   KCVAPGSEDAFKAVVNARTALLKNIK"
FT   CDS             join(1011246..1011332,1014413..1014495,1017701..1017770,
FT                   1024790..1024954,1025801..1025923,1031631..1031791,
FT                   1035379..1035507,1038549..1038648)
FT                   /codon_start=1
FT                   /gene="C330021A05Rik"
FT                   /locus_tag="mCG_7954"
FT                   /product="RIKEN cDNA C330021A05, isoform CRA_b"
FT                   /note="gene_id=mCG7954.1 transcript_id=mCT7157.1
FT                   protein_id=mCP7132.2 isoform=CRA_b"
FT                   /protein_id="EDL01380.1"
FT                   /translation="METNVPKRKEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKY
FT                   LATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSF
FT                   DALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFET
FT                   SAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSASFTKEQADTIRRIRNSKDSWEML
FT                   GVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNINGRKTEGLP
FT                   FEARKQGASISPLAMTVIPSRSAQ"
FT   assembly_gap    1017063..1017207
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1021140..1021222
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1054706..1054809
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            <1061992..1141179
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /note="gene_id=mCG116984.1"
FT   mRNA            join(<1061992..1062285,1062719..1063566,1102088..1102237,
FT                   1121470..1121600,1122019..1122130,1122285..1122412,
FT                   1123917..1124075,1125448..1125622,1126458..1126586,
FT                   1128055..1128197,1128335..1128496,1130669..1130756,
FT                   1131877..1131993,1133520..1133779,1134068..1134133,
FT                   1135711..1135792,1136436..1136594,1137325..1137471,
FT                   1137903..1138022,1138613..1138736,1139210..1139334,
FT                   1139736..1140655)
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, transcript variant
FT                   mCT189391"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189391.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<1062034..1062344,1062719..1063566,1102088..1102237,
FT                   1121470..1121600,1122019..1122130,1122285..1122412,
FT                   1123917..1124075,1125448..1125622,1126458..1126586,
FT                   1128055..1128197,1128335..1128496,1130669..1130756,
FT                   1131877..1131993,1133520..1133779,1134068..1134133,
FT                   1135711..1135792,1136436..1136594,1137325..1137471,
FT                   1137903..1138022,1138613..1138736,1139210..1139334,
FT                   1139736..1140655)
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, transcript variant
FT                   mCT189392"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189392.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<1062139..1062344,1062713..1063566,1102088..1102237,
FT                   1121470..1121600,1122019..1122130,1122285..1122412,
FT                   1123917..1124075,1125448..1125622,1126458..1126586,
FT                   1128055..1128197,1128335..1128496,1130669..1130756,
FT                   1131877..1131993,1133520..1133779,1134068..1134133,
FT                   1135708..1135792,1136436..1136594,1137325..1137471,
FT                   1137903..1138736,1139210..1139334,1139736..1140655)
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, transcript variant
FT                   mCT189393"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189393.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1062874..1063566,1102088..1102237,1121470..1121600,
FT                   1122019..1122130,1122285..1122412,1123917..1124075,
FT                   1125448..1125622,1126458..1126586,1128055..1128197,
FT                   1128335..1128496,1130669..1130756,1131877..1131993,
FT                   1133520..1133779,1134068..1134133,1135711..1135792,
FT                   1136436..1136594,1137325..1137471,1137903..1138022,
FT                   1138613..1138736,1139210..1139334,1139736..1139918)
FT                   /codon_start=1
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, isoform CRA_b"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189391.0
FT                   protein_id=mCP110380.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q80TY9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030672"
FT                   /db_xref="InterPro:IPR032628"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/TrEMBL:Q80TY9"
FT                   /protein_id="EDL01375.1"
FT                   /translation="KQPAANMPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEIS
FT                   VRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAV
FT                   VFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGL
FT                   NFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDE
FT                   LEGMQLLREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQ
FT                   ENLMLSILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSA
FT                   CSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLA
FT                   MVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPG
FT                   RVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSA
FT                   VPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQD
FT                   LADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEK
FT                   QSGAAFSCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPK
FT                   KLVAFSSWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCM
FT                   ENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRF
FT                   QEKDSPMVALEKMQVLATPGLNGTDRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLAR
FT                   TLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGV
FT                   MFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMA
FT                   ASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRI
FT                   GMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFV
FT                   RRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQVVDNP"
FT   CDS             join(<1062874..1063566,1102088..1102237,1121470..1121600,
FT                   1122019..1122130,1122285..1122412,1123917..1124075,
FT                   1125448..1125622,1126458..1126586,1128055..1128197,
FT                   1128335..1128496,1130669..1130756,1131877..1131993,
FT                   1133520..1133779,1134068..1134133,1135711..1135792,
FT                   1136436..1136594,1137325..1137471,1137903..1138022,
FT                   1138613..1138736,1139210..1139334,1139736..1139918)
FT                   /codon_start=1
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, isoform CRA_b"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189392.0
FT                   protein_id=mCP110381.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q80TY9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030672"
FT                   /db_xref="InterPro:IPR032628"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/TrEMBL:Q80TY9"
FT                   /protein_id="EDL01376.1"
FT                   /translation="KQPAANMPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEIS
FT                   VRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAV
FT                   VFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGL
FT                   NFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDE
FT                   LEGMQLLREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQ
FT                   ENLMLSILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSA
FT                   CSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLA
FT                   MVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPG
FT                   RVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSA
FT                   VPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQD
FT                   LADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEK
FT                   QSGAAFSCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPK
FT                   KLVAFSSWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCM
FT                   ENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRF
FT                   QEKDSPMVALEKMQVLATPGLNGTDRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLAR
FT                   TLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGV
FT                   MFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMA
FT                   ASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRI
FT                   GMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFV
FT                   RRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQVVDNP"
FT   CDS             join(<1062874..1063566,1102088..1102237,1121470..1121600,
FT                   1122019..1122130,1122285..1122412,1123917..1124075,
FT                   1125448..1125622,1126458..1126586,1128055..1128197,
FT                   1128335..1128496,1130669..1130756,1131877..1131993,
FT                   1133520..1133779,1134068..1134133,1135708..1135792,
FT                   1136436..1136594,1137325..1137471,1137903..1138034)
FT                   /codon_start=1
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, isoform CRA_c"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT189393.0
FT                   protein_id=mCP110382.0 isoform=CRA_c"
FT                   /protein_id="EDL01377.1"
FT                   /translation="KQPAANMPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEIS
FT                   VRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAV
FT                   VFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGL
FT                   NFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDE
FT                   LEGMQLLREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQ
FT                   ENLMLSILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSA
FT                   CSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLA
FT                   MVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPG
FT                   RVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSA
FT                   VPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQD
FT                   LADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEK
FT                   QSGAAFSCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPK
FT                   KLVAFSSWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCM
FT                   ENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRF
FT                   QEKDSPMVALEKMQVLATPGLNGTDSRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLA
FT                   RTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIG
FT                   VMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYM
FT                   AASGVTPDVNTNGFTSSSKVTQ"
FT   mRNA            join(<1062892..1063566,1102088..1102237,1121470..1121600,
FT                   1122019..1122130,1122285..1122412,1123917..1124075,
FT                   1125448..1125622,1126458..1126586,1128055..1128197,
FT                   1128335..1128496,1130669..1130756,1131877..1131993,
FT                   1133520..1133779,1134068..1134133,1135708..1135792,
FT                   1136436..1136594,1137325..1137471,1137903..1138022,
FT                   1138613..1138736,1139210..1139334,1139736..1141179)
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, transcript variant
FT                   mCT118116"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT118116.1
FT                   created on 21-APR-2002"
FT   CDS             join(1062892..1063566,1102088..1102237,1121470..1121600,
FT                   1122019..1122130,1122285..1122412,1123917..1124075,
FT                   1125448..1125622,1126458..1126586,1128055..1128197,
FT                   1128335..1128496,1130669..1130756,1131877..1131993,
FT                   1133520..1133779,1134068..1134133,1135708..1135792,
FT                   1136436..1136594,1137325..1137471,1137903..1138022,
FT                   1138613..1138736,1139210..1139334,1139736..1139918)
