
ID   CH466620; SV 1; linear; genomic DNA; CON; MUS; 4812833 BP.
AC   CH466620;
PR   Project:PRJNA11785;
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
DE   Mus musculus 232000009837791 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-4812833
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-4812833
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 1c1800f5d3b9b0ce0626a98d880b45f5.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000211.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000005628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005774; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015522; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015750; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027871; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028099; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028100; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028111; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028148; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038374; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038550; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038861; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038902; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043468; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049288; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049908; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051392; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053192; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053769; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061482; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063954; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064288; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068876; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069266; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069267; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069273; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069274; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069305; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069306; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074403; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000081058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093769; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096010; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000099583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000100210; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000105734; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020303; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020308; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020344; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020345; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020348; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020352; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020358; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020363; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020364; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027545; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027548; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027557; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027560; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027562; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027563; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027568; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027585; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027597; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027599; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027604; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027610; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027613; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027614; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027623; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027630; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027631; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027637; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027640; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027642; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027645; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027648; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027660; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020249; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020259; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020260; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020267; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020301; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020302; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020303; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020305; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020312; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020313; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020314; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027504; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027507; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027516; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027517; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027521; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027527; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027534; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027544; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027547; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027555; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027556; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027563; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027569; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027571; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027572; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027573; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027574; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027575; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027576; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027585; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027592; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027593; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027599; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027602; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027604; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027607; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027610; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020223; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020224; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020232; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020233; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020237; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020273; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020276; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020277; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020282; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020283; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020289; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020294; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027472; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027485; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027486; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027488; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027489; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027494; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027501; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027511; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027514; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027523; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027530; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027536; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027538; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027539; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027540; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027541; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027542; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027543; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027552; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027559; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027560; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027566; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027569; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027571; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027574; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027577; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027584; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027585; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020237; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020238; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020247; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020254; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020287; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020289; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020292; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020293; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020299; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020300; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020305; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020308; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020310; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020311; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020312; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027518; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027531; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027533; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027534; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027539; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027546; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027556; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027559; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027568; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027570; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027575; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027581; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027583; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027584; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027585; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027586; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027595; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027602; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027603; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027609; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027612; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027614; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027617; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027620; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027631; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027632; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020042; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020056; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020057; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020061; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020096; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020100; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020105; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020110; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020114; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020115; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027251; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027254; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027263; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027264; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027266; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027267; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027272; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027289; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027292; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027300; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027301; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027303; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027314; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027316; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027317; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027318; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027327; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027334; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027335; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027341; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027344; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027346; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027349; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027352; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027360; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027361; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020680; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020681; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020685; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020686; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020693; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020732; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020735; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020743; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020748; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027964; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027967; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027978; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027981; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027982; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027987; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027989; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027994; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028004; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028007; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028016; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028018; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028023; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028029; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028031; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028032; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028041; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028048; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028049; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028055; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028058; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028060; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028063; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028066; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028074; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028075; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031868; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019575; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019576; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019580; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019585; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019586; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019615; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019618; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019620; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019622; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019627; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019634; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019635; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026699; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026702; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026711; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026712; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026716; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