FT                   /codon_start=1
FT                   /gene="Adcy3"
FT                   /locus_tag="mCG_116984"
FT                   /product="adenylate cyclase 3, isoform CRA_a"
FT                   /note="gene_id=mCG116984.1 transcript_id=mCT118116.1
FT                   protein_id=mCP89791.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VHH7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030672"
FT                   /db_xref="InterPro:IPR032628"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VHH7"
FT                   /protein_id="EDL01374.1"
FT                   /translation="MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGS
FT                   CLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDK
FT                   LAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGLNFSRAH
FT                   AASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQL
FT                   LREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLS
FT                   ILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQEL
FT                   VKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAIS
FT                   YVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQ
FT                   STMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSAVPNGAP
FT                   ASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVV
FT                   DASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAF
FT                   SCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFS
FT                   SWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCMENPKYY
FT                   NYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRFQEKDSP
FT                   MVALEKMQVLATPGLNGTDSRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLARTLFLW
FT                   KIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASL
FT                   PNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVT
FT                   PDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKG
FT                   GVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPI
FT                   FVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQVVDNP"
FT   assembly_gap    1080966..1081437
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    1094942..1095273
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    1114719..1115507
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   gene            complement(1124975..1166795)
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /note="gene_id=mCG11019.2"
FT   mRNA            complement(join(1124975..1125641,1143650..1143909,
FT                   1144339..1144453,1164016..1164182,1166031..1166157,
FT                   1166252..1166795))
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, transcript variant
FT                   mCT179678"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT179678.1 created
FT                   on 14-JUN-2003"
FT   CDS             complement(join(1125612..1125641,1143650..1143909,
FT                   1144339..1144453,1164016..1164182,1166031..1166076))
FT                   /codon_start=1
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, isoform CRA_b"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT179678.1
FT                   protein_id=mCP102600.1 isoform=CRA_b"
FT                   /protein_id="EDL01372.1"
FT                   /translation="MESANTLCPGRKCKGGVLAHLERLEAQTNISNRKSEEPAVRKKES
FT                   SLRTKIRELRQQRDKLRAEVKQWGARVKEPPAKEDPSRTVISEQEVLEREWRNVDAILE
FT                   AYRFTGLSGKLTSRGVCMCISTAFEGNLLDSYFVDLVIEKPLRIHHHSVPVFIPLEKIA
FT                   AAHLQTDVQRFLFRLWEYLNAYAGRKYQADQLENWTADSPSR"
FT   assembly_gap    1135607..1135626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1138803..1141761,1142390..1142561,
FT                   1143650..1143909,1144339..1144453,1166031..1166157,
FT                   1166252..1166795))
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, transcript variant
FT                   mCT180089"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT180089.1 created
FT                   on 14-JUN-2003"
FT   mRNA            complement(join(1138803..1141761,1142390..1142561,
FT                   1143650..1143909,1144339..1144453,1164016..1164182,
FT                   1166031..1166157,1166252..1166795))
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, transcript variant
FT                   mCT11333"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT11333.2 created
FT                   on 14-JUN-2003"
FT   CDS             complement(join(1141625..1141761,1142390..1142561,
FT                   1143650..1143909,1144339..1144453,1164016..1164182,
FT                   1166031..1166076))
FT                   /codon_start=1
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, isoform CRA_a"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT11333.2
FT                   protein_id=mCP21973.3 isoform=CRA_a"
FT                   /protein_id="EDL01371.1"
FT                   /translation="MESANTLCPGRKCKGGVLAHLERLEAQTNISNRKSEEPAVRKKES
FT                   SLRTKIRELRQQRDKLRAEVKQWGARVKEPPAKEDPSRTVISEQEVLEREWRNVDAILE
FT                   AYRFTGLSGKLTSRGVCMCISTAFEGNLLDSYFVDLVIEKPLRIHHHSVPVFIPLEKIA
FT                   AAHLQTDVQRFLFRLWEYLNAYAGRKYQADQLESDFCDVLTGPLQRNALCNLLSFTYKV
FT                   EQRCQTFSFSARLLYEDPTAALPTNVTVTRPGVEASSPPWEEHRASHQMLFRTKPLHKV
FT                   FASFSKETEKLHLNLVS"
FT   CDS             complement(join(1141625..1141761,1142390..1142561,
FT                   1143650..1143874))
FT                   /codon_start=1
FT                   /gene="Cenpo"
FT                   /locus_tag="mCG_11019"
FT                   /product="centromere protein O, isoform CRA_c"
FT                   /note="gene_id=mCG11019.2 transcript_id=mCT180089.1
FT                   protein_id=mCP103011.1 isoform=CRA_c"
FT                   /db_xref="GOA:B8JK52"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="MGI:MGI:1923800"
FT                   /db_xref="UniProtKB/TrEMBL:B8JK52"
FT                   /protein_id="EDL01373.1"
FT                   /translation="MCISTAFEGNLLDSYFVDLVIEKPLRIHHHSVPVFIPLEKIAAAH
FT                   LQTDVQRFLFRLWEYLNAYAGRKYQADQLESDFCDVLTGPLQRNALCNLLSFTYKVEQR
FT                   CQTFSFSARLLYEDPTAALPTNVTVTRPGVEASSPPWEEHRASHQMLFRTKPLHKVFAS
FT                   FSKETEKLHLNLVS"
FT   assembly_gap    1147278..1149776
FT                   /estimated_length=2499
FT                   /gap_type="unknown"
FT   assembly_gap    1150644..1153470
FT                   /estimated_length=2827
FT                   /gap_type="unknown"
FT   gene            1158244..1161043
FT                   /pseudo
FT                   /locus_tag="mCG_11014"
FT                   /note="gene_id=mCG11014.2"
FT   mRNA            1158244..1161043
FT                   /pseudo
FT                   /locus_tag="mCG_11014"
FT                   /note="gene_id=mCG11014.2 transcript_id=mCT11329.2 created
FT                   on 22-APR-2002"
FT   assembly_gap    1163811..1163830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1166527..1169461
FT                   /locus_tag="mCG_11021"
FT                   /note="gene_id=mCG11021.1"
FT   mRNA            join(<1166527..1166778,1168863..1169461)
FT                   /locus_tag="mCG_11021"
FT                   /product="mCG11021"
FT                   /note="gene_id=mCG11021.1 transcript_id=mCT11335.1 created
FT                   on 22-APR-2002"
FT   CDS             join(1166527..1166778,1168863..1169033)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11021"
FT                   /product="mCG11021"
FT                   /note="gene_id=mCG11021.1 transcript_id=mCT11335.1
FT                   protein_id=mCP21970.0"
FT                   /db_xref="GOA:D3Z4S3"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="MGI:MGI:1916959"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3Z4S3"
FT                   /protein_id="EDL01370.1"
FT                   /translation="MHRKVRPASLMIRKMACSGVEPQILVQYLVLRKDLSQAPFSWPTG
FT                   ALVAQACHAATAALHLHRDHPHTAAYLRELGRMRKVVLEAADETTLKELAETLQQKNID
FT                   HTLWLEQPENIATCIALRPYPKEEVSQYLKKFRLFK"
FT   gene            1170203..1171083
FT                   /pseudo
FT                   /locus_tag="mCG_11002"
FT                   /note="gene_id=mCG11002.2"
FT   mRNA            1170203..1171083
FT                   /pseudo
FT                   /locus_tag="mCG_11002"
FT                   /note="gene_id=mCG11002.2 transcript_id=mCT11315.2 created
FT                   on 21-APR-2002"
FT   gene            <1173632..>1180166
FT                   /locus_tag="mCG_145874"
FT                   /note="gene_id=mCG145874.0"
FT   mRNA            join(<1173632..1173724,1176693..1176915,1180099..>1180166)
FT                   /locus_tag="mCG_145874"
FT                   /product="mCG145874"
FT                   /note="gene_id=mCG145874.0 transcript_id=mCT185982.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<1176771..1176915,1180099..>1180166)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145874"
FT                   /product="mCG145874"
FT                   /note="gene_id=mCG145874.0 transcript_id=mCT185982.0
FT                   protein_id=mCP107725.0"
FT                   /protein_id="EDL01369.1"
FT                   /translation="TAQMRTLLTVIHEAYCLRLIDCTMTLFHEKDPDSHTQSWSPPRVP
FT                   CVLGPYAKAPRQETSSGMLKLKVNFL"
FT   assembly_gap    1177410..1177429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1179859..1348693)
FT                   /gene="Ncoa1"
FT                   /locus_tag="mCG_140096"
FT                   /note="gene_id=mCG140096.0"
FT   mRNA            complement(join(1179859..1180525,1180650..1180703,
FT                   1182195..1182245,1182344..1182385,1186136..1186225,
FT                   1191816..1191999,1196038..1196212,1200211..1200613,
FT                   1203351..1203452,1207298..1207612,1207777..1207945,
FT                   1210845..1210962,1223557..1223737,1227121..1228459,
FT                   1229687..1229834,1238630..1238770,1247904..1248002,
FT                   1255086..1255263,1267915..1268026,1271151..1271318,
FT                   1276531..1276636,1286495..1286643,1340431..1340506,
FT                   1348556..1348693))
FT                   /gene="Ncoa1"
FT                   /locus_tag="mCG_140096"
FT                   /product="nuclear receptor coactivator 1, transcript
FT                   variant mCT168030"
FT                   /note="gene_id=mCG140096.0 transcript_id=mCT168030.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(1180373..1180525,1180650..1180703,
FT                   1182195..1182245,1182344..1182385,1186136..1186225,
FT                   1191816..1191999,1196038..1196212,1200211..1200613,
FT                   1203351..1203452,1207298..1207612,1207777..1207945,
FT                   1210845..1210962,1223557..1223737,1227121..1228459,
FT                   1229687..1229834,1238630..1238770,1247904..1248002,
FT                   1255086..1255263,1267915..1268026,1271151..1271318,
FT                   1276531..1276619))
FT                   /codon_start=1
FT                   /gene="Ncoa1"
FT                   /locus_tag="mCG_140096"
FT                   /product="nuclear receptor coactivator 1, isoform CRA_a"
FT                   /note="gene_id=mCG140096.0 transcript_id=mCT168030.0
FT                   protein_id=mCP90929.0 isoform=CRA_a"
FT                   /protein_id="EDL01367.1"
FT                   /translation="MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEE
FT                   LAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQGFIVAEKSTTDDDVQKSDI
FT                   SSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYS
FT                   ILHVGDHAEFVKNLLPKSLEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEGKIISID
FT                   TSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDG
FT                   TMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGI
FT                   SPAHGVTRSSTLPPSNNNMVSARVNRQQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVAN
FT                   VALNQGQAGSQSSNPSLNLNNSPMEGTGIALSQFMSPRRQANSGLATRARMSNNSFPPN
FT                   IPTLSSPVGITSGACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSAGSPVLRQMSSQNSP
FT                   SRLSMQPAKAESKDSKEIASILNEMIQSDNSDNSANEGKPLDSGLLHNNDRLSEGDSKY
FT                   SQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSSSASSNPSGGTCPSSHSSLTE
FT                   RHKILHRLLQEGSPSDITTLSVEPEKKDSVPASTAVSVSGQSQGSASIKLELDAAKKKE
FT                   SKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVKVEKKEQMDPCNTNPTPMTKPAPEEVKL
FT                   ESQSQFTADLDQFDQLLPTLEKAAQLPSLCETDRMDGAVTGVSIKAEVLPASLQPTTAR
FT                   AAPRLSRLPELELEAIDNQFGQPGAGDQIPWANNTLTTINQNKPEDQCISSQLDELLCP
FT                   PTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQA
FT                   TPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQKPSLGAMPVQVTPPRGTFSPNMG
FT                   MQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQFAANAPVGMNMRSGMQQ
FT                   QITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQSFGNNIPPSSGLPVQMG
FT                   TPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLATRSSMVNRGMAGNMG
FT                   GQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSSMVPMPVPPPQSSLLQQTPP
FT                   TSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVSMAGGNANIQNMN
FT                   PMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTDADGNQDKKTEE
FT                   FFSVVTTDQVQQVQVFADVQCTVNLKGASELTLVLAVVLLTGQRKGHKNQCRQGARTQD
FT                   FKEEAISPGPSFCISPPLVQTTPLNGIYSETTGF"
FT   mRNA            complement(join(1181950..1182245,1182331..1182385,
FT                   1186136..1186225,1191816..1191999,1196038..1196212,
FT                   1200211..1200613,1203351..1203452,1207298..1207612,
FT                   1207777..1207945,1210845..1210962,1223557..1223737,
FT                   1227121..1228459,1229687..1229834,1238630..1238770,
FT                   1245244..1245339,1247904..1248083,1255086..1255263,
FT                   1267915..1268012,1271152..1271318,1276531..1276636,
FT                   1286495..1286643,1348556..1348692))
FT                   /gene="Ncoa1"
FT                   /locus_tag="mCG_140096"
FT                   /product="nuclear receptor coactivator 1, transcript
FT                   variant mCT179712"
FT                   /note="gene_id=mCG140096.0 transcript_id=mCT179712.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(1182341..1182385,1186136..1186225,
FT                   1191816..1191999,1196038..1196212,1200211..1200613,
FT                   1203351..1203452,1207298..1207612,1207777..1207945,
FT                   1210845..1210962,1223557..1223737,1227121..1228459,
FT                   1229687..1229834,1238630..1238770,1245244..1245339,
FT                   1247904..1248083,1255086..1255263,1267915..1268012,
FT                   1271152..1271318,1276531..1276619))
FT                   /codon_start=1
FT                   /gene="Ncoa1"
FT                   /locus_tag="mCG_140096"
FT                   /product="nuclear receptor coactivator 1, isoform CRA_b"
FT                   /note="gene_id=mCG140096.0 transcript_id=mCT179712.0
FT                   protein_id=mCP102634.0 isoform=CRA_b"
FT                   /protein_id="EDL01368.1"
FT                   /translation="MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEE
FT                   LAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQ
FT                   GVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVG
FT                   DHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQ
FT                   CFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLR
FT                   AAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSA
FT                   HTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHG
FT                   VTRSSTLPPSNNNMVSARVNRQQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVANVALNQ
FT                   GQAGSQSSNPSLNLNNSPMEGTGIALSQFMSPRRQANSGLATRARMSNNSFPPNIPTLS
FT                   SPVGITSGACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSM
FT                   QPAKAESKDSKEIASILNEMIQSDNSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSH
FT                   KLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSSSASSNPSGGTCPSSHSSLTERHKIL
FT                   HRLLQEGSPSDITTLSVEPEKKDSVPASTAVSVSGQSQGSASIKLELDAAKKKESKDHQ
FT                   LLRYLLDKDEKDLRSTPNLCLDDVKVKVEKKEQMDPCNTNPTPMTKPAPEEVKLESQSQ
FT                   FTADLDQFDQLLPTLEKAAQLPSLCETDRMDGAVTGVSIKAEVLPASLQPTTARAAPRL
FT                   SRLPELELEAIDNQFGQPGAGDQIPWANNTLTTINQNKPEDQCISSQLDELLCPPTTVE
FT                   GRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLM
FT                   MEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQKPSLGAMPVQVTPPRGTFSPNMGMQPRQ
FT                   TLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQFAANAPVGMNMRSGMQQQITPQ
FT                   PPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQSFGNNIPPSSGLPVQMGTPRLP
FT                   QGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLATRSSMVNRGMAGNMGGQFGA
FT                   GISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSSMVPMPVPPPQSSLLQQTPPTSGYQ
FT                   SPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVSMAGGNANIQNMNPMMGQ
FT                   MQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTDADGNQDKKTEEFFSVV
FT                   TTD"
FT   assembly_gap    1184902..1184937
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    1190732..1191017
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    1209038..1209651
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    1242679..1242719
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    1258047..1258066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1291353..1291372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1293078..1293287
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    1297069..1297113
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1298652..1298671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1304536..1307021
FT                   /estimated_length=2486
FT                   /gap_type="unknown"
FT   assembly_gap    1312225..1312326
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1332517..1332536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1334352..1334453
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1348362..1348528
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    1354163..1354292
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1376210..1376229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1382173..1382192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1391629..1392108
FT                   /pseudo
FT                   /locus_tag="mCG_49688"
FT                   /note="gene_id=mCG49688.1"
FT   mRNA            1391629..1392108
FT                   /pseudo
FT                   /locus_tag="mCG_49688"
FT                   /note="gene_id=mCG49688.1 transcript_id=mCT49871.1 created
FT                   on 22-APR-2002"
FT   gene            <1406813..>1407445
FT                   /locus_tag="mCG_1027320"
FT                   /note="gene_id=mCG1027320.0"
FT   mRNA            join(<1406813..1407301,1407363..>1407445)
FT                   /locus_tag="mCG_1027320"
FT                   /product="mCG1027320"
FT                   /note="gene_id=mCG1027320.0 transcript_id=mCT145024.1
FT                   created on 21-APR-2002"
FT   CDS             join(<1407060..1407301,1407363..>1407445)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027320"
FT                   /product="mCG1027320"
FT                   /note="gene_id=mCG1027320.0 transcript_id=mCT145024.1
FT                   protein_id=mCP89804.1"
FT                   /protein_id="EDL01366.1"
FT                   /translation="KLNCLEREKREVTFSTRTPASPLQCLYKDRGARKANVLPSLKFLS
FT                   LPNSSATAPGLVLVTHSQSLRLPLTTSHYRVSGPWDHRRGVVRTEDPGVQFLRVSSKRL
FT                   WRAQ"
FT   assembly_gap    1408005..1408774
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   assembly_gap    1434392..1434411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1440812..1453866
FT                   /locus_tag="mCG_146995"
FT                   /note="gene_id=mCG146995.0"
FT   mRNA            join(1440812..1440903,1452665..1453866)
FT                   /locus_tag="mCG_146995"
FT                   /product="mCG146995"
FT                   /note="gene_id=mCG146995.0 transcript_id=mCT187258.0
FT                   created on 13-JAN-2004"
FT   CDS             1452703..1452885
FT                   /codon_start=1
FT                   /locus_tag="mCG_146995"
FT                   /product="mCG146995"
FT                   /note="gene_id=mCG146995.0 transcript_id=mCT187258.0
FT                   protein_id=mCP109655.0"
FT                   /protein_id="EDL01365.1"
FT                   /translation="MLFTLGNLAGKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
FT                   EEEEEEEEERRRRRK"
FT   gene            <1455607..1460616
FT                   /locus_tag="mCG_144515"
FT                   /note="gene_id=mCG144515.0"
FT   mRNA            join(<1455607..1455833,1456363..1456505,1459168..1460616)
FT                   /locus_tag="mCG_144515"
FT                   /product="mCG144515"
FT                   /note="gene_id=mCG144515.0 transcript_id=mCT183939.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1456113..1456132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <1460245..1460496
FT                   /codon_start=1
FT                   /locus_tag="mCG_144515"
FT                   /product="mCG144515"
FT                   /note="gene_id=mCG144515.0 transcript_id=mCT183939.0
FT                   protein_id=mCP106189.0"
FT                   /protein_id="EDL01364.1"
FT                   /translation="GKVSRTQDLFSKGLSLPVLPVSVKSLGYPSFCGLSPPKSVIILLI
FT                   ERIEPFVHWVNHHHKSMMSLCPNCPSSVGQNLSCYDII"
FT   assembly_gap    1461629..1462941
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    1510231..1510250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1515901..1516015
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   gene            complement(1518591..1519316)
FT                   /pseudo
FT                   /locus_tag="mCG_1027311"
FT                   /note="gene_id=mCG1027311.1"
FT   mRNA            complement(1518591..1519316)
FT                   /pseudo
FT                   /locus_tag="mCG_1027311"
FT                   /note="gene_id=mCG1027311.1 transcript_id=mCT145015.1
FT                   created on 19-APR-2002"
FT   gene            1524343..1645574
FT                   /gene="Itsn2"
FT                   /locus_tag="mCG_11010"
FT                   /note="gene_id=mCG11010.2"
FT   mRNA            join(1524343..1524636,1545025..1545052,1556640..1556732,
FT                   1558279..1558342,1559583..1559746,1561295..1561501,
FT                   1561618..1561714,1562387..1562526,1564124..1564187,
FT                   1564686..1564825,1565241..1565312,1566456..1566718,
FT                   1567502..1567651,1568468..1568608,1569660..1569747,
FT                   1571576..1571715,1581767..1581903,1584135..1584271,
FT                   1585239..1585327,1589799..1589974,1590226..1590355,
FT                   1593533..1593738,1596209..1596294,1597832..1597998,
FT                   1602945..1602990,1603074..1603195,1604409..1604505,
FT                   1605088..1605279,1628792..1628913,1631970..1632076,
FT                   1632832..1633015,1637910..1638008,1638615..1638782,
FT                   1639180..1639395,1639763..1639884,1640595..1640677,
FT                   1643576..1643659,1644090..1644263,1644663..1645574)
FT                   /gene="Itsn2"
FT                   /locus_tag="mCG_11010"
FT                   /product="intersectin 2, transcript variant mCT168948"
FT                   /note="gene_id=mCG11010.2 transcript_id=mCT168948.0 created
FT                   on 15-MAY-2002"
FT   mRNA            join(1524711..1524851,1544990..1545052,1556640..1556732,
FT                   1558279..1558342,1559583..1559746,1561295..1561501,
FT                   1561618..1561714,1562387..1562526,1564124..1564187,
FT                   1564686..1564823,1565227..1565312,1566456..1566718,
FT                   1567502..1567651,1568468..1568608,1569660..1569747,
FT                   1571576..1571715,1581767..1581903,1584135..1584271,
FT                   1585230..1585327,1589799..1589974,1590226..1590355,
FT                   1593533..1593738,1596209..1596294,1597832..1597998,
FT                   1602945..1602990,1603074..1603195,1604409..1604505,
FT                   1605088..1605279,1628792..1628901,1644794..1645572)
FT                   /gene="Itsn2"
FT                   /locus_tag="mCG_11010"
FT                   /product="intersectin 2, transcript variant mCT11326"
FT                   /note="gene_id=mCG11010.2 transcript_id=mCT11326.1 created
FT                   on 15-MAY-2002"
FT   assembly_gap    1524856..1524991
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(1526997..>1587673)
FT                   /locus_tag="mCG_144924"
FT                   /note="gene_id=mCG144924.0"
FT   mRNA            complement(join(1526997..1527749,1527842..1529063,
FT                   1587578..>1587673))
FT                   /locus_tag="mCG_144924"
FT                   /product="mCG144924"
FT                   /note="gene_id=mCG144924.0 transcript_id=mCT184348.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1527820..1527839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1528932..1529063,1587578..>1587622))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144924"
FT                   /product="mCG144924"
FT                   /note="gene_id=mCG144924.0 transcript_id=mCT184348.0
FT                   protein_id=mCP106190.0"
FT                   /protein_id="EDL01363.1"
FT                   /translation="LLVLHPLVINSDLESTEDRIKKRRLMWNVEKTKIKNSCSNEEAIC
FT                   ERCKSELHYQVLS"
FT   CDS             join(1545025..1545052,1556640..1556732,1558279..1558342,
FT                   1559583..1559746,1561295..1561501,1561618..1561714,
FT                   1562387..1562526,1564124..1564187,1564686..1564825,
FT                   1565241..1565312,1566456..1566718,1567502..1567651,
FT                   1568468..1568608,1569660..1569747,1571576..1571715,
FT                   1581767..1581903,1584135..1584271,1585239..1585327,
FT                   1589799..1589974,1590226..1590355,1593533..1593738,
FT                   1596209..1596294,1597832..1597998,1602945..1602990,
FT                   1603074..1603195,1604409..1604505,1605088..1605279,
FT                   1628792..1628913,1631970..1632076,1632832..1633015,
FT                   1637910..1638008,1638615..1638782,1639180..1639395,
FT                   1639763..1639884,1640595..1640677,1643576..1643659,
FT                   1644090..1644263,1644663..1644820)
FT                   /codon_start=1
FT                   /gene="Itsn2"
FT                   /locus_tag="mCG_11010"
FT                   /product="intersectin 2, isoform CRA_b"
FT                   /note="gene_id=mCG11010.2 transcript_id=mCT168948.0
FT                   protein_id=mCP91946.0 isoform=CRA_b"
FT                   /protein_id="EDL01362.1"
FT                   /translation="MAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQAR
FT                   TFFLQSGLPAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQ
FT                   PPMFSPLISARFGMGSMPNLSIHQPLPPVAPIATPLSSATSGTSIPPLMMPAPLVPSVS
FT                   TSSLPNGTASLIQPLSIPYSSSTLPHASSYSLMMGGFGGASIQKAQSLIDLGSSSSTSS
FT                   TASLSGNSPKTGTSEWAVPQPSRLKYRQKFNSLDKGMSGYLSGFQARNALLQSNLSQTQ
FT                   LATIWTLADIDGDGQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRFDSVNGTL
FT                   PSYQKTQEEEPQKKLPVTFEDKRKANYERGNMELEKRRQVLMEQQQREAERKAQKEKEE
FT                   WERKQRELQEQEWKKQLELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEW
FT                   ERLRRQELLSQKTREQEDIVRLSSRKKSLHLELEAVNGKHQQISGRLQDVQIRKQTQKT
FT                   ELEVLDKQCDLEIMEIKQLQQELKEYQNKLIYLVPEKQLLNERIKNMQLSNTPDSGISL
FT                   LHKKSSEKEELCQRLKEQLDALEKETASKLSEMDSFNNQLKELRESYNTQQLALEQLHK
FT                   IKRDKLKEIERKRLEQIQKKKLEDEAARKAKQGKENLWRESIRKEEEEKQKRLQEEKSQ
FT                   DKTQEEERKAEAKQTSALVNYRALYPFEARNHDEMSFSSGDIIQVDEKTVGEPGWLYGS
FT                   FQGKFGWFPCNYVEKVLSSEKALSPKKALLPPTVSLSATSTSSQPPASVTDYHNVSFSN
FT                   LTVNTTWQQKSAFTRTVSPGSVSPIHGQGQAVENLKAQALCSWTAKKENHLNFSKHDVI
FT                   TVLEQQENWWFGEVHGGRGWFPKSYVKLIPGNEVQRGEPEALYAAVTKKPTSTAYPVTS
FT                   TAYPVGEDYIALYSYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGERTGIFPSNYVRP
FT                   KDQENFGNASKSGASNKKPEIAQVTSAYAASGTEQLSLAPGQLILILKKNTSGWWQGEL
FT                   QARGKKRQKGWFPASHVKLLGPSSERTMPTFHAVCQVIAMYDYMANNEDELNFSKGQLI
FT                   NVMNKDDPDWWQGETNGLTGLFPSNYVKMTTDSDPSQQWCADLQALDTMQPTERKRQGY
FT                   IHELIQTEERYMDDLQLVIEVFQKRMAESGFLTEADMALIFVNWKELIMSNTKLLRALR
FT                   VRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGATLLQQKTDEDTDFKEFLKK
FT                   LASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPQSHVDHSSLKLALERAEELCS
FT                   QVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKE
FT                   LHAFLFNDFLLLTYLVRQFAAASGHEKLFNSKSSAQFRMYKTPIFLNEVLVKLPTDPSS
FT                   DEPVFHISHIDRVYTLRTDNINERTAWVQKIKGASEQYIDTEKKKREKAYQARSQKTSG
FT                   IGRLMVHVIEATELKACKPNGKSNPYCEVSMGSQSYTTRTLQDTLNPKWNFNCQFFIKD
FT                   LYQDVLCLTMFDRDQFSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTGEVWVR
FT                   FDLQLFEQKTLL"
FT   CDS             join(1545025..1545052,1556640..1556732,1558279..1558342,
FT                   1559583..1559746,1561295..1561501,1561618..1561714,
FT                   1562387..1562526,1564124..1564187,1564686..1564823,
FT                   1565227..1565312,1566456..1566718,1567502..1567651,
FT                   1568468..1568608,1569660..1569747,1571576..1571715,
FT                   1581767..1581903,1584135..1584271,1585230..1585327,
FT                   1589799..1589974,1590226..1590355,1593533..1593738,
FT                   1596209..1596294,1597832..1597998,1602945..1602990,
FT                   1603074..1603195,1604409..1604505,1605088..1605279,
FT                   1628792..1628901,1644794..1644820)
FT                   /codon_start=1
FT                   /gene="Itsn2"
FT                   /locus_tag="mCG_11010"
FT                   /product="intersectin 2, isoform CRA_a"
FT                   /note="gene_id=mCG11010.2 transcript_id=mCT11326.1
FT                   protein_id=mCP21993.0 isoform=CRA_a"
FT                   /protein_id="EDL01361.1"
FT                   /translation="MAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQAR
FT                   TFFLQSGLPAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQ
FT                   PPMFSPLISARFGMGSMPNLSIHQPLPPVAPIATPLSSATSGTSIPPLMMPAPLVPSVS
FT                   TSSLPNGTASLIQPLSIPYSSSTLPHASSYSLMMGGFGGASIQKAQSLIDLGSSSSTSS
FT                   TASLSGNSPKTGTSEWAVPQPSRLKYRQKFNSLDKGMSGYLSGFQARNALLQSNLSQTQ
FT                   LATIWTLADIDGDGQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQVDSV
FT                   NGTLPSYQKTQEEEPQKKLPVTFEDKRKANYERGNMELEKRRQVLMEQQQREAERKAQK
FT                   EKEEWERKQRELQEQEWKKQLELEKRLEKQRELERQREEERRKEIERREAAKQELERQR
FT                   RLEWERLRRQELLSQKTREQEDIVRLSSRKKSLHLELEAVNGKHQQISGRLQDVQIRKQ
FT                   TQKTELEVLDKQCDLEIMEIKQLQQELKEYQNKLIYLVPEKQLLNERIKNMQLSNTPDS
FT                   GISLLHKKSSEKEELCQRLKEQLDALEKETASKLSEMDSFNNQLKELRESYNTQQLALE
FT                   QLHKIKRDKLKEIERKRLEQIQKKKLEDEAARKAKQGKENLWRESIRKEEEEKQKRLQE
FT                   EKSQDKTQEEERKAEAKQSETASALVNYRALYPFEARNHDEMSFSSGDIIQVDEKTVGE
FT                   PGWLYGSFQGKFGWFPCNYVEKVLSSEKALSPKKALLPPTVSLSATSTSSQPPASVTDY
FT                   HNVSFSNLTVNTTWQQKSAFTRTVSPGSVSPIHGQGQAVENLKAQALCSWTAKKENHLN
FT                   FSKHDVITVLEQQENWWFGEVHGGRGWFPKSYVKLIPGNEVQRGEPEALYAAVTKKPTS
FT                   TAYPVTSTAYPVGEDYIALYSYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGERTGIF
FT                   PSNYVRPKDQENFGNASKSGASNKKPEIAQVTSAYAASGTEQLSLAPGQLILILKKNTS
FT                   GWWQGELQARGKKRQKGWFPASHVKLLGPSSERTMPTFHAVCQVIAMYDYMANNEDELN
FT                   FSKGQLINVMNKDDPDWWQGETNGLTGLFPSNYVKMTTDSDPSQQWCADLQALDTMQPT
FT                   ERKRQGYIHELIQTEERYMDDLQLFEQKTLL"
FT   assembly_gap    1566209..1566228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1574658..1574944
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    1578687..1578709
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1592495..1592596
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1595416..1595435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1621023..1621623)
FT                   /pseudo
FT                   /locus_tag="mCG_117532"
FT                   /note="gene_id=mCG117532.1"
FT   mRNA            complement(1621023..1621623)
FT                   /pseudo
FT                   /locus_tag="mCG_117532"
FT                   /note="gene_id=mCG117532.1 transcript_id=mCT118673.1
FT                   created on 19-NOV-2002"
FT   assembly_gap    1623670..1623689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1642046..1642065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1645428..1670055)
FT                   /gene="4930417G10Rik"
FT                   /locus_tag="mCG_11006"
FT                   /note="gene_id=mCG11006.2"
FT   mRNA            complement(join(1645428..1647330,1650200..1650341,
FT                   1662763..1662928,1663048..1663129,1664364..1664552,
FT                   1666591..1666659,1669302..1669408,1669832..1670055))
FT                   /gene="4930417G10Rik"
FT                   /locus_tag="mCG_11006"
FT                   /product="RIKEN cDNA 4930417G10, transcript variant
FT                   mCT11320"
FT                   /note="gene_id=mCG11006.2 transcript_id=mCT11320.2 created
FT                   on 06-MAY-2003"
FT   CDS             complement(join(1647172..1647330,1650200..1650341,
FT                   1662763..1662928,1663048..1663129,1664364..1664552,
FT                   1666591..1666659,1669302..1669394))
FT                   /codon_start=1
FT                   /gene="4930417G10Rik"
FT                   /locus_tag="mCG_11006"
FT                   /product="RIKEN cDNA 4930417G10, isoform CRA_b"
FT                   /note="gene_id=mCG11006.2 transcript_id=mCT11320.2
FT                   protein_id=mCP21990.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CDW1"
FT                   /db_xref="MGI:MGI:1922105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CDW1"
FT                   /protein_id="EDL01360.1"
FT                   /translation="MADTKTSKCDEHFSVEKLKEWPEPESVSLMELLAREDIDEAVHAV
FT                   LFRENYVVKRLDTYLQHLAVFKERRKEMLHKKWVENVVQPLQQRITDKITSYRRPGKNQ
FT                   VKYEHCLKQTNKPTKVSSSCLFQKQQEFREAKGTSYQHGRGKTHDTQKEAKETEKGLSF
FT                   TPFSLRPHCSSPRERQRASARLMQSKPGGRNRYKGASSEKPVFTLKSHLPKEEKTVSRS
FT                   QLVFERQFRASRLSQDIKEAEKKGLVVGTGPQRPRSWAAADSVPRPSLVGRRVMTAEIL
FT                   GEHLVSLHQAARSGLQWP"
FT   mRNA            complement(join(1662432..1663129,1664364..1664552,
FT                   1666591..1666659,1669302..1669408,1670009..1670054))
FT                   /gene="4930417G10Rik"
FT                   /locus_tag="mCG_11006"
FT                   /product="RIKEN cDNA 4930417G10, transcript variant
FT                   mCT170333"
FT                   /note="gene_id=mCG11006.2 transcript_id=mCT170333.0 created
FT                   on 06-MAY-2003"
FT   CDS             complement(join(1662962..1663129,1664364..1664552,
FT                   1666591..1666659,1669302..1669394))
FT                   /codon_start=1
FT                   /gene="4930417G10Rik"
FT                   /locus_tag="mCG_11006"
FT                   /product="RIKEN cDNA 4930417G10, isoform CRA_a"
FT                   /note="gene_id=mCG11006.2 transcript_id=mCT170333.0
FT                   protein_id=mCP93251.0 isoform=CRA_a"
FT                   /protein_id="EDL01359.1"
FT                   /translation="MADTKTSKCDEHFSVEKLKEWPEPESVSLMELLAREDIDEAVHAV
FT                   LFRENYVVKRLDTYLQHLAVFKERRKEMLHKKWVENVVQPLQQRITDKITSYRRPGKNQ
FT                   VKYEHCLKQTNKPTKVSSSCLFQKQQEFREAKGTSYQHGRGALQPTRGCIEDTAKCQIV
FT                   PPQEPQTCF"
FT   gene            complement(1671511..1701072)
FT                   /gene="A830093I24Rik"
FT                   /locus_tag="mCG_11016"
FT                   /note="gene_id=mCG11016.1"
FT   mRNA            complement(join(1671511..1671665,1694158..1694238,
FT                   1694831..1695022,1695910..1695978,1700230..1700361,
FT                   1700746..1701072))
FT                   /gene="A830093I24Rik"