026717; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026722; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026739; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026751; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026753; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026758; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026764; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026766; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026767; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026769; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026771; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026782; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026790; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026796; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026799; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026801; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026804; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026807; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026817; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020003; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020004; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020011; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020015; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020047; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020049; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020051; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020052; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020056; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020061; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0020070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027230; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027239; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027240; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027244; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027249; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027266; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027269; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027278; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027280; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027285; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027290; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027293; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027302; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027309; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027310; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027315; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027319; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027321; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027324; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027327; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027335; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027336; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031088; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020124; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020133; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020134; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020140; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020173; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020177; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020183; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020192; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020194; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020195; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0020196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027369; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027378; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027382; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027383; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027388; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027395; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027408; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027416; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027417; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027419; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027424; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027430; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027432; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027433; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027434; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027435; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027436; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027445; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027452; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027453; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027459; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027464; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027467; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027470; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027478; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027479; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020108; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020109; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020120; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020121; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020126; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020162; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020163; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020168; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020173; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020178; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027336; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027339; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027353; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027354; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027359; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027366; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027376; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027379; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027388; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027390; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027395; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027401; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027403; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027404; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027405; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027414; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027421; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027422; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027428; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027431; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027433; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027436; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027439; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027443; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027447; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031196; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020196; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020197; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020203; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020204; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020212; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020246; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020249; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020251; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020252; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020255; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020256; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020263; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020267; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020268; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027477; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027489; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027491; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027492; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027497; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027504; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027514; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027526; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027528; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027533; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027540; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027541; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027557; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027558; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027564; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027567; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027569; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027572; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027575; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027586; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020142; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020157; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020196; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020201; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020204; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020205; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020206; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020207; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027363; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027366; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027377; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027378; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027380; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027381; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027388; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027403; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027406; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027414; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027415; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027417; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027422; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027428; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027430; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027431; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027440; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027447; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027448; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027454; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027457; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027459; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027462; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027465; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031236; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020720; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020725; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020762; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020767; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020768; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020783; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020789; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020790; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020791; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028018; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028032; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028033; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028035; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028036; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028043; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028048; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028058; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028061; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028069; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028070; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028072; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028077; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028083; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028085; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028086; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028095; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028102; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028103; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028109; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028112; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028114; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028117; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028120; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028130; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031900; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019335; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019341; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019342; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019374; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019376; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019377; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019381; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019384; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019387; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026427; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026430; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026442; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026444; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026445; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026450; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026457; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026467; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026470; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026478; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026479; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026481; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026486; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026492; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026496; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026514; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026515; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026521; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026524; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026526; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026532; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026544; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019632; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019633; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019641; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019645; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019646; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019674; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019676; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019678; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019680; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019681; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019685; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019688; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019691; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019692; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019693; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026782; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026785; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026793; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026794; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026799; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026804; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026811; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026821; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026824; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026833; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026835; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026846; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026849; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026850; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026851; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026867; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026868; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026874; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026877; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026879; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026882; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026885; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030589; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000005769; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015664; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029729; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029772; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050342; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090750; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091703; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102749; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107251; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107260; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153263; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159739; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170847; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196025; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200387; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036446; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036447; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036457; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036458; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036518; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036522; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036530; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036537; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036538; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036539; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062186; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062194; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062241; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062256; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062272; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062289; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062324; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062365; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062426; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062497; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062508; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062532; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062556; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062560; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062578; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062609; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062613; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062641; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062661; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062666; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062678; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062719; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0036373; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036374; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036387; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036388; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036404; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036444; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036446; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036454; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036459; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036460; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036461; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062219; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062227; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062272; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062276; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062314; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062349; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062388; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062450; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062457; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062524; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062535; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062560; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062584; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062586; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062589; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062590; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062591; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062609; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062640; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062644; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062691; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062695; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062707; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062723; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062747; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0036339; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036340; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036349; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036350; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036363; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036405; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036408; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036409; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036415; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036423; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036430; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036431; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062149; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062157; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062215; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062218; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062250; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062285; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062324; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062385; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062392; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062456; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062467; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062492; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062516; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062518; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062519; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062521; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062523; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062541; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062572; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062576; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062622; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062626; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062638; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062654; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062678; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036383; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036384; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036395; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036396; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036412; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036451; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036456; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036457; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036464; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036471; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036476; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036478; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036479; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036480; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062145; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062153; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062208; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062223; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062240; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062275; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062314; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062376; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062383; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062446; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062450; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062461; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062508; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062510; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062511; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062512; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062513; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062531; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062562; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062566; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062592; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062611; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062615; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062625; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062641; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062667; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062670; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036144; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036145; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036162; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036163; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036217; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036220; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036221; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036222; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036225; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036226; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036238; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036240; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0036241; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061837; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061845; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061890; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061909; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061926; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061999; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062059; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062129; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062133; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062144; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062195; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062196; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062197; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062215; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062250; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062277; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062297; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062301; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062313; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062329; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062351; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062354; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036854; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036855; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036877; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036923; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036924; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036928; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036936; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036943; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036944; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062639; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062703; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062738; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062773; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062787; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062813; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062874; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062881; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062946; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062957; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062981; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063006; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063008; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063009; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063058; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063062; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063089; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063109; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063123; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063139; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063161; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063164; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0081156; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036088; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036089; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036093; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036107; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036140; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036144; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036146; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036148; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036155; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036164; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036165; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062127; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062135; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062185; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062189; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062211; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062228; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062263; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062304; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062363; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062370; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062437; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062448; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062470; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062493; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062495; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062496; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062497; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062498; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062499; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062500; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062520; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062551; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062555; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062581; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062607; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062620; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062637; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062662; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0036051; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036052; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036061; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036075; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036113; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036115; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036117; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036121; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036129; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036139; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0036140; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061803; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061811; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061859; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061863; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061880; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061932; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061970; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062031; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062103; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062114; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062140; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062166; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062215; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062219; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062244; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062264; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062268; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062280; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062296; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062316; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0062319; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0080244; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0036196; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036197; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036209; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036210; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036268; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036273; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036274; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036282; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036287; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036289; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036290; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0036291; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061905; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061913; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061966; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061987; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062039; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062078; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062139; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062146; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062209; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062213; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062224; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062248; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062272; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062274; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062275; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062276; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062277; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062278; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062296; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062331; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062376; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062392; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062408; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062430; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0062433; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0036179; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036180; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036193; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036194; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036208; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036249; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036250; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036251; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036252; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036256; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036263; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036270; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036271; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036272; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061890; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061962; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061979; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062014; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062056; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062189; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062200; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062225; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062249; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062251; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062252; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062253; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062271; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062302; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062332; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062352; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062357; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062369; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062385; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062395; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0062400; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0080286; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0036333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036334; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036340; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036341; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036358; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036398; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036403; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036407; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036417; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036423; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036424; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062046; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062054; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062113; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062128; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062145; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062180; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062221; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062281; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062351; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062362; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062384; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062409; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062428; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062459; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062463; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062490; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062514; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062542; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062565; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0062568; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036186; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036209; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036210; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036211; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036251; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036253; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036256; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036263; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036269; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036270; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036271; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061874; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061882; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061940; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061944; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061979; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062052; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062113; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062120; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062183; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062187; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062198; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062220; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062244; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062246; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062247; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062296; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062300; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062327; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062347; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062352; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062364; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062380; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0080303; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036893; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036894; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036907; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036921; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036964; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036966; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036970; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036978; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036987; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036995; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036996; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036997; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062823; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062831; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062893; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062898; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062913; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062930; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063006; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063074; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063137; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063141; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063178; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063204; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063205; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063223; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063254; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063258; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063284; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063304; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063309; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063321; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063337; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081424; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035748; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035762; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035763; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035764; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035800; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035802; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035803; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035809; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035814; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061674; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061682; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061738; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061755; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061767; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061802; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061841; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061902; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061909; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061972; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061976; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061987; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062035; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062039; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062041; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062091; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062095; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062122; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062142; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062148; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062161; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062177; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062200; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035584; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035585; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035593; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035606; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035607; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035641; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035643; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035645; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035647; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035648; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035654; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035659; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035662; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035664; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061097; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061105; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061152; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061156; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061182; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061199; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061234; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061274; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061335; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061341; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061408; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061419; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061462; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061465; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061466; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061467; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061516; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061520; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061546; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061566; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061571; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061583; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061600; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079378; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..4812833
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    5117..5203
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    12725..14541
FT                   /estimated_length=1817
FT                   /gap_type="unknown"
FT   assembly_gap    15867..19779
FT                   /estimated_length=3913
FT                   /gap_type="unknown"
FT   assembly_gap    22106..22125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <22558..23555
FT                   /locus_tag="mCG_1041468"
FT                   /note="gene_id=mCG1041468.1"
FT   mRNA            <22558..23555
FT                   /locus_tag="mCG_1041468"
FT                   /product="mCG1041468"
FT                   /note="gene_id=mCG1041468.1 transcript_id=mCT159172.1
FT                   created on 23-MAY-2002"
FT   CDS             22558..22917