FT                   /locus_tag="mCG_11016"
FT                   /product="RIKEN cDNA A830093I24"
FT                   /note="gene_id=mCG11016.1 transcript_id=mCT11330.2 created
FT                   on 27-JUN-2002"
FT   CDS             complement(join(1671636..1671665,1694158..1694238,
FT                   1694831..1695022,1695910..1695978,1700230..1700337))
FT                   /codon_start=1
FT                   /gene="A830093I24Rik"
FT                   /locus_tag="mCG_11016"
FT                   /product="RIKEN cDNA A830093I24"
FT                   /note="gene_id=mCG11016.1 transcript_id=mCT11330.2
FT                   protein_id=mCP21977.2"
FT                   /protein_id="EDL01358.1"
FT                   /translation="MTTMKNRSQDDMVTGTLPKLKSSKEWLEPQSLSFMEALAKEDTDA
FT                   AVQSILYRENYIMKELDKYLHHQDFLNTRRKEMLYKKWVERVADPLQKKIIEKVHSHKN
FT                   IKKRRRQELDNFLKHSNKKGNAFIEHYDPKEYDPFYMSKEDPNFLKVLTATYPDS"
FT   assembly_gap    1687164..1687435
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    1691152..1691171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1699715..1699792
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            1701133..1710645
FT                   /gene="Pfn4"
FT                   /locus_tag="mCG_11004"
FT                   /note="gene_id=mCG11004.2"
FT   mRNA            join(1701133..1702109,1706231..1706368,1707259..1707364,
FT                   1710019..1710105)
FT                   /gene="Pfn4"
FT                   /locus_tag="mCG_11004"
FT                   /product="profilin family, member 4, transcript variant
FT                   mCT180088"
FT                   /note="gene_id=mCG11004.2 transcript_id=mCT180088.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(1701134..1702088,1706231..1706368,1707259..1707364,
FT                   1710019..1710645)
FT                   /gene="Pfn4"
FT                   /locus_tag="mCG_11004"
FT                   /product="profilin family, member 4, transcript variant
FT                   mCT11317"
FT                   /note="gene_id=mCG11004.2 transcript_id=mCT11317.2 created
FT                   on 14-FEB-2003"
FT   CDS             join(1701993..1702109,1706231..1706368,1707259..1707364,
FT                   1710019..1710047)
FT                   /codon_start=1
FT                   /gene="Pfn4"
FT                   /locus_tag="mCG_11004"
FT                   /product="profilin family, member 4, isoform CRA_b"
FT                   /note="gene_id=mCG11004.2 transcript_id=mCT180088.0
FT                   protein_id=mCP103010.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6JEK6"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="MGI:MGI:1920121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JEK6"
FT                   /protein_id="EDL01357.1"
FT                   /translation="MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDV
FT                   RTLLNGFAKNPLLTRREGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATY
FT                   TAGMYPSVCVEATEKLGEYLRKKGN"
FT   CDS             join(1701993..1702088,1706231..1706368,1707259..1707364,
FT                   1710019..1710047)
FT                   /codon_start=1
FT                   /gene="Pfn4"
FT                   /locus_tag="mCG_11004"
FT                   /product="profilin family, member 4, isoform CRA_a"
FT                   /note="gene_id=mCG11004.2 transcript_id=mCT11317.2
FT                   protein_id=mCP21988.1 isoform=CRA_a"
FT                   /protein_id="EDL01356.1"
FT                   /translation="MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVMPSDVRTLLNGF
FT                   AKNPLLTRREGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPS
FT                   VCVEATEKLGEYLRKKGN"
FT   gene            1713965..1715455
FT                   /pseudo
FT                   /locus_tag="mCG_117523"
FT                   /note="gene_id=mCG117523.0"
FT   mRNA            1713965..1715455
FT                   /pseudo
FT                   /locus_tag="mCG_117523"
FT                   /note="gene_id=mCG117523.0 transcript_id=mCT118664.0
FT                   created on 19-APR-2002"
FT   gene            1749095..1758801
FT                   /gene="0610009D07Rik"
FT                   /locus_tag="mCG_11015"
FT                   /note="gene_id=mCG11015.0"
FT   mRNA            join(1749095..1749362,1752137..1752255,1758301..1758439,
FT                   1758557..1758801)
FT                   /gene="0610009D07Rik"
FT                   /locus_tag="mCG_11015"
FT                   /product="RIKEN cDNA 0610009D07"
FT                   /note="gene_id=mCG11015.0 transcript_id=mCT11325.0 created
FT                   on 24-APR-2002"
FT   CDS             join(1749333..1749362,1752137..1752255,1758301..1758439,
FT                   1758557..1758646)
FT                   /codon_start=1
FT                   /gene="0610009D07Rik"
FT                   /locus_tag="mCG_11015"
FT                   /product="RIKEN cDNA 0610009D07"
FT                   /note="gene_id=mCG11015.0 transcript_id=mCT11325.0
FT                   protein_id=mCP21969.1"
FT                   /protein_id="EDL01355.1"
FT                   /translation="MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPI
FT                   RQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTK
FT                   KKEEQLKLLKEKYGINTDPPK"
FT   assembly_gap    1759626..1759645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1764593..1772944)
FT                   /gene="Fkbp1b"
FT                   /locus_tag="mCG_11017"
FT                   /note="gene_id=mCG11017.1"
FT   mRNA            complement(join(1764593..1765200,1766144..1766256,
FT                   1769574..1769621,1772804..1772944))
FT                   /gene="Fkbp1b"
FT                   /locus_tag="mCG_11017"
FT                   /product="FK506 binding protein 1b"
FT                   /note="gene_id=mCG11017.1 transcript_id=mCT11331.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(1765072..1765200,1766144..1766256,
FT                   1769574..1769621,1772804..1772840))
FT                   /codon_start=1
FT                   /gene="Fkbp1b"
FT                   /locus_tag="mCG_11017"
FT                   /product="FK506 binding protein 1b"
FT                   /note="gene_id=mCG11017.1 transcript_id=mCT11331.1
FT                   protein_id=mCP21971.1"
FT                   /db_xref="GOA:A9E3L2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:1336205"
FT                   /db_xref="UniProtKB/TrEMBL:A9E3L2"
FT                   /protein_id="EDL01354.1"
FT                   /translation="MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNK
FT                   PFKFRIGKQEVIKGFEEGTAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVEL
FT                   LSLE"
FT   gene            1774751..1784318
FT                   /gene="BC068281"
FT                   /locus_tag="mCG_11003"
FT                   /note="gene_id=mCG11003.2"
FT   mRNA            join(1774751..1774856,1781532..1784318)
FT                   /gene="BC068281"
FT                   /locus_tag="mCG_11003"
FT                   /product="cDNA sequence BC068281"
FT                   /note="gene_id=mCG11003.2 transcript_id=mCT11318.2 created
FT                   on 15-APR-2003"
FT   CDS             1781551..1783458
FT                   /codon_start=1
FT                   /gene="BC068281"
FT                   /locus_tag="mCG_11003"
FT                   /product="cDNA sequence BC068281"
FT                   /note="gene_id=mCG11003.2 transcript_id=mCT11318.2
FT                   protein_id=mCP21979.3"
FT                   /protein_id="EDL01353.1"
FT                   /translation="MELGNGKLPRTGLNSLNQAVHPTWGLAWTDGNRVVLTDLQLHSGE
FT                   AKFGDSRVIGRFESVCGVCWAPVRTVRSPALLAIQHRKLVSVWQLCPSTAGASKWQASQ
FT                   TSEVRESLPILPRGCVWHPKDAVLTVLTAQGVSIFPNVHQDGSRVKVDVNTKGRVYCAC
FT                   WTLDGQRLVVAIDSNLHSYIWDSSQKSLHSCSFCPVFPVNCSIRSIEATGNSQVAIATE
FT                   LPLHKLCSLNASEALDGPPNGDDGSVHTRPVDEQVATMDMNSGVTVSPFSVPLDLTHIH
FT                   FNPSQAEQSSLICLRKKDYLTGTGQDSSHLILVTFKKAITITKKVAIPGILVPDLIAFN
FT                   LTAELVAVASNTCNVILIYSAAPSSMPNIQQIQLESNERPKGICFLTDRLLLIAVGKQK
FT                   PSEAAFLPSSEYGQYTVRLIVREMAQGSESSGTSAESQGAYSDFTALLSKADREKFTDS
FT                   LSPGSSPLSQGLLLTPNSSTQSGRSGRALIQEIKSPLSPLSSDSVVHETLHRPPWLCPA
FT                   LPRPSRTPEHTSTPELNSPQRENLQKEKETCPLSRELEILSRHLVAMQQYLSELTGFLH
FT                   KEKRVAPAYPPSQDAPYVHLIYQVQSFLRNFHYTGSSGIQSVLPATLWGRWGGRESEAQ
FT                   "
FT   gene            complement(1794960..>1805948)
FT                   /locus_tag="mCG_11011"
FT                   /note="gene_id=mCG11011.2"
FT   mRNA            complement(join(1794960..1795484,1795687..1795762,
FT                   1795968..1796090,1796540..1796716,1797071..1797274,
FT                   1797562..1797671,1797852..1797932,1798193..1798276,
FT                   1798741..1798862,1799015..1799105,1800316..1800446,
FT                   1800535..1800604,1800938..1801061,1801902..1802026,
FT                   1802779..1802904,1805674..>1805948))
FT                   /locus_tag="mCG_11011"
FT                   /product="mCG11011"
FT                   /note="gene_id=mCG11011.2 transcript_id=mCT11324.2 created
FT                   on 04-JUN-2002"
FT   CDS             complement(join(1795476..1795484,1795687..1795762,
FT                   1795968..1796090,1796540..1796716,1797071..1797274,
FT                   1797562..1797671,1797852..1797932,1798193..1798276,
FT                   1798741..1798862,1799015..1799105,1800316..1800446,
FT                   1800535..1800604,1800938..1801061,1801902..1802026,
FT                   1802779..1802904,1805674..>1805946))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11011"
FT                   /product="mCG11011"
FT                   /note="gene_id=mCG11011.2 transcript_id=mCT11324.2
FT                   protein_id=mCP21975.2"
FT                   /protein_id="EDL01352.1"
FT                   /translation="VWRLEFLLGEEDPKLRGPGYPHTAASGGTRLLELPEGGLPAQWDH
FT                   AHLARSTLPIVTALRQQSELNSHGMSVPHGPTPAPVAEPHTQEPGSDKRDGRLSVCTKV
FT                   CYGIGGVPNQVASSASAFYLQLFLLDVAQIPAAQVSLALFGGKVSGAVADPVAGFFINK
FT                   SRRTGSGRLMPWALGCMPLIALAYFFLWFLPPFTSLRGLWYTSFYCLFQALATVPYTAL
FT                   TMILTPSPRERDSATAYRMTMEMAGTLMGATVHGLIVSSAHGSQRCEDTVHPRSPAVSP
FT                   DVARLYCIAAAVVALTYPVCGSLLCLGVKEQPDTSAPASGQGLNFFTGLAITSQHPPYL
FT                   SLVVSFLFISAAVQVEQSYLVLFCTHASKLQDHVQNLVLIILVSAVLSTPLWEWVLQRF
FT                   GKKTSAFGICVMVPFSILLAAVPSAPVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQL
FT                   QHRCGPGVETIFYSSYVFFTKLSGAGALGISTLSLESVRGRGCSKSTKDQGGGKRRFAG
FT                   YEAGACQQAEEVVVTLKVLIGAVPTCMILIGLCILLVGPTPKMPRQDTSSQLSLRRDGI
FT                   TVCTIAQAWEPPSLLLMTAEWLSALFFLYHSSRYMGEGPHKAALSAAPHFMADDVILQQ
FT                   KGSEED"
FT   gene            complement(1808135..>1838842)
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /note="gene_id=mCG117529.2"
FT   mRNA            complement(join(1808135..1812174,1815226..1815384,
FT                   1817124..1817261,1822718..1822824,1825941..1826068,
FT                   1833541..1833593,1838670..1838719))
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, transcript variant
FT                   mCT118670"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT118670.1
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(1808136..1812174,1815226..1815384,
FT                   1817124..1817261,1825941..1826082,1833541..1833593,
FT                   1838670..1838759))
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, transcript variant
FT                   mCT169832"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT169832.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(1810435..1812174,1815226..1815384,
FT                   1817124..1817261,1822718..1822824,1825941..1826082,
FT                   1833541..1833593,1838670..>1838842))
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, transcript variant
FT                   mCT189394"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT189394.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1810757..1812174,1815226..1815384,
FT                   1817124..1817261,1822718..1822824,1825941..1826082,
FT                   1833541..1833593,1838462..1838585))
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, transcript variant
FT                   mCT179714"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT179714.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(1811985..1812174,1815226..1815384,
FT                   1817124..1817261,1822718..1822824,1825941..1826082,
FT                   1833541..1833593,1838670..>1838690))
FT                   /codon_start=1
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT189394.0
FT                   protein_id=mCP110383.0 isoform=CRA_b"
FT                   /protein_id="EDL01349.1"
FT                   /translation="AVGPRPECRKRMKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDC
FT                   EYFVDSLFEEAGKAGAKCLSPTEQKKQVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNS
FT                   IKKGELPSELWGIFDKEEVDVKVEDKKNEVCMSTKPVFQPFSGQGHRLGSATPRIVSKA
FT                   KSVEVDNKSTLSAVSLNNLEPITRIQIWLANGERTVQRFNVSHRVSHIKDFIEKYQGSQ
FT                   RSPPFALATALPFLRFLDETLTLEEADLKNAVIIQRLQKTAEPFRKL"
FT   CDS             complement(join(1811985..1812174,1815226..1815384,
FT                   1817124..1817261,1822718..1822824,1825941..1826082,
FT                   1833541..1833581))
FT                   /codon_start=1
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT179714.0
FT                   protein_id=mCP102636.0 isoform=CRA_a"
FT                   /protein_id="EDL01348.1"
FT                   /translation="MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEA
FT                   GKAGAKCLSPTEQKKQVDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELW
FT                   GIFDKEEVDVKVEDKKNEVCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSVEVDNKSTL
FT                   SAVSLNNLEPITRIQIWLANGERTVQRFNVSHRVSHIKDFIEKYQGSQRSPPFALATAL
FT                   PFLRFLDETLTLEEADLKNAVIIQRLQKTAEPFRKL"
FT   CDS             complement(join(1817229..1817261,1825941..1826082,
FT                   1833541..1833581))
FT                   /codon_start=1
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, isoform CRA_d"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT169832.0
FT                   protein_id=mCP92782.1 isoform=CRA_d"
FT                   /db_xref="GOA:D6RGU9"
FT                   /db_xref="MGI:MGI:2442310"
FT                   /db_xref="UniProtKB/TrEMBL:D6RGU9"
FT                   /protein_id="EDL01351.1"
FT                   /translation="MKEVDNLDSIKEEWACETGPPDSQPLNDNQQKDCEYFVDSLFEEA
FT                   GKAGAKCLSPTEQKKQGITFRIMGNF"
FT   CDS             complement(join(1826059..1826068,1833541..1833581))
FT                   /codon_start=1
FT                   /gene="Ubxd4"
FT                   /locus_tag="mCG_117529"
FT                   /product="UBX domain containing 4, isoform CRA_c"
FT                   /note="gene_id=mCG117529.2 transcript_id=mCT118670.1
FT                   protein_id=mCP89823.2 isoform=CRA_c"
FT                   /protein_id="EDL01350.1"
FT                   /translation="MKEVDNLDSIKEEWTS"
FT   assembly_gap    1829038..1829132
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            1848658..1977000
FT                   /locus_tag="mCG_117533"
FT                   /note="gene_id=mCG117533.3"
FT   mRNA            join(1848658..1849237,1868660..1868811,1870929..1870978,
FT                   1871365..1871518,1873245..1873347,1874428..1874536,
FT                   1876179..1876295,1881792..1881867,1883881..1883979,
FT                   1885818..1885929,1888772..1888887,1889329..1889503,
FT                   1892490..1892578,1897113..1897272,1900438..1900528,
FT                   1905054..1905390,1921958..1922144,1937687..1937872,
FT                   1941334..1941469,1944884..1945080,1949073..1949232,
FT                   1955672..1955794,1958133..1958270,1962583..1963266,
FT                   1965123..1965250,1965558..1965686,1976113..1977000)
FT                   /locus_tag="mCG_117533"
FT                   /product="mCG117533"
FT                   /note="gene_id=mCG117533.3 transcript_id=mCT118674.3
FT                   created on 31-MAR-2004"
FT   CDS             join(1849025..1849237,1868660..1868811,1870929..1870978,
FT                   1871365..1871518,1873245..1873347,1874428..1874536,
FT                   1876179..1876295,1881792..1881867,1883881..1883979,
FT                   1885818..1885929,1888772..1888887,1889329..1889503,
FT                   1892490..1892578,1897113..1897272,1900438..1900528,
FT                   1905054..1905390,1921958..1922144,1937687..1937872,
FT                   1941334..1941469,1944884..1945080,1949073..1949232,
FT                   1955672..1955794,1958133..1958270,1962583..1963266,
FT                   1965123..1965250,1965558..1965686,1976113..1976115)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117533"
FT                   /product="mCG117533"
FT                   /note="gene_id=mCG117533.3 transcript_id=mCT118674.3
FT                   protein_id=mCP89755.3"
FT                   /protein_id="EDL01347.1"
FT                   /translation="MVNTRKSSLRLLGSKSPGPGPGPGAGAGAEPGATGGSSHFISSRT
FT                   RSSKTRAASCPAAKAGGSGGALDEARKAEVDGSLSDSHVSPPAKRTLKQPDSVCKDKSK
FT                   SRSTGQREEWNIPSGQTRLTSQPGATLPNGHSSLSLRSHPLRGEKKGDGDLSCINGDIE
FT                   VRKSCRSRKNRFESVNQSLLFDQLVNSTAEAVLQEMDNINIRRNRRSGEVERLRMWTDT
FT                   EFENMDMYSRVKRRRKSLRRNSYGIQNHHEVSTEGEEEESQEEDGDIEVEEAEGEENDR
FT                   PYNLRQRKTVDRYQAPPIVPAHQKKRENTLFDIHRSPARRSHIRRKKHAIHSSDTTSSD
FT                   EERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFD
FT                   SIGGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECS
FT                   QGDKKVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQ
FT                   DQIHSSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQRA
FT                   RKHILQIHTRDWNPKLSDAFLGELAEKCVGYCGADIKALCTEAALTALRRRYPQIYASS
FT                   HKLQLDVTSIVLSAHDFYHAMQNIVPASQRAVMSSGQALSPIIRPLLERSFNNILAVLQ
FT                   KIFPHAETSQSDKKEGTVNYFFVLSPYHQPTSYRPRLLLSGERGSGQTSHLAPALLHTL
FT                   ERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWDAVSDTVRAT
FT                   FLTLLQDIPSFSPIFLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIEEDRRKFFQE
FT                   LILHQASMAPPRRKHTALRAMEVLPLALPSPPRQLSESEKNRMEDQEENTLRELRLFLR
FT                   DVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLQDI
FT                   DLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRG
FT                   LSVTAEQITPHGAGARKTETRVEEAFRHKQRNPMDAWHNSANKCAFRVRRKSRRRSQWG
FT                   KGIIKKRKVNNLKKDEEDTKFTDYDHTEDRKLLENGEFEVSTDCHEENGEETGDLSMTN
FT                   DESSCDIMDMDQGQRLNSGAGTKENFASTEEESSNESLLVHSSSSLNPEQTSKKEPFLK
FT                   GTCLNGEASTDSSEGIPVLECQNGRVLEVVPLPDGGEKSSSEQKIALEEQLKDKPETWN
FT                   ENRGDAAEKLEVLECSSSEKPEPGPDAEGKETELDREGASKVKKYRKLLLEQAKPTNLE
FT                   LVPEEPSEPAPPLVVDHERLQKLLDLLVDKSNNLTVDQLERLYSLLSQSIYRHRKDYDK
FT                   SQLVE"
FT   assembly_gap    1864389..1864414
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    1897628..1898284
FT                   /estimated_length=657
FT                   /gap_type="unknown"
FT   gene            complement(1977639..>1978482)
FT                   /locus_tag="mCG_1027310"
FT                   /note="gene_id=mCG1027310.1"
FT   mRNA            complement(1977639..>1978482)
FT                   /locus_tag="mCG_1027310"
FT                   /product="mCG1027310"
FT                   /note="gene_id=mCG1027310.1 transcript_id=mCT145014.1
FT                   created on 22-APR-2002"
FT   CDS             complement(1977807..>1978091)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027310"
FT                   /product="mCG1027310"
FT                   /note="gene_id=mCG1027310.1 transcript_id=mCT145014.1
FT                   protein_id=mCP89766.1"
FT                   /protein_id="EDL01346.1"
FT                   /translation="LNQLNQNKRRKEITTLLPKNKTQETYKYIGIREKSSHERMLKKSQ
FT                   VRFKLKTTIYSTAISFKPNAVSSSSGRSQGSHAELLLGWGDIHNLLIIY"
FT   gene            <1999960..2000369
FT                   /locus_tag="mCG_1027336"
FT                   /note="gene_id=mCG1027336.1"
FT   mRNA            join(<1999960..1999989,2000056..2000095,2000138..2000369)
FT                   /locus_tag="mCG_1027336"
FT                   /product="mCG1027336"
FT                   /note="gene_id=mCG1027336.1 transcript_id=mCT145040.1
FT                   created on 21-APR-2002"
FT   CDS             join(<2000059..2000095,2000138..2000259)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027336"
FT                   /product="mCG1027336"
FT                   /note="gene_id=mCG1027336.1 transcript_id=mCT145040.1
FT                   protein_id=mCP89777.0"
FT                   /protein_id="EDL01345.1"
FT                   /translation="PICIAYLPFYYRKEIINACNPMSTMTGLYTWLSCIDIRISEVAWG
FT                   RRTLVSE"
FT   gene            2002050..2002514
FT                   /locus_tag="mCG_1027309"
FT                   /note="gene_id=mCG1027309.0"
FT   mRNA            join(2002050..2002333,2002395..2002514)
FT                   /locus_tag="mCG_1027309"
FT                   /product="mCG1027309"
FT                   /note="gene_id=mCG1027309.0 transcript_id=mCT145013.0
FT                   created on 24-APR-2002"
FT   CDS             join(2002146..2002333,2002395..2002455)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027309"
FT                   /product="mCG1027309"
FT                   /note="gene_id=mCG1027309.0 transcript_id=mCT145013.0
FT                   protein_id=mCP89763.0"
FT                   /protein_id="EDL01344.1"
FT                   /translation="MRRETEFQCHRGVLLTTNTSLGGRHTPMLTFALPQAVRNLCSSPW
FT                   VHTCTLFDINTLNDIQCISVSCQVGATLVMLEADACR"
FT   gene            complement(2003623..2214698)
FT                   /locus_tag="mCG_117527"
FT                   /note="gene_id=mCG117527.1"
FT   mRNA            complement(join(2003623..2004256,2006811..2006955,
FT                   2007213..2007406,2013455..2013635,2013838..2014020,
FT                   2014161..2014359,2016405..2016664,2017736..2017938,
FT                   2025608..2025746,2060573..2061085,2063717..2063858,
FT                   2133279..2133608,2214582..2214698))
FT                   /locus_tag="mCG_117527"
FT                   /product="mCG117527"
FT                   /note="gene_id=mCG117527.1 transcript_id=mCT118668.1
FT                   created on 22-APR-2002"
FT   CDS             complement(join(2004073..2004256,2006811..2006955,
FT                   2007213..2007406,2013455..2013635,2013838..2014020,
FT                   2014161..2014359,2016405..2016664,2017736..2017938,
FT                   2025608..2025746,2060573..2061085,2063717..2063858,
FT                   2133279..2133563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117527"
FT                   /product="mCG117527"
FT                   /note="gene_id=mCG117527.1 transcript_id=mCT118668.1
FT                   protein_id=mCP89821.1"
FT                   /protein_id="EDL01343.1"
FT                   /translation="MSRHHSRFERDYRIGWDRREWSVNGTHGATSVCSVTSGAGGSTAS
FT                   SLSARPGLLPLPVVPSRLPTPATAPAPCTTGSSEAITSLVVSSASAATTKAPGISKADN
FT                   QSQGLTTSIRWGQTPVNQSTPWDTDEPPSKQMRESDNPGTGPWVTTVAAGNQPSLITHS
FT                   YGVTQPPTFSPAVNVQAPVIGVTPSLPPHVGPQLPLIPGHYSLPQPPSQPLSSVVVNMP
FT                   AQALYASPQPLAVSTLPGVGQVSRPGPTPVGNGHMAGPLLPPPPPAQPSAALPSSVPAT
FT                   NGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPKEMLKELNQQRRAKAFTDLKIVVEGREF
FT                   EVHQNVLASCSLYFKDLIQRSVQDSSQSSREKLELVLSNLQADVLELLLEFVYTGSLVI
FT                   DSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAF
FT                   ALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAA
FT                   ELLAAVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRP
FT                   RLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAG
FT                   DNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVA
FT                   GNVDHVERYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVP
FT                   QTNTWSFIESPMIDNKYAPAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQ
FT                   FCSAVVLDGKIYATGGIVSSEGPALGNMEAYEPTTNTWTLLPHMPCPVFRHGCVVIKKY