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041468"
FT                   /product="mCG1041468"
FT                   /note="gene_id=mCG1041468.1 transcript_id=mCT159172.1
FT                   protein_id=mCP78129.0"
FT                   /protein_id="EDL38713.1"
FT                   GPAQCFLEPSLKQLK"
FT   assembly_gap    38030..40875
FT                   /estimated_length=2846
FT                   /gap_type="unknown"
FT   assembly_gap    46519..51561
FT                   /estimated_length=5043
FT                   /gap_type="unknown"
FT   gene            complement(57793..>59172)
FT                   /locus_tag="mCG_1041469"
FT                   /note="gene_id=mCG1041469.1"
FT   mRNA            complement(57793..>59172)
FT                   /locus_tag="mCG_1041469"
FT                   /product="mCG1041469"
FT                   /note="gene_id=mCG1041469.1 transcript_id=mCT159173.1
FT                   created on 26-MAR-2003"
FT   CDS             complement(58102..59172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041469"
FT                   /product="mCG1041469"
FT                   /note="gene_id=mCG1041469.1 transcript_id=mCT159173.1
FT                   protein_id=mCP78131.0"
FT                   /protein_id="EDL38714.1"
FT                   FLGPARSVSWSPHSNT"
FT   assembly_gap    76029..84679
FT                   /estimated_length=8651
FT                   /gap_type="unknown"
FT   gene            complement(<85965..86996)
FT                   /locus_tag="mCG_1041476"
FT                   /note="gene_id=mCG1041476.1"
FT   mRNA            complement(<85965..86996)
FT                   /locus_tag="mCG_1041476"
FT                   /product="mCG1041476"
FT                   /note="gene_id=mCG1041476.1 transcript_id=mCT159180.1
FT                   created on 23-MAY-2002"
FT   CDS             complement(85965..86963)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041476"
FT                   /product="mCG1041476"
FT                   /note="gene_id=mCG1041476.1 transcript_id=mCT159180.1
FT                   protein_id=mCP78154.1"
FT                   /protein_id="EDL38715.1"
FT   gene            <109224..>110297
FT                   /locus_tag="mCG_64768"
FT                   /note="gene_id=mCG64768.0"
FT   mRNA            <109224..>110297
FT                   /locus_tag="mCG_64768"
FT                   /product="mCG64768"
FT                   /note="gene_id=mCG64768.0 transcript_id=mCT64951.0 created
FT                   on 26-MAR-2003"
FT   CDS             109224..110297
FT                   /codon_start=1
FT                   /locus_tag="mCG_64768"
FT                   /product="mCG64768"
FT                   /note="gene_id=mCG64768.0 transcript_id=mCT64951.0
FT                   protein_id=mCP37183.0"
FT                   /protein_id="EDL38716.1"
FT                   SLASAQCFLEPSIKHLK"
FT   assembly_gap    112687..112706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    113979..114280
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    120710..122738
FT                   /estimated_length=2029
FT                   /gap_type="unknown"
FT   assembly_gap    123698..126105
FT                   /estimated_length=2408
FT                   /gap_type="unknown"
FT   assembly_gap    134012..134303
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            147298..169715
FT                   /locus_tag="mCG_5005"
FT                   /note="gene_id=mCG5005.3"
FT   mRNA            join(147298..147426,154521..154707,160722..160881,
FT                   161417..163170)
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, transcript variant mCT169166"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT169166.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(147304..147426,154521..154707,160722..160881,
FT                   161417..161524,166886..167010,168803..169714)
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, transcript variant mCT4247"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT4247.1 created on
FT                   23-MAY-2002"
FT   CDS             join(147355..147426,154521..154707,160722..160881,
FT                   161417..161524,166886..167010,168803..168888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, isoform CRA_c"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT4247.1
FT                   protein_id=mCP16427.2 isoform=CRA_c"
FT                   /protein_id="EDL38719.1"
FT   CDS             join(147355..147426,154521..154707,160722..160881,
FT                   161417..161528)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, isoform CRA_a"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT169166.0
FT                   protein_id=mCP92413.0 isoform=CRA_a"
FT                   /protein_id="EDL38717.1"
FT                   VAMTANLNITYKK"
FT   mRNA            join(<147383..147426,154521..154707,160722..160881,
FT                   161417..161524,166886..167010,168710..169715)
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, transcript variant mCT193747"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT193747.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<147385..147426,154521..154707,160722..160881,
FT                   161417..161524,166886..167010,168710..168750)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5005"
FT                   /product="mCG5005, isoform CRA_b"
FT                   /note="gene_id=mCG5005.3 transcript_id=mCT193747.0
FT                   protein_id=mCP114718.0 isoform=CRA_b"
FT                   /protein_id="EDL38718.1"
FT   assembly_gap    168434..168620
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   gene            179298..184549
FT                   /gene="Them5"
FT                   /locus_tag="mCG_5006"
FT                   /note="gene_id=mCG5006.1"
FT   mRNA            join(179298..179583,180457..180658,181605..181743,
FT                   183347..183457,183746..183870,184160..184548)
FT                   /gene="Them5"
FT                   /locus_tag="mCG_5006"
FT                   /product="thioesterase superfamily member 5, transcript
FT                   variant mCT4244"
FT                   /note="gene_id=mCG5006.1 transcript_id=mCT4244.0 created on
FT                   23-MAY-2002"
FT   mRNA            join(179299..179583,180457..180658,181605..181743,
FT                   183347..183457,183746..184549)
FT                   /gene="Them5"
FT                   /locus_tag="mCG_5006"
FT                   /product="thioesterase superfamily member 5, transcript
FT                   variant mCT169167"
FT                   /note="gene_id=mCG5006.1 transcript_id=mCT169167.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(179461..179583,180457..180658,181605..181743,
FT                   183347..183457,183746..183870,184160..184206)
FT                   /codon_start=1
FT                   /gene="Them5"
FT                   /locus_tag="mCG_5006"
FT                   /product="thioesterase superfamily member 5, isoform CRA_b"
FT                   /note="gene_id=mCG5006.1 transcript_id=mCT4244.0
FT                   protein_id=mCP16431.1 isoform=CRA_b"
FT                   /protein_id="EDL38721.1"
FT   CDS             join(179461..179583,180457..180658,181605..181743,
FT                   183347..183457,183746..184076)
FT                   /codon_start=1
FT                   /gene="Them5"
FT                   /locus_tag="mCG_5006"
FT                   /product="thioesterase superfamily member 5, isoform CRA_a"
FT                   /note="gene_id=mCG5006.1 transcript_id=mCT169167.0
FT                   protein_id=mCP92414.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="MGI:MGI:1913448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEK7"
FT                   /protein_id="EDL38720.1"
FT   gene            complement(193676..>198009)
FT                   /locus_tag="mCG_145016"
FT                   /note="gene_id=mCG145016.0"
FT   mRNA            complement(join(193676..194366,194708..194787,
FT                   197818..>198009))
FT                   /locus_tag="mCG_145016"
FT                   /product="mCG145016"
FT                   /note="gene_id=mCG145016.0 transcript_id=mCT184440.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(193781..>194062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145016"
FT                   /product="mCG145016"
FT                   /note="gene_id=mCG145016.0 transcript_id=mCT184440.0
FT                   protein_id=mCP106329.0"
FT                   /protein_id="EDL38722.1"
FT   gene            complement(205774..>214396)
FT                   /locus_tag="mCG_1041502"
FT                   /note="gene_id=mCG1041502.1"
FT   mRNA            complement(join(205774..206007,206991..207578,
FT                   214279..>214396))
FT                   /locus_tag="mCG_1041502"
FT                   /product="mCG1041502"
FT                   /note="gene_id=mCG1041502.1 transcript_id=mCT159206.1
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(205854..206007,206991..>207193))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041502"
FT                   /product="mCG1041502"
FT                   /note="gene_id=mCG1041502.1 transcript_id=mCT159206.1
FT                   protein_id=mCP78288.2"
FT                   /protein_id="EDL38723.1"
FT                   EGAIFHWSLSTAVQ"
FT   gene            209945..234206
FT                   /gene="Rorc"
FT                   /locus_tag="mCG_5011"
FT                   /note="gene_id=mCG5011.1"
FT   mRNA            join(209945..210090,212194..212223,224602..224687,
FT                   224942..225072,226266..226772,226990..227111,
FT                   228589..228721,228895..229002,229160..229270,
FT                   232809..234206)
FT                   /gene="Rorc"
FT                   /locus_tag="mCG_5011"
FT                   /product="RAR-related orphan receptor gamma, transcript
FT                   variant mCT4249"
FT                   /note="gene_id=mCG5011.1 transcript_id=mCT4249.3 created on
FT                   10-JUN-2003"
FT   CDS             join(210051..210090,212194..212223,224602..224687,
FT                   224942..225072,226266..226455)
FT                   /codon_start=1
FT                   /gene="Rorc"
FT                   /locus_tag="mCG_5011"
FT                   /product="RAR-related orphan receptor gamma, isoform CRA_b"
FT                   /note="gene_id=mCG5011.1 transcript_id=mCT4249.3
FT                   protein_id=mCP16434.3 isoform=CRA_b"
FT                   /protein_id="EDL38725.1"
FT   mRNA            join(214581..214752,221665..221805,224602..224687,
FT                   224942..225072,226266..226772,226990..227111,
FT                   228589..228721,228895..229002,229160..229270,
FT                   232809..234206)
FT                   /gene="Rorc"
FT                   /locus_tag="mCG_5011"
FT                   /product="RAR-related orphan receptor gamma, transcript
FT                   variant mCT169168"
FT                   /note="gene_id=mCG5011.1 transcript_id=mCT169168.1 created
FT                   on 10-JUN-2003"
FT   assembly_gap    220101..220475
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   CDS             join(221781..221805,224602..224687,224942..225072,
FT                   226266..226455)
FT                   /codon_start=1
FT                   /gene="Rorc"
FT                   /locus_tag="mCG_5011"
FT                   /product="RAR-related orphan receptor gamma, isoform CRA_a"
FT                   /note="gene_id=mCG5011.1 transcript_id=mCT169168.1
FT                   protein_id=mCP92415.1 isoform=CRA_a"
FT                   /protein_id="EDL38724.1"
FT   assembly_gap    225076..225175
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    230139..230292
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   gene            234154..240135
FT                   /gene="Lrrn6d"
FT                   /locus_tag="mCG_142665"
FT                   /note="gene_id=mCG142665.0"
FT   mRNA            join(234154..235099,237440..240135)
FT                   /gene="Lrrn6d"
FT                   /locus_tag="mCG_142665"
FT                   /product="leucine rich repeat neuronal 6D"
FT                   /note="gene_id=mCG142665.0 transcript_id=mCT181510.0
FT                   created on 04-JUN-2003"
FT   CDS             join(235035..235099,237440..239231)
FT                   /codon_start=1
FT                   /gene="Lrrn6d"
FT                   /locus_tag="mCG_142665"
FT                   /product="leucine rich repeat neuronal 6D"
FT                   /note="gene_id=mCG142665.0 transcript_id=mCT181510.0
FT                   protein_id=mCP104432.0"
FT                   /db_xref="GOA:A0A0R4J0Q7"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:2444651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0Q7"
FT                   /protein_id="EDL38726.1"
FT   gene            complement(245029..248548)
FT                   /locus_tag="mCG_148355"
FT                   /note="gene_id=mCG148355.0"
FT   mRNA            complement(join(245029..245800,248328..248548))
FT                   /locus_tag="mCG_148355"
FT                   /product="mCG148355"
FT                   /note="gene_id=mCG148355.0 transcript_id=mCT188618.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(245307..245513)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148355"
FT                   /product="mCG148355"
FT                   /note="gene_id=mCG148355.0 transcript_id=mCT188618.0
FT                   protein_id=mCP109728.0"
FT                   /protein_id="EDL38727.1"
FT   gene            248897..267125
FT                   /locus_tag="mCG_5013"
FT                   /note="gene_id=mCG5013.3"
FT   mRNA            join(248897..248996,258436..258585,259329..259435,
FT                   260135..260324,261197..261336,261425..261746,
FT                   263489..263649,263780..263952,264294..264358,
FT                   264674..264825,264991..265092,265685..265781,
FT                   266194..266325)
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, transcript variant mCT4243"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT4243.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(248898..248996,259329..259435,260135..260324,
FT                   261197..261336,261425..262021)
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, transcript variant mCT169169"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT169169.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(<248952..249002,258436..258585,259329..259435,
FT                   260135..260324,261197..261336,261425..261746,
FT                   263489..263649,263780..263952,264294..264358,
FT                   264674..264825,264991..265092,265685..265781,
FT                   266194..267125)
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, transcript variant mCT193748"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT193748.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<258444..258585,259329..259435,260135..260324,
FT                   261197..261336,261425..261746,263489..263649,
FT                   263780..263952,264294..264358,264674..264825,
FT                   264991..265092,265685..265781,266194..266243)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, isoform CRA_b"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT193748.0
FT                   protein_id=mCP114723.0 isoform=CRA_b"
FT                   /protein_id="EDL38729.1"
FT   CDS             join(258462..258585,259329..259435,260135..260324,
FT                   261197..261336,261425..261746,263489..263649,
FT                   263780..263952,264294..264358,264674..264825,
FT                   264991..265092,265685..265781,266194..266243)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, isoform CRA_c"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT4243.2
FT                   protein_id=mCP16436.2 isoform=CRA_c"
FT                   /protein_id="EDL38730.1"
FT   CDS             join(259373..259435,260135..260324,261197..261336,
FT                   261425..261754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5013"
FT                   /product="mCG5013, isoform CRA_a"
FT                   /note="gene_id=mCG5013.3 transcript_id=mCT169169.0
FT                   protein_id=mCP92412.0 isoform=CRA_a"
FT                   /protein_id="EDL38728.1"
FT                   FQNSGAQSSPETSMFESM"
FT   gene            complement(269025..>272251)
FT                   /gene="Oaz3"
FT                   /locus_tag="mCG_5012"
FT                   /note="gene_id=mCG5012.1"
FT   mRNA            complement(join(269025..269275,270099..270184,
FT                   270606..270781,271591..271760,272023..>272251))
FT                   /gene="Oaz3"
FT                   /locus_tag="mCG_5012"
FT                   /product="ornithine decarboxylase antizyme 3"
FT                   /note="gene_id=mCG5012.1 transcript_id=mCT4250.0 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(269142..269275,270099..270184,
FT                   270606..270781,271591..>271731))
FT                   /codon_start=1
FT                   /gene="Oaz3"
FT                   /locus_tag="mCG_5012"
FT                   /product="ornithine decarboxylase antizyme 3"
FT                   /note="gene_id=mCG5012.1 transcript_id=mCT4250.0
FT                   protein_id=mCP16428.0"
FT                   /protein_id="EDL38731.1"
FT                   FMVYPLERDLGHPGQ"
FT   assembly_gap    275287..275481
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            279125..284538
FT                   /gene="Mrpl9"
FT                   /locus_tag="mCG_5008"
FT                   /note="gene_id=mCG5008.1"
FT   mRNA            join(279125..279303,279468..279624,280416..280540,
FT                   280730..280780,282467..282568,283091..283174,
FT                   283617..284538)
FT                   /gene="Mrpl9"
FT                   /locus_tag="mCG_5008"
FT                   /product="mitochondrial ribosomal protein L9, transcript
FT                   variant mCT4245"
FT                   /note="gene_id=mCG5008.1 transcript_id=mCT4245.2 created on
FT                   30-MAY-2002"
FT   mRNA            join(279126..279303,279468..279624,280416..280540,
FT                   280730..280780,282467..282672)
FT                   /gene="Mrpl9"
FT                   /locus_tag="mCG_5008"
FT                   /product="mitochondrial ribosomal protein L9, transcript
FT                   variant mCT170007"
FT                   /note="gene_id=mCG5008.1 transcript_id=mCT170007.0 created
FT                   on 30-MAY-2002"
FT   CDS             join(279160..279303,279468..279624,280416..280540,
FT                   280730..280780,282467..282568,283091..283174,
FT                   283617..283751)
FT                   /codon_start=1
FT                   /gene="Mrpl9"
FT                   /locus_tag="mCG_5008"
FT                   /product="mitochondrial ribosomal protein L9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5008.1 transcript_id=mCT4245.2
FT                   protein_id=mCP16433.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q14B21"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="MGI:MGI:2137211"
FT                   /db_xref="UniProtKB/TrEMBL:Q14B21"
FT                   /protein_id="EDL38733.1"
FT   CDS             join(279160..279303,279468..279624,280416..280540,
FT                   280730..280780,282467..282589)
FT                   /codon_start=1
FT                   /gene="Mrpl9"
FT                   /locus_tag="mCG_5008"
FT                   /product="mitochondrial ribosomal protein L9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5008.1 transcript_id=mCT170007.0
FT                   protein_id=mCP92894.0 isoform=CRA_a"
FT                   /protein_id="EDL38732.1"
FT   assembly_gap    287012..287136
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    289149..289171
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            289185..290006
FT                   /pseudo
FT                   /locus_tag="mCG_48708"
FT                   /note="gene_id=mCG48708.2"
FT   mRNA            289185..290006
FT                   /pseudo
FT                   /locus_tag="mCG_48708"
FT                   /note="gene_id=mCG48708.2 transcript_id=mCT48891.2 created
FT                   on 23-MAY-2002"
FT   gene            complement(300907..310661)
FT                   /gene="2310007A19Rik"
FT                   /locus_tag="mCG_5007"
FT                   /note="gene_id=mCG5007.1"
FT   mRNA            complement(join(300907..301020,301685..301811,
FT                   302813..302859,309231..309307,309890..309990,
FT                   310319..310387,310564..310661))
FT                   /gene="2310007A19Rik"
FT                   /locus_tag="mCG_5007"
FT                   /product="RIKEN cDNA 2310007A19"
FT                   /note="gene_id=mCG5007.1 transcript_id=mCT4256.1 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(301741..301811,302813..302859,
FT                   309231..309307,309890..309990,310319..310382))
FT                   /codon_start=1
FT                   /gene="2310007A19Rik"
FT                   /locus_tag="mCG_5007"
FT                   /product="RIKEN cDNA 2310007A19"
FT                   /note="gene_id=mCG5007.1 transcript_id=mCT4256.1
FT                   protein_id=mCP16432.2"
FT                   /protein_id="EDL38734.1"
FT                   PSRIHMQLIKEKKGT"
FT   assembly_gap    312384..312489
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            <315381..329213
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /note="gene_id=mCG5010.3"
FT   mRNA            join(<315381..315426,316151..316256,317273..317355,
FT                   321847..321895,322306..322431,322527..322606,
FT                   323553..323696,323823..323964,324164..324313,
FT                   324816..324881,325168..325308,325556..325699,
FT                   326465..326601,328145..329205)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT193742"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193742.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<315382..315426,316151..316256,317273..317355,
FT                   321847..321895,322306..322431,322527..322606,
FT                   323553..323696,323823..323964,324164..324313,
FT                   324816..324881,325168..325308,325556..325699,
FT                   326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193742.0
FT                   protein_id=mCP114719.0 isoform=CRA_b"
FT                   /protein_id="EDL38736.1"
FT                   RPKDANRPY"
FT   mRNA            join(<315385..315426,316151..316256,317273..317355,
FT                   321847..321895,322306..322431,322527..322606,
FT                   323553..323696,323823..323964,324164..324313,
FT                   324732..324881,325556..325699,326465..326601,
FT                   328145..329210)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT193745"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193745.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<315385..315426,316151..316256,317273..317355,
FT                   321847..321895,322306..322431,322527..322606,
FT                   323553..323696,323823..323964,324164..324313,
FT                   324732..324881,325556..325699,326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_e"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193745.0
FT                   protein_id=mCP114722.0 isoform=CRA_e"
FT                   /protein_id="EDL38739.1"
FT   assembly_gap    315466..315485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<315499..316256,317273..317355,321847..321895,
FT                   322303..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324732..324881,
FT                   325168..325308,325556..325699,326465..326601,
FT                   328145..329213)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT193743"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193743.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(315554..316256,317273..317355,321847..321895,
FT                   322303..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324816..324881,
FT                   325168..325308,325556..325699,326465..329210)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT4248"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT4248.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(<315836..316256,317273..317355,321847..321895,
FT                   322306..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324816..324881,
FT                   325168..325308,325556..325699,326465..326601,
FT                   328145..329210)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT193744"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193744.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<315893..316256,317273..317355,321847..321895,
FT                   322303..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324732..324881,
FT                   325168..325308,325556..325699,326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_c"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193743.0
FT                   protein_id=mCP114720.0 isoform=CRA_c"
FT                   /protein_id="EDL38737.1"
FT   CDS             join(<315893..316256,317273..317355,321847..321895,
FT                   322306..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324816..324881,
FT                   325168..325308,325556..325699,326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_d"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT193744.0
FT                   protein_id=mCP114721.0 isoform=CRA_d"
FT                   /protein_id="EDL38738.1"
FT   CDS             join(316112..316256,317273..317355,321847..321895,
FT                   322303..322431,322527..322606,323553..323696,
FT                   323823..323964,324164..324313,324816..324881,
FT                   325168..325308,325556..325699,326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_f"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT4248.2
FT                   protein_id=mCP16430.2 isoform=CRA_f"
FT                   /protein_id="EDL38740.1"
FT                   PKDANRPY"
FT   mRNA            join(321352..321895,322303..322431,322527..322606,
FT                   323553..323696,323823..324313,324816..324881,
FT                   325168..325308,325556..325699,326465..326601,
FT                   328145..329210)
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, transcript
FT                   variant mCT170008"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT170008.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(323929..324313,324816..324881,325168..325308,
FT                   325556..325699,326465..326592)
FT                   /codon_start=1
FT                   /gene="Tnrc4"
FT                   /locus_tag="mCG_5010"
FT                   /product="trinucleotide repeat containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG5010.3 transcript_id=mCT170008.0
FT                   protein_id=mCP92881.0 isoform=CRA_a"
FT                   /protein_id="EDL38735.1"
FT                   DANRPY"
FT   gene            complement(334557..412311)
FT                   /locus_tag="mCG_5009"
FT                   /note="gene_id=mCG5009.2"
FT   mRNA            complement(join(334557..338287,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365997,368218..368410,391929..392160,
FT                   411836..412311))
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, transcript variant mCT4246"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT4246.3 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(334557..338287,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365997,368218..368410,391929..>392192))
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, transcript variant mCT170077"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT170077.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(334564..339081,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365965))
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, transcript variant mCT170076"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT170076.1 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(338240..338287,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365997,368218..368410,391929..392160,
FT                   411836..412140))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, isoform CRA_c"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT4246.3
FT                   protein_id=mCP16435.2 isoform=CRA_c"
FT                   /protein_id="EDL38743.1"
FT   CDS             complement(join(338240..338287,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365997,368218..368410,391929..392192))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, isoform CRA_b"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT170077.0
FT                   protein_id=mCP92864.0 isoform=CRA_b"
FT                   /protein_id="EDL38742.1"
FT   CDS             complement(join(339073..339081,339186..339245,
FT                   339872..340000,340473..340622,348052..348141,
FT                   356073..356236,357213..357291,361207..361311,
FT                   365933..365962))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5009"
FT                   /product="mCG5009, isoform CRA_a"
FT                   /note="gene_id=mCG5009.2 transcript_id=mCT170076.1
FT                   protein_id=mCP92898.0 isoform=CRA_a"
FT                   /protein_id="EDL38741.1"
FT   assembly_gap    369554..369697
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    376053..376072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    418969..419060
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    420656..420675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(434034..434468)
FT                   /pseudo
FT                   /locus_tag="mCG_5015"
FT                   /note="gene_id=mCG5015.1"
FT   mRNA            complement(434034..434468)
FT                   /pseudo
FT                   /locus_tag="mCG_5015"
FT                   /note="gene_id=mCG5015.1 transcript_id=mCT4239.1 created on
FT                   24-MAY-2002"
FT   gene            complement(442197..>558262)
FT                   /gene="Tuft1"
FT                   /locus_tag="mCG_5014"
FT                   /note="gene_id=mCG5014.2"
FT   mRNA            complement(join(442197..443629,444157..444257,
FT                   445203..445286,446055..446160,451423..451517,
FT                   452060..452188,457700..457813,462109..462174,
FT                   463970..464059,464886..464972,468410..468511,
FT                   558188..>558262))
FT                   /gene="Tuft1"
FT                   /locus_tag="mCG_5014"
FT                   /product="tuftelin 1, transcript variant mCT4238"
FT                   /note="gene_id=mCG5014.2 transcript_id=mCT4238.2 created on
FT                   24-MAY-2002"
FT   mRNA            complement(join(442197..443629,444157..444257,
FT                   445203..445286,446055..446160,451423..451517,
FT                   452060..452188,457700..457813,462109..462174,
FT                   463970..464059,464886..464972,468410..468511,
FT                   544953..545018,546816..546905,547732..547818,
FT                   557719..557820,558188..>558262))
FT                   /gene="Tuft1"
FT                   /locus_tag="mCG_5014"
FT                   /product="tuftelin 1, transcript variant mCT170009"
FT                   /note="gene_id=mCG5014.2 transcript_id=mCT170009.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(443566..443629,444157..444257,
FT                   445203..445286,446055..446160,451423..451517,
FT                   452060..452188,457700..457813,462109..462174,
FT                   463970..464059,464886..464972,468410..468511,
FT                   558188..>558262))
FT                   /codon_start=1
FT                   /gene="Tuft1"
FT                   /locus_tag="mCG_5014"
FT                   /product="tuftelin 1, isoform CRA_b"
FT                   /note="gene_id=mCG5014.2 transcript_id=mCT4238.2
FT                   protein_id=mCP16429.1 isoform=CRA_b"
FT                   /protein_id="EDL38745.1"
FT   CDS             complement(join(443566..443629,444157..444257,
FT                   445203..445286,446055..446160,451423..451517,
FT                   452060..452188,457700..457813,462109..462174,
FT                   463970..464059,464886..464972,468410..468511,
FT                   544953..545018,546816..546905,547732..547818,
FT                   557719..557820,558188..>558262))
FT                   /codon_start=1
FT                   /gene="Tuft1"
FT                   /locus_tag="mCG_5014"
FT                   /product="tuftelin 1, isoform CRA_a"
FT                   /note="gene_id=mCG5014.2 transcript_id=mCT170009.0
FT                   protein_id=mCP92870.0 isoform=CRA_a"
FT                   /protein_id="EDL38744.1"
FT   assembly_gap    447276..447335
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    468658..469549
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   assembly_gap    471573..473882
FT                   /estimated_length=2310
FT                   /gap_type="unknown"
FT   assembly_gap    477240..477259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    481216..483955
FT                   /estimated_length=2740
FT                   /gap_type="unknown"
FT   assembly_gap    486780..487344
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   gene            487387..488538
FT                   /locus_tag="mCG_148356"
FT                   /note="gene_id=mCG148356.0"
FT   mRNA            join(487387..487441,487539..488538)
FT                   /locus_tag="mCG_148356"
FT                   /product="mCG148356"
FT                   /note="gene_id=mCG148356.0 transcript_id=mCT188619.0
FT                   created on 13-JAN-2004"
FT   CDS             487826..487921
FT                   /codon_start=1
FT                   /locus_tag="mCG_148356"
FT                   /product="mCG148356"
FT                   /note="gene_id=mCG148356.0 transcript_id=mCT188619.0
FT                   protein_id=mCP109729.0"
FT                   /protein_id="EDL38746.1"
FT                   /translation="MVGRGGTHDLKRNLHPRERVLVAPKAVASQA"
FT   gene            complement(489003..>498980)
FT                   /locus_tag="mCG_125547"
FT                   /note="gene_id=mCG125547.1"
FT   mRNA            complement(join(489003..490459,490732..490895,
FT                   491514..491622,491937..492055,492143..492226,
FT                   493383..493472,494390..494551,495395..495565,
FT                   497436..497693,498240..498446,498762..>498980))
FT                   /locus_tag="mCG_125547"
FT                   /product="mCG125547"
FT                   /note="gene_id=mCG125547.1 transcript_id=mCT126808.1
FT                   created on 24-MAY-2002"
FT   CDS             complement(join(490318..490459,490732..490895,
FT                   491514..491622,491937..492055,492143..492226,
FT                   493383..493472,494390..494551,495395..495565,
FT                   497436..497693,498240..498446,498762..>498980))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125547"
FT                   /product="mCG125547"
FT                   /note="gene_id=mCG125547.1 transcript_id=mCT126808.1
FT                   protein_id=mCP78259.1"
FT                   /protein_id="EDL38747.1"
FT   assembly_gap    491232..491427
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            521904..531736
FT                   /locus_tag="mCG_125538"
FT                   /note="gene_id=mCG125538.0"
FT   mRNA            join(521904..521993,525125..525181,525323..525435,
FT                   525636..525821,526374..526494,527861..528043,
FT                   528269..528448,530814..530909,531052..531170,
FT                   531384..531736)
FT                   /locus_tag="mCG_125538"
FT                   /product="mCG125538"
FT                   /note="gene_id=mCG125538.0 transcript_id=mCT126799.0
FT                   created on 24-MAY-2002"
FT   CDS             join(521990..521993,525125..525181,525323..525435,
FT                   525636..525821,526374..526494,527861..528043,
FT                   528269..528448,530814..530842)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125538"
FT                   /product="mCG125538"
FT                   /note="gene_id=mCG125538.0 transcript_id=mCT126799.0
FT                   protein_id=mCP78200.1"
FT                   /protein_id="EDL38748.1"
FT                   ADLPWGQHC"
FT   assembly_gap    529969..529988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    534739..534758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    536288..536307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    537705..538927
FT                   /estimated_length=1223
FT                   /gap_type="unknown"
FT   assembly_gap    541628..541647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    553972..555429
FT                   /estimated_length=1458
FT                   /gap_type="unknown"
FT   assembly_gap    563829..588491
FT                   /estimated_length=24663
FT                   /gap_type="unknown"
FT   gene            complement(<588559..607931)
FT                   /locus_tag="mCG_13712"
FT                   /note="gene_id=mCG13712.2"
FT   mRNA            complement(join(<588559..588729,590600..590857,
FT                   591399..591605,591930..592139,594565..594697,
FT                   594934..595082,595640..595852,596337..596469,
FT                   597546..597673,599431..599526,599638..599707,
FT                   599816..599916,600588..601456,607811..607931))
FT                   /locus_tag="mCG_13712"
FT                   /product="mCG13712, transcript variant mCT17532"
FT                   /note="gene_id=mCG13712.2 transcript_id=mCT17532.2 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(<588559..588729,590600..590857,
FT                   591399..591605,591930..592139,594565..594697,
FT                   594934..595082,595640..595852,596337..596469,
FT                   597546..597673,599431..599526,599638..599707,
FT                   599816..599916,600588..601427))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13712"
FT                   /product="mCG13712, isoform CRA_b"
FT                   /note="gene_id=mCG13712.2 transcript_id=mCT17532.2
FT                   protein_id=mCP13724.2 isoform=CRA_b"
FT                   /protein_id="EDL38750.1"
FT   mRNA            complement(join(596665..597673,599431..599502,
FT                   599638..599707,599816..599916,600588..601456,
FT                   607811..607888))
FT                   /locus_tag="mCG_13712"
FT                   /product="mCG13712, transcript variant mCT185876"
FT                   /note="gene_id=mCG13712.2 transcript_id=mCT185876.0 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(597542..597673,599431..599502,
FT                   599638..599707,599816..599916,600588..601427))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13712"
FT                   /product="mCG13712, isoform CRA_a"
FT                   /note="gene_id=mCG13712.2 transcript_id=mCT185876.0
FT                   protein_id=mCP107134.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1927237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JFG0"
FT                   /protein_id="EDL38749.1"
FT                   QSSKE"
FT   assembly_gap    620612..620631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    651708..652041
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   gene            659056..705070
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /note="gene_id=mCG13704.2"
FT   mRNA            join(659056..659119,675435..675559,677528..677686,
FT                   682297..682472,683923..684031,685589..685879,
FT                   685959..686168,691583..691689,692491..692828,
FT                   693776..693930,696101..696201,696607..696753,
FT                   698143..698277,698421..698590,698743..698883,
FT                   699439..699495,699664..699776,700030..700054,
FT                   700169..705070)
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   transcript variant mCT193735"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT193735.1 created
FT                   on 10-JUN-2004"
FT   mRNA            join(659056..659119,675435..675559,677528..677686,
FT                   682297..682472,683923..684031,685589..685879,
FT                   685986..686168,691583..691689,692491..692828,
FT                   693776..693930,696101..696201,696607..696753,
FT                   698143..698277,698421..698590,698743..698883,
FT                   699439..699495,699664..699776,700030..700054,
FT                   700169..705070)
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   transcript variant mCT17523"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT17523.3 created
FT                   on 10-JUN-2004"
FT   mRNA            join(659056..659119,675435..675559,677528..677686,
FT                   682297..682472,683923..684031,685589..685879,
FT                   685959..688003)
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   transcript variant mCT169555"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT169555.1 created
FT                   on 10-JUN-2004"
FT   assembly_gap    659120..659630
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   CDS             join(675436..675559,677528..677686,682297..682472,
FT                   683923..684031,685589..685879,685959..686168,
FT                   691583..691689,692491..692828,693776..693930,
FT                   696101..696201,696607..696753,698143..698277,
FT                   698421..698590,698743..698883,699439..699495,
FT                   699664..699776,700030..700054,700169..701840)
FT                   /codon_start=1
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT193735.1
FT                   protein_id=mCP114691.1 isoform=CRA_c"
FT                   /db_xref="GOA:B9EIG6"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:2442117"
FT                   /db_xref="UniProtKB/TrEMBL:B9EIG6"
FT                   /protein_id="EDL38753.1"
FT                   DLDLMEI"
FT   CDS             join(675436..675559,677528..677686,682297..682472,
FT                   683923..684031,685589..685879,685986..686168,
FT                   691583..691689,692491..692828,693776..693930,
FT                   696101..696201,696607..696753,698143..698277,
FT                   698421..698590,698743..698883,699439..699495,
FT                   699664..699776,700030..700054,700169..701840)
FT                   /codon_start=1
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT17523.3
FT                   protein_id=mCP13685.3 isoform=CRA_b"
FT                   /db_xref="GOA:Q0VGT3"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:2442117"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGT3"
FT                   /protein_id="EDL38752.1"
FT   CDS             join(675436..675559,677528..677686,682297..682472,
FT                   683923..684031,685589..685879,685959..686221)
FT                   /codon_start=1
FT                   /gene="Pogz"
FT                   /locus_tag="mCG_13704"
FT                   /product="pogo transposable element with ZNF domain,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13704.2 transcript_id=mCT169555.1
FT                   protein_id=mCP92899.1 isoform=CRA_a"
FT                   /protein_id="EDL38751.1"
FT   gene            complement(705600..708448)
FT                   /gene="Psmb4"
FT                   /locus_tag="mCG_13716"
FT                   /note="gene_id=mCG13716.1"
FT   mRNA            complement(join(705600..705948,706179..706267,
FT                   706425..706541,707168..707249,707583..707729,
FT                   707949..708155,708277..708448))
FT                   /gene="Psmb4"
FT                   /locus_tag="mCG_13716"
FT                   /product="proteasome (prosome, macropain) subunit, beta
FT                   type 4"
FT                   /note="gene_id=mCG13716.1 transcript_id=mCT17537.1 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(705936..705948,706179..706267,
FT                   706425..706541,707168..707249,707583..707729,
FT                   707949..708155,708277..708416))
FT                   /codon_start=1
FT                   /gene="Psmb4"
FT                   /locus_tag="mCG_13716"
FT                   /product="proteasome (prosome, macropain) subunit, beta
FT                   type 4"
FT                   /note="gene_id=mCG13716.1 transcript_id=mCT17537.1
FT                   protein_id=mCP13687.2"
FT                   /protein_id="EDL38754.1"
FT   assembly_gap    723701..723726
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    734027..734046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    750531..750550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            755241..766816
FT                   /locus_tag="mCG_13719"
FT                   /note="gene_id=mCG13719.2"
FT   mRNA            join(755241..755329,758888..758944,759086..759198,
FT                   759399..759584,760146..760266,761832..762014,
FT                   762234..762412,764523..764601,764684..764805,
FT                   765898..765990,766134..766252,766465..766816)
FT                   /locus_tag="mCG_13719"
FT                   /product="mCG13719"
FT                   /note="gene_id=mCG13719.2 transcript_id=mCT17534.2 created
FT                   on 24-MAY-2002"
FT   CDS             join(755326..755329,758888..758944,759086..759198,
FT                   759399..759584,760146..760266,761832..762014,
FT                   762234..762412,764523..764601,764684..764805,
FT                   765898..765990,766134..766252,766465..766627)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13719"
FT                   /product="mCG13719"
FT                   /note="gene_id=mCG13719.2 transcript_id=mCT17534.2
FT                   protein_id=mCP13697.2"
FT                   /protein_id="EDL38755.1"
FT                   LRYPGGDCSSDIWI"
FT   assembly_gap    756051..756283
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            <776231..783444
FT                   /locus_tag="mCG_13706"
FT                   /note="gene_id=mCG13706.2"
FT   mRNA            join(<776231..776277,777111..777232,777448..777481,
FT                   777842..777924,778368..778487,778583..778702,
FT                   778817..778898,779193..779394,779878..779981,
FT                   780346..783444)
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, transcript variant mCT193737"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193737.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(776267..776347,776859..776885,777111..777242,
FT                   777448..777481,777842..777924,778368..778487,
FT                   778583..778702,778817..778898,779193..779394,
FT                   779878..779981,780346..783442)
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, transcript variant mCT17526"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT17526.2 created
FT                   on 24-MAY-2002"
FT   mRNA            join(<776296..776347,777111..777242,777448..777481,
FT                   777842..777924,778368..778487,778583..778898,
FT                   779193..779394,779878..779981,780346..783443)
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, transcript variant mCT193736"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193736.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<776322..776347,777111..777242,777448..777481,
FT                   777842..777924,778368..778487,778583..778702,
FT                   778817..778898,779193..779394,779878..783444)
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, transcript variant mCT193738"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193738.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(777130..777242,777448..777481,777842..777924,
FT                   778368..778487,778583..778702,778817..778898,
FT                   779193..779394,779878..779981,780346..781464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, isoform CRA_a"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT17526.2
FT                   protein_id=mCP13689.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JL61"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR029298"
FT                   /db_xref="InterPro:IPR033486"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="MGI:MGI:1858421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JL61"
FT                   /protein_id="EDL38756.1"
FT   CDS             join(<777195..777232,777448..777481,777842..777924,
FT                   778368..778487,778583..778702,778817..778898,
FT                   779193..779394,779878..779981,780346..781464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, isoform CRA_c"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193737.0
FT                   protein_id=mCP114693.0 isoform=CRA_c"
FT                   /protein_id="EDL38758.1"
FT   CDS             join(<778725..778898,779193..779394,779878..779981,
FT                   780346..781464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, isoform CRA_b"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193736.0
FT                   protein_id=mCP114692.0 isoform=CRA_b"
FT                   /protein_id="EDL38757.1"
FT                   SSLTPEHKDPKATPP"
FT   CDS             <780346..781464
FT                   /codon_start=1
FT                   /locus_tag="mCG_13706"
FT                   /product="mCG13706, isoform CRA_d"
FT                   /note="gene_id=mCG13706.2 transcript_id=mCT193738.0
FT                   protein_id=mCP114694.0 isoform=CRA_d"
FT                   /protein_id="EDL38759.1"
FT   gene            complement(781130..>784144)
FT                   /locus_tag="mCG_146331"
FT                   /note="gene_id=mCG146331.0"
FT   mRNA            complement(join(781130..781947,782511..782616,
FT                   783111..>784144))
FT                   /locus_tag="mCG_146331"
FT                   /product="mCG146331"
FT                   /note="gene_id=mCG146331.0 transcript_id=mCT186434.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(782554..782616,783111..>783287))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146331"
FT                   /product="mCG146331"
FT                   /note="gene_id=mCG146331.0 transcript_id=mCT186434.0
FT                   protein_id=mCP107792.0"
FT                   /protein_id="EDL38760.1"
FT   gene            785598..790249
FT                   /locus_tag="mCG_1041504"
FT                   /note="gene_id=mCG1041504.0"
FT   mRNA            join(785598..785698,789697..790249)
FT                   /locus_tag="mCG_1041504"
FT                   /product="mCG1041504"
FT                   /note="gene_id=mCG1041504.0 transcript_id=mCT159208.0
FT                   created on 24-MAY-2002"
FT   CDS             790031..790138
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041504"
FT                   /product="mCG1041504"
FT                   /note="gene_id=mCG1041504.0 transcript_id=mCT159208.0
FT                   protein_id=mCP78292.1"
FT                   /protein_id="EDL38761.1"
FT   gene            796772..828680
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /note="gene_id=mCG13701.2"
FT   mRNA            join(796772..797158,806043..806979,811363..811407,
FT                   815027..815254,816222..816449,817896..818005,
FT                   818641..818745,818913..819036,820909..821174,
FT                   826299..826431,826693..826813,827818..828680)
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, transcript variant mCT17352"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT17352.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(<796809..797158,806043..806979,815027..815254,
FT                   816222..816449,817896..818005,818641..818745,
FT                   818913..819036,820909..821174,826299..826431,
FT                   826693..826813,827818..828648)
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, transcript variant mCT193727"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT193727.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<797011..797158,815027..815254,816222..816449,
FT                   817896..818005,818641..818745,818913..819036,
FT                   820909..821174,826299..826431,826693..826813,
FT                   827818..828680)
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, transcript variant mCT193728"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT193728.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<797012..797158,815027..815254,816222..816449,
FT                   817896..818005,818641..818745,818913..819036,
FT                   820909..821174,826299..826431,826693..826813,
FT                   827818..827999)
FT                   /codon_start=1
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, isoform CRA_c"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT193728.0
FT                   protein_id=mCP114686.0 isoform=CRA_c"
FT                   /protein_id="EDL38764.1"
FT   CDS             join(<797097..797158,806043..806979,815027..815254,
FT                   816222..816449,817896..818005,818641..818745,
FT                   818913..819036,820909..821174,826299..826431,
FT                   826693..826813,827818..827999)
FT                   /codon_start=1
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT193727.0
FT                   protein_id=mCP114685.0 isoform=CRA_b"
FT                   /protein_id="EDL38763.1"
FT   CDS             join(806071..806979,811363..811407,815027..815254,
FT                   816222..816449,817896..818005,818641..818745,
FT                   818913..819036,820909..821174,826299..826431,
FT                   826693..826813,827818..827999)
FT                   /codon_start=1
FT                   /gene="Pik4cb"
FT                   /locus_tag="mCG_13701"
FT                   /product="phosphatidylinositol 4-kinase, catalytic, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG13701.2 transcript_id=mCT17352.2
FT                   protein_id=mCP13721.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BKC8"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="MGI:MGI:1334433"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BKC8"
FT                   /protein_id="EDL38762.1"
FT                   NGIM"
FT   gene            complement(828545..>837496)
FT                   /gene="Zfp687"
FT                   /locus_tag="mCG_13703"
FT                   /note="gene_id=mCG13703.3"
FT   mRNA            complement(join(828545..830025,830131..830272,
FT                   830439..830551,830644..830976,831135..831297,
FT                   831402..831578,832103..832281,832404..834535,
FT                   837170..837298))
FT                   /gene="Zfp687"
FT                   /locus_tag="mCG_13703"
FT                   /product="zinc finger protein 687, transcript variant
FT                   mCT17522"
FT                   /note="gene_id=mCG13703.3 transcript_id=mCT17522.2 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(828898..830025,830131..830272,
FT                   830439..830551,830644..830976,832103..832281,
FT                   832404..834535,837379..>837496))
FT                   /gene="Zfp687"
FT                   /locus_tag="mCG_13703"
FT                   /product="zinc finger protein 687, transcript variant
FT                   mCT193732"
FT                   /note="gene_id=mCG13703.3 transcript_id=mCT193732.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(829534..830025,830131..830272,
FT                   830439..830551,830644..830976,831135..831297,
FT                   831402..831578,832103..832281,832404..834518))
FT                   /codon_start=1
FT                   /gene="Zfp687"
FT                   /locus_tag="mCG_13703"
FT                   /product="zinc finger protein 687, isoform CRA_a"
FT                   /note="gene_id=mCG13703.3 transcript_id=mCT17522.2
FT                   protein_id=mCP13673.2 isoform=CRA_a"
FT                   /protein_id="EDL38765.1"
FT                   FIRARQGGSGDN"
FT   CDS             complement(join(830910..830976,832103..832281,
FT                   832404..834535,837379..>837442))
FT                   /codon_start=1
FT                   /gene="Zfp687"
FT                   /locus_tag="mCG_13703"
FT                   /product="zinc finger protein 687, isoform CRA_b"
FT                   /note="gene_id=mCG13703.3 transcript_id=mCT193732.0
FT                   protein_id=mCP114690.0 isoform=CRA_b"
FT                   /protein_id="EDL38766.1"
FT                   F"
FT   gene            837657..839129
FT                   /locus_tag="mCG_125550"
FT                   /note="gene_id=mCG125550.1"
FT   mRNA            join(837657..838336,838700..839129)
FT                   /locus_tag="mCG_125550"
FT                   /product="mCG125550"
FT                   /note="gene_id=mCG125550.1 transcript_id=mCT126811.1
FT                   created on 28-MAY-2002"
FT   CDS             838123..838287
FT                   /codon_start=1
FT                   /locus_tag="mCG_125550"
FT                   /product="mCG125550"
FT                   /note="gene_id=mCG125550.1 transcript_id=mCT126811.1
FT                   protein_id=mCP78140.1"
FT                   /protein_id="EDL38767.1"
FT                   TRCDRKWGR"
FT   gene            complement(854760..864657)
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /note="gene_id=mCG13702.2"
FT   mRNA            complement(join(854760..855039,855538..855602,
FT                   855689..855820,855974..856082,856622..856837,
FT                   856998..857066,857294..857380,857866..857980,
FT                   858661..858801,864562..864657))
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, transcript variant mCT17521"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT17521.1 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(854760..855039,855538..855602,
FT                   855689..856082,856622..856837,856998..857980,
FT                   858661..858801,864562..>864602))
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, transcript variant mCT193731"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193731.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(854760..855602,855689..855820,
FT                   855965..856082,856622..856837,856998..857066,
FT                   857294..857380,857866..857980,858661..858801,
FT                   864562..>864597))
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, transcript variant mCT193729"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193729.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(854869..855039,855538..855602,
FT                   855689..855820,855974..856082,856622..856837,
FT                   856998..857066,857294..857380,857866..857980,
FT                   858661..858801,864562..864587))
FT                   /codon_start=1
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, isoform CRA_a"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT17521.1
FT                   protein_id=mCP13682.1 isoform=CRA_a"
FT                   /protein_id="EDL38768.1"
FT   CDS             complement(join(854869..855039,855538..855602,
FT                   855689..>855953))
FT                   /codon_start=1
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, isoform CRA_d"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193731.0
FT                   protein_id=mCP114689.0 isoform=CRA_d"
FT                   /protein_id="EDL38771.1"
FT                   EKK"
FT   CDS             complement(join(855400..855602,855689..855820,
FT                   855965..856082,856622..856837,856998..857066,
FT                   857294..857380,857866..857980,858661..858801,
FT                   864562..>864596))
FT                   /codon_start=1
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, isoform CRA_b"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193729.0
FT                   protein_id=mCP114687.0 isoform=CRA_b"
FT                   /protein_id="EDL38769.1"
FT   mRNA            complement(join(855850..856082,856622..856837,
FT                   856998..857066,857294..857380,857866..857980,
FT                   858661..858801,864562..>864587))
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, transcript variant mCT193730"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193730.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(855954..856082,856622..856837,
FT                   856998..857066,857294..857380,857866..857980,
FT                   858661..858801,864562..864587))
FT                   /codon_start=1
FT                   /gene="Psmd4"
FT                   /locus_tag="mCG_13702"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   non-ATPase, 4, isoform CRA_c"
FT                   /note="gene_id=mCG13702.2 transcript_id=mCT193730.0
FT                   protein_id=mCP114688.0 isoform=CRA_c"
FT                   /protein_id="EDL38770.1"
FT   gene            complement(881643..928854)
FT                   /gene="Pip5k1b"
FT                   /locus_tag="mCG_13700"
FT                   /note="gene_id=mCG13700.1"
FT   mRNA            complement(join(881643..882133,882532..882577,
FT                   885705..885834,886381..886524,887471..887555,
FT                   887862..887910,889428..889511,890107..890312,
FT                   892758..893057,893936..894088,894449..894566,
FT                   896041..896171,900215..900295,904904..904938,
FT                   928510..928854))
FT                   /gene="Pip5k1b"
FT                   /locus_tag="mCG_13700"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type 1
FT                   beta"
FT                   /note="gene_id=mCG13700.1 transcript_id=mCT17351.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(882131..882133,882532..882577,
FT                   885705..885834,886381..886524,887471..887555,
FT                   887862..887910,889428..889511,890107..890312,
FT                   892758..893057,893936..894088,894449..894566,
FT                   896041..896171,900215..900295,904904..904938,
FT                   928510..928585))
FT                   /codon_start=1
FT                   /gene="Pip5k1b"
FT                   /locus_tag="mCG_13700"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type 1
FT                   beta"
FT                   /note="gene_id=mCG13700.1 transcript_id=mCT17351.0
FT                   protein_id=mCP13667.1"
FT                   /protein_id="EDL38772.1"
FT   assembly_gap    897954..898062
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            933203..944899
FT                   /gene="Vps72"
FT                   /locus_tag="mCG_13699"
FT                   /note="gene_id=mCG13699.1"
FT   mRNA            join(933203..933346,940369..940521,940793..940907,
FT                   941279..941455,943228..943372,944345..944899)
FT                   /gene="Vps72"
FT                   /locus_tag="mCG_13699"
FT                   /product="vacuolar protein sorting 72 (yeast)"
FT                   /note="gene_id=mCG13699.1 transcript_id=mCT17350.1 created
FT                   on 28-MAY-2002"
FT   CDS             join(933230..933346,940369..940521,940793..940907,
FT                   941279..941455,943228..943372,944345..944744)
FT                   /codon_start=1
FT                   /gene="Vps72"
FT                   /locus_tag="mCG_13699"
FT                   /product="vacuolar protein sorting 72 (yeast)"
FT                   /note="gene_id=mCG13699.1 transcript_id=mCT17350.1
FT                   protein_id=mCP13665.2"
FT                   /protein_id="EDL38773.1"
FT   gene            947497..951151
FT                   /gene="Tmod4"
FT                   /locus_tag="mCG_13717"
FT                   /note="gene_id=mCG13717.1"
FT   mRNA            join(947497..947643,947786..947942,948377..948493,
FT                   949283..949372,949532..949662,949747..949854,
FT                   950212..950355,950543..950687,951031..951151)
FT                   /gene="Tmod4"
FT                   /locus_tag="mCG_13717"
FT                   /product="tropomodulin 4"
FT                   /note="gene_id=mCG13717.1 transcript_id=mCT17538.1 created
FT                   on 28-MAY-2002"
FT   CDS             join(947521..947643,947786..947942,948377..948493,
FT                   949283..949372,949532..949662,949747..949854,
FT                   950212..950355,950543..950687,951031..951053)
FT                   /codon_start=1
FT                   /gene="Tmod4"
FT                   /locus_tag="mCG_13717"
FT                   /product="tropomodulin 4"
FT                   /note="gene_id=mCG13717.1 transcript_id=mCT17538.1
FT                   protein_id=mCP13713.1"
FT                   /db_xref="GOA:Q3UN19"
FT                   /db_xref="InterPro:IPR004934"
FT                   /db_xref="InterPro:IPR030129"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1355285"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN19"
FT                   /protein_id="EDL38774.1"
FT                   QQKKR"
FT   gene            complement(951661..955956)
FT                   /gene="Scnm1"
FT                   /locus_tag="mCG_13721"
FT                   /note="gene_id=mCG13721.1"
FT   mRNA            complement(join(951661..951826,952107..952301,
FT                   954768..954856,954960..955054,955143..955231,
FT                   955501..955571,955788..955956))
FT                   /gene="Scnm1"
FT                   /locus_tag="mCG_13721"
FT                   /product="sodium channel modifier 1"
FT                   /note="gene_id=mCG13721.1 transcript_id=mCT17541.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(951727..951826,952107..952301,
FT                   954768..954856,954960..955054,955143..955231,
FT                   955501..955571,955788..955838))
FT                   /codon_start=1
FT                   /gene="Scnm1"
FT                   /locus_tag="mCG_13721"
FT                   /product="sodium channel modifier 1"
FT                   /note="gene_id=mCG13721.1 transcript_id=mCT17541.2
FT                   protein_id=mCP13699.1"
FT                   /protein_id="EDL38775.1"
FT                   PPDLPLD"
FT   gene            956038..961458
FT                   /locus_tag="mCG_13720"
FT                   /note="gene_id=mCG13720.1"
FT   mRNA            join(956038..956939,959565..959926,960336..961458)
FT                   /locus_tag="mCG_13720"
FT                   /product="mCG13720"
FT                   /note="gene_id=mCG13720.1 transcript_id=mCT17540.2 created
FT                   on 28-MAY-2002"
FT   gene            complement(956222..959107)
FT                   /locus_tag="mCG_140525"
FT                   /note="gene_id=mCG140525.0"
FT   mRNA            complement(join(956222..956639,958989..959107))
FT                   /locus_tag="mCG_140525"
FT                   /product="mCG140525"
FT                   /note="gene_id=mCG140525.0 transcript_id=mCT169930.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(956254..956358)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140525"
FT                   /product="mCG140525"
FT                   /note="gene_id=mCG140525.0 transcript_id=mCT169930.0
FT                   protein_id=mCP92897.0"
FT                   /protein_id="EDL38777.1"
FT   CDS             join(956760..956939,959565..959926,960336..960474)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13720"
FT                   /product="mCG13720"
FT                   /note="gene_id=mCG13720.1 transcript_id=mCT17540.2
FT                   protein_id=mCP13698.1"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6H624"
FT                   /protein_id="EDL38776.1"
FT                   IFKL"
FT   gene            complement(961461..964302)
FT                   /gene="Tnfaip8l2"
FT                   /locus_tag="mCG