FT                   IQSG"
FT   assembly_gap    2004785..2004804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2047197..2047499
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    2067226..2067324
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    2092326..2092345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2145563..2145582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2224942..2225763
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    2280203..2280271
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2293278..2293297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2298690..2298803
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            2299228..2339851
FT                   /locus_tag="mCG_53948"
FT                   /note="gene_id=mCG53948.1"
FT   mRNA            join(2299228..2299889,2338448..2339851)
FT                   /locus_tag="mCG_53948"
FT                   /product="mCG53948"
FT                   /note="gene_id=mCG53948.1 transcript_id=mCT54131.1 created
FT                   on 21-APR-2002"
FT   assembly_gap    2302296..2302315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2303457..2304430
FT                   /estimated_length=974
FT                   /gap_type="unknown"
FT   assembly_gap    2316306..2316325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2318561..2318604
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    2322673..2322702
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   CDS             2338449..2338790
FT                   /codon_start=1
FT                   /locus_tag="mCG_53948"
FT                   /product="mCG53948"
FT                   /note="gene_id=mCG53948.1 transcript_id=mCT54131.1
FT                   protein_id=mCP42022.2"
FT                   /db_xref="GOA:Q8BT22"
FT                   /db_xref="MGI:MGI:1919919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BT22"
FT                   /protein_id="EDL01342.1"
FT                   /translation="MKHPCHHESSVWRSMRRLGLLGSAFSCFSSQQETIWISQSCRRKR
FT                   HTSNGPNSSSTWWGQPQKPCKLINEKKVFCCKAPRPGDYLIDKIIIEKITDGYAIISFA
FT                   WTALPRPLF"
FT   assembly_gap    2386657..2386996
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    2403488..2406601
FT                   /estimated_length=3114
FT                   /gap_type="unknown"
FT   assembly_gap    2411060..2411079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2413664..2413809
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2420636..2420696
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    2446985..2447004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2489562..2490410
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    2496448..2497361
FT                   /estimated_length=914
FT                   /gap_type="unknown"
FT   assembly_gap    2503165..2503184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2512173..2513278)
FT                   /pseudo
FT                   /locus_tag="mCG_14373"
FT                   /note="gene_id=mCG14373.1"
FT   mRNA            complement(2512173..2513278)
FT                   /pseudo
FT                   /locus_tag="mCG_14373"
FT                   /note="gene_id=mCG14373.1 transcript_id=mCT16525.1 created
FT                   on 22-APR-2002"
FT   gene            complement(2513813..2514137)
FT                   /pseudo
FT                   /locus_tag="mCG_1027319"
FT                   /note="gene_id=mCG1027319.1"
FT   mRNA            complement(2513813..2514137)
FT                   /pseudo
FT                   /locus_tag="mCG_1027319"
FT                   /note="gene_id=mCG1027319.1 transcript_id=mCT145023.1
FT                   created on 22-APR-2002"
FT   assembly_gap    2514508..2514527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2540293..2540840
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   gene            2561708..2562085
FT                   /locus_tag="mCG_51120"
FT                   /note="gene_id=mCG51120.2"
FT   mRNA            2561708..2562085
FT                   /locus_tag="mCG_51120"
FT                   /product="mCG51120"
FT                   /note="gene_id=mCG51120.2 transcript_id=mCT51303.1 created
FT                   on 19-APR-2002"
FT   CDS             2561770..2562024
FT                   /codon_start=1
FT                   /locus_tag="mCG_51120"
FT                   /product="mCG51120"
FT                   /note="gene_id=mCG51120.2 transcript_id=mCT51303.1
FT                   protein_id=mCP42034.1"
FT                   /protein_id="EDL01341.1"
FT                   /translation="MDPNCSCASDRSCCCIGSCKCKQCRCTSCKKSCCSCCPVGCAKCC
FT                   QGCIWQRGFGQVQLLRLEWGRLHSCVDSICRNLAFFVQP"
FT   assembly_gap    2566071..2566090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2590889..2590914
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2606682..2606801
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2610275..2610542
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    2639129..2639148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2639971..2640032
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2643173..2643192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2646201..2646220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2648047..2648066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2649368..2649387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2652872..2652996
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    2693824..2693911
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2694157..2694302
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2727805..2727824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2736000..2778336
FT                   /locus_tag="mCG_1027331"
FT                   /note="gene_id=mCG1027331.0"
FT   mRNA            join(<2736000..2736081,2776532..2776600,2778008..2778336)
FT                   /locus_tag="mCG_1027331"
FT                   /product="mCG1027331"
FT                   /note="gene_id=mCG1027331.0 transcript_id=mCT145035.0
FT                   created on 19-APR-2002"
FT   CDS             join(<2736000..2736081,2776532..2776600,2778008..2778024)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027331"
FT                   /product="mCG1027331"
FT                   /note="gene_id=mCG1027331.0 transcript_id=mCT145035.0
FT                   protein_id=mCP89768.0"
FT                   /protein_id="EDL01340.1"
FT                   /translation="VLVVPVPTMYIRMTSNSQRSTCFCLLKEVMCTSLLIEGESKEGTQ
FT                   ATITSGWSVQ"
FT   assembly_gap    2752388..2753112
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    2783050..2783428
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    2787089..2787197
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    2795236..2795255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2800869..2800905
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2813892..2814170
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    2832645..2832858
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            complement(2848881..2865263)
FT                   /locus_tag="mCG_146994"
FT                   /note="gene_id=mCG146994.0"
FT   mRNA            complement(join(2848881..2849617,2864482..2865263))
FT                   /locus_tag="mCG_146994"
FT                   /product="mCG146994"
FT                   /note="gene_id=mCG146994.0 transcript_id=mCT187257.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    2853827..2853846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(2865066..2865212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146994"
FT                   /product="mCG146994"
FT                   /note="gene_id=mCG146994.0 transcript_id=mCT187257.0
FT                   protein_id=mCP109654.0"
FT                   /protein_id="EDL01339.1"
FT                   /translation="MRVGDKACTFSVILIRVCTSLRDPSADPPSNVSSLPTGDFIIKIE
FT                   CNL"
FT   assembly_gap    2873715..2873734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2935697..2938393
FT                   /estimated_length=2697
FT                   /gap_type="unknown"
FT   assembly_gap    2943826..2943845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2990966..2991470
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    3003735..3003754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3049150..3049169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3064901..3065317
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    3065992..3066225
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    3077861..3077957
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3093701..3094717
FT                   /estimated_length=1017
FT                   /gap_type="unknown"
FT   assembly_gap    3108472..3108607
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    3140618..3141211
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    3158669..3158693
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(3198140..3199461)
FT                   /pseudo
FT                   /locus_tag="mCG_53327"
FT                   /note="gene_id=mCG53327.2"
FT   mRNA            complement(3198140..3199461)
FT                   /pseudo
FT                   /locus_tag="mCG_53327"
FT                   /note="gene_id=mCG53327.2 transcript_id=mCT53510.2 created
FT                   on 22-APR-2002"
FT   assembly_gap    3225338..3225357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3254220..3254239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3269505..3269666
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3270921..3271004
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    3285058..3285077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3287633..3287652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3314215..3314234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3352713..3352748
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    3378077..3378096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3381875..3381894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3419582..>3420064)
FT                   /locus_tag="mCG_48620"
FT                   /note="gene_id=mCG48620.2"
FT   mRNA            complement(3419582..>3420064)
FT                   /locus_tag="mCG_48620"
FT                   /product="mCG48620"
FT                   /note="gene_id=mCG48620.2 transcript_id=mCT48803.2 created
FT                   on 22-APR-2002"
FT   CDS             complement(3419621..3420064)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48620"
FT                   /product="mCG48620"
FT                   /note="gene_id=mCG48620.2 transcript_id=mCT48803.2
FT                   protein_id=mCP42044.2"
FT                   /protein_id="EDL01338.1"
FT                   /translation="MKKSPLEWEDYVYKEVMVIACEKEYKGWLLTTDPVSANIVLVNFL
FT                   EDGRLSVTGIMGHSVQTVETISEGHHRVCETLMHVFAAGDCKGYSPEDLEEKRTSLKKW
FT                   LEKNHIPVTEQGMQKGLCVAGVLTIEPPYSPENCSSSNEIILF"
FT   assembly_gap    3427846..3427865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3435189..3441964
FT                   /estimated_length=6776
FT                   /gap_type="unknown"
FT   assembly_gap    3455711..3455745
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3471374..3472159
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    3528695..3529484
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   assembly_gap    3535802..3535821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3543747..3543913
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    3550605..3550624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3585537..3587186
FT                   /estimated_length=1650
FT                   /gap_type="unknown"
FT   assembly_gap    3602330..3602349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3605166..3605185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3614478..3614579
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    3625430..3625449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3629368..3630858
FT                   /estimated_length=1491
FT                   /gap_type="unknown"
FT   assembly_gap    3632375..3632394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3654744..3654763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3691045..3695681
FT                   /estimated_length=4637
FT                   /gap_type="unknown"
FT   assembly_gap    3704284..3704347
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    3706102..3706288
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    3726977..3726996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3743831..3743850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3759362..3759758
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    3797174..3797698
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    3880210..3880348
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            complement(3886302..3886601)
FT                   /pseudo
FT                   /locus_tag="mCG_49291"
FT                   /note="gene_id=mCG49291.1"
FT   mRNA            complement(3886302..3886601)
FT                   /pseudo
FT                   /locus_tag="mCG_49291"
FT                   /note="gene_id=mCG49291.1 transcript_id=mCT49474.1 created
FT                   on 22-APR-2002"
FT   assembly_gap    3914645..3914885
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    3944569..3944588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3958421..3958440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3962012..3962479
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    4031215..4033310
FT                   /estimated_length=2096
FT                   /gap_type="unknown"
FT   assembly_gap    4042656..4043524
FT                   /estimated_length=869
FT                   /gap_type="unknown"
FT   assembly_gap    4044214..4044233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4057566..4057590
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    4063910..4066245
FT                   /estimated_length=2336
FT                   /gap_type="unknown"
FT   assembly_gap    4092313..4093099
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    4095603..4095622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4127840..4127959
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    4184213..4184340
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    4191395..4191681
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    4203034..4203053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4241581..4241702
FT                   /estimated_length=122
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01097052.1:1..3778),gap(1500),
CO   complement(AAHY01097053.1:1..3448),gap(334),
CO   complement(AAHY01097054.1:1..11653),gap(20),
CO   complement(AAHY01097055.1:1..19055),gap(20),
CO   complement(AAHY01097056.1:1..79133),gap(175),
CO   complement(AAHY01097057.1:1..33451),gap(20),
CO   complement(AAHY01097058.1:1..50614),gap(20),AAHY01097059.1:1..37855,
CO   gap(122),complement(AAHY01097060.1:1..4019),gap(223),
CO   complement(AAHY01097061.1:1..2318),gap(20),
CO   complement(AAHY01097062.1:1..968),gap(1132),AAHY01097063.1:1..8661,
CO   gap(4514),complement(AAHY01097064.1:1..5165),gap(20),
CO   AAHY01097065.1:1..1070,gap(174),complement(AAHY01097066.1:1..5803),
CO   gap(140),AAHY01097067.1:1..20054,gap(68),AAHY01097068.1:1..18402,gap(167),
CO   AAHY01097069.1:1..3249,gap(20),AAHY01097070.1:1..5258,gap(33),
CO   complement(AAHY01097071.1:1..17428),gap(207),AAHY01097072.1:1..33938,
CO   gap(83),AAHY01097073.1:1..2818,gap(370),AAHY01097074.1:1..18384,gap(144),
CO   AAHY01097075.1:1..1405,gap(481),AAHY01097076.1:1..726,gap(195),
CO   AAHY01097077.1:1..40317,gap(175),AAHY01097078.1:1..37235,gap(20),
CO   AAHY01097079.1:1..14397,gap(163),complement(AAHY01097080.1:1..22064),
CO   gap(20),AAHY01097081.1:1..19160,gap(20),AAHY01097082.1:1..14390,gap(20),
CO   complement(AAHY01097083.1:1..46237),gap(145),AAHY01097084.1:1..54478,
CO   gap(20),complement(AAHY01097085.1:1..4921),gap(77),
CO   complement(AAHY01097086.1:1..17458),gap(146),
CO   complement(AAHY01097087.1:1..16554),gap(53),AAHY01097088.1:1..22969,
CO   gap(165),AAHY01097089.1:1..8768,gap(61),
CO   complement(AAHY01097090.1:1..15707),gap(1436),
CO   complement(AAHY01097091.1:1..1413),gap(20),
CO   complement(AAHY01097092.1:1..2623),gap(252),AAHY01097093.1:1..18907,
CO   gap(20),complement(AAHY01097094.1:1..3310),gap(20),AAHY01097095.1:1..9418,
CO   gap(20),complement(AAHY01097096.1:1..10961),gap(73),AAHY01097097.1:1..9384,
CO   gap(20),complement(AAHY01097098.1:1..21894),gap(98),
CO   complement(AAHY01097099.1:1..4211),gap(884),
CO   complement(AAHY01097100.1:1..30945),gap(20),
CO   complement(AAHY01097101.1:1..4719),gap(421),
CO   complement(AAHY01097102.1:1..15249),gap(20),
CO   complement(AAHY01097103.1:1..39666),gap(319),
CO   complement(AAHY01097104.1:1..15201),gap(20),
CO   complement(AAHY01097105.1:1..3011),gap(187),
CO   complement(AAHY01097106.1:1..16444),gap(20),AAHY01097107.1:1..2544,gap(20),
CO   AAHY01097108.1:1..18685,gap(72),complement(AAHY01097109.1:1..7211),
CO   gap(511),complement(AAHY01097110.1:1..33124),gap(139),
CO   complement(AAHY01097111.1:1..8955),gap(145),
CO   complement(AAHY01097112.1:1..3932),gap(83),
CO   complement(AAHY01097113.1:1..33483),gap(104),AAHY01097114.1:1..26156,
CO   gap(472),complement(AAHY01097115.1:1..13504),gap(332),
CO   complement(AAHY01097116.1:1..19445),gap(789),
CO   complement(AAHY01097117.1:1..20099),gap(20),
CO   complement(AAHY01097118.1:1..11651),gap(2499),
CO   complement(AAHY01097119.1:1..867),gap(2827),
CO   complement(AAHY01097120.1:1..10340),gap(20),
CO   complement(AAHY01097121.1:1..13579),gap(20),
CO   complement(AAHY01097122.1:1..7472),gap(36),
CO   complement(AAHY01097123.1:1..5794),gap(286),
CO   complement(AAHY01097124.1:1..18020),gap(614),
CO   complement(AAHY01097125.1:1..33027),gap(41),AAHY01097126.1:1..15327,
CO   gap(20),complement(AAHY01097127.1:1..33286),gap(20),
CO   complement(AAHY01097128.1:1..1705),gap(210),
CO   complement(AAHY01097129.1:1..3781),gap(45),
CO   complement(AAHY01097130.1:1..1538),gap(20),
CO   complement(AAHY01097131.1:1..5864),gap(2486),AAHY01097132.1:1..5203,
CO   gap(102),complement(AAHY01097133.1:1..20190),gap(20),
CO   complement(AAHY01097134.1:1..1815),gap(102),
CO   complement(AAHY01097135.1:1..13908),gap(167),
CO   complement(AAHY01097136.1:1..5634),gap(130),
CO   complement(AAHY01097137.1:1..21917),gap(20),AAHY01097138.1:1..5943,gap(20),
CO   complement(AAHY01097139.1:1..25812),gap(770),AAHY01097140.1:1..25617,
CO   gap(20),complement(AAHY01097141.1:1..21701),gap(20),
CO   complement(AAHY01097142.1:1..5496),gap(1313),
CO   complement(AAHY01097143.1:1..47289),gap(20),AAHY01097144.1:1..5650,
CO   gap(115),complement(AAHY01097145.1:1..8840),gap(136),
CO   complement(AAHY01097146.1:1..2828),gap(20),
CO   complement(AAHY01097147.1:1..38369),gap(20),
CO   complement(AAHY01097148.1:1..8429),gap(287),
CO   complement(AAHY01097149.1:1..3742),gap(23),
CO   complement(AAHY01097150.1:1..13785),gap(102),AAHY01097151.1:1..2819,
CO   gap(20),AAHY01097152.1:1..28234,gap(20),
CO   complement(AAHY01097153.1:1..18356),gap(20),
CO   complement(AAHY01097154.1:1..45098),gap(272),
CO   complement(AAHY01097155.1:1..3716),gap(20),
CO   complement(AAHY01097156.1:1..8543),gap(78),
CO   complement(AAHY01097157.1:1..59833),gap(20),
CO   complement(AAHY01097158.1:1..69392),gap(95),AAHY01097159.1:1..35256,
CO   gap(26),complement(AAHY01097160.1:1..33213),gap(657),
CO   complement(AAHY01097161.1:1..106500),gap(20),
CO   complement(AAHY01097162.1:1..42392),gap(303),AAHY01097163.1:1..19726,
CO   gap(99),complement(AAHY01097164.1:1..25001),gap(20),
CO   complement(AAHY01097165.1:1..53217),gap(20),
CO   complement(AAHY01097166.1:1..79359),gap(822),
CO   complement(AAHY01097167.1:1..54439),gap(69),
CO   complement(AAHY01097168.1:1..13006),gap(20),
CO   complement(AAHY01097169.1:1..5392),gap(114),AAHY01097170.1:1..3492,gap(20),
CO   AAHY01097171.1:1..1141,gap(974),complement(AAHY01097172.1:1..11875),
CO   gap(20),complement(AAHY01097173.1:1..2235),gap(44),AAHY01097174.1:1..4068,
CO   gap(30),complement(AAHY01097175.1:1..63954),gap(340),
CO   complement(AAHY01097176.1:1..16491),gap(3114),
CO   complement(AAHY01097177.1:1..4458),gap(20),
CO   complement(AAHY01097178.1:1..2584),gap(146),
CO   complement(AAHY01097179.1:1..6826),gap(61),
CO   complement(AAHY01097180.1:1..26288),gap(20),
CO   complement(AAHY01097181.1:1..42557),gap(849),
CO   complement(AAHY01097182.1:1..6037),gap(914),
CO   complement(AAHY01097183.1:1..5803),gap(20),
CO   complement(AAHY01097184.1:1..11323),gap(20),
CO   complement(AAHY01097185.1:1..25765),gap(548),
CO   complement(AAHY01097186.1:1..25230),gap(20),
CO   complement(AAHY01097187.1:1..24798),gap(26),
CO   complement(AAHY01097188.1:1..15767),gap(120),
CO   complement(AAHY01097189.1:1..3473),gap(268),
CO   complement(AAHY01097190.1:1..28586),gap(20),
CO   complement(AAHY01097191.1:1..822),gap(62),AAHY01097192.1:1..3140,gap(20),
CO   AAHY01097193.1:1..3008,gap(20),complement(AAHY01097194.1:1..1826),gap(20),
CO   AAHY01097195.1:1..1301,gap(20),AAHY01097196.1:1..3484,gap(125),
CO   complement(AAHY01097197.1:1..40827),gap(88),AAHY01097198.1:1..245,gap(146),
CO   AAHY01097199.1:1..33502,gap(20),complement(AAHY01097200.1:1..24563),
CO   gap(725),complement(AAHY01097201.1:1..29937),gap(379),
CO   AAHY01097202.1:1..3660,gap(109),complement(AAHY01097203.1:1..8038),gap(20),
CO   complement(AAHY01097204.1:1..5613),gap(37),
CO   complement(AAHY01097205.1:1..12986),gap(279),
CO   complement(AAHY01097206.1:1..18474),gap(214),AAHY01097207.1:1..20968,
CO   gap(20),AAHY01097208.1:1..19868,gap(20),
CO   complement(AAHY01097209.1:1..61962),gap(2697),
CO   complement(AAHY01097210.1:1..5432),gap(20),AAHY01097211.1:1..47120,
CO   gap(505),complement(AAHY01097212.1:1..12264),gap(20),
CO   complement(AAHY01097213.1:1..45395),gap(20),AAHY01097214.1:1..15731,
CO   gap(417),AAHY01097215.1:1..674,gap(234),AAHY01097216.1:1..11635,gap(97),
CO   AAHY01097217.1:1..15743,gap(1017),AAHY01097218.1:1..13754,gap(136),
CO   complement(AAHY01097219.1:1..32010),gap(594),
CO   complement(AAHY01097220.1:1..17457),gap(25),
CO   complement(AAHY01097221.1:1..66644),gap(20),
CO   complement(AAHY01097222.1:1..28862),gap(20),
CO   complement(AAHY01097223.1:1..15265),gap(162),AAHY01097224.1:1..1254,
CO   gap(84),AAHY01097225.1:1..14053,gap(20),AAHY01097226.1:1..2555,gap(20),
CO   AAHY01097227.1:1..26562,gap(20),complement(AAHY01097228.1:1..38478),
CO   gap(36),complement(AAHY01097229.1:1..25328),gap(20),AAHY01097230.1:1..3778,
CO   gap(20),complement(AAHY01097231.1:1..45951),gap(20),AAHY01097232.1:1..7323,
CO   gap(6776),complement(AAHY01097233.1:1..13746),gap(35),
CO   complement(AAHY01097234.1:1..15628),gap(786),
CO   complement(AAHY01097235.1:1..56535),gap(790),
CO   complement(AAHY01097236.1:1..6317),gap(20),
CO   complement(AAHY01097237.1:1..7925),gap(167),
CO   complement(AAHY01097238.1:1..6691),gap(20),
CO   complement(AAHY01097239.1:1..34912),gap(1650),
CO   complement(AAHY01097240.1:1..15143),gap(20),
CO   complement(AAHY01097241.1:1..2816),gap(20),
CO   complement(AAHY01097242.1:1..9292),gap(102),
CO   complement(AAHY01097243.1:1..10850),gap(20),
CO   complement(AAHY01097244.1:1..3918),gap(1491),
CO   complement(AAHY01097245.1:1..1516),gap(20),
CO   complement(AAHY01097246.1:1..22349),gap(20),
CO   complement(AAHY01097247.1:1..36281),gap(4637),AAHY01097248.1:1..8602,
CO   gap(64),AAHY01097249.1:1..1754,gap(187),
CO   complement(AAHY01097250.1:1..20688),gap(20),
CO   complement(AAHY01097251.1:1..16834),gap(20),
CO   complement(AAHY01097252.1:1..15511),gap(397),
CO   complement(AAHY01097253.1:1..37415),gap(525),
CO   complement(AAHY01097254.1:1..82511),gap(139),
CO   complement(AAHY01097255.1:1..34296),gap(241),
CO   complement(AAHY01097256.1:1..29683),gap(20),
CO   complement(AAHY01097257.1:1..13832),gap(20),
CO   complement(AAHY01097258.1:1..3571),gap(468),
CO   complement(AAHY01097259.1:1..68735),gap(2096),
CO   complement(AAHY01097260.1:1..9345),gap(869),
CO   complement(AAHY01097261.1:1..689),gap(20),
CO   complement(AAHY01097262.1:1..13332),gap(25),
CO   complement(AAHY01097263.1:1..6319),gap(2336),
CO   complement(AAHY01097264.1:1..26067),gap(787),
CO   complement(AAHY01097265.1:1..2503),gap(20),
CO   complement(AAHY01097266.1:1..32217),gap(120),
CO   complement(AAHY01097267.1:1..56253),gap(128),
CO   complement(AAHY01097268.1:1..7054),gap(287),
CO   complement(AAHY01097269.1:1..11352),gap(20),
CO   complement(AAHY01097270.1:1..38527),gap(122),
CO   complement(AAHY01097271.1:1..28305))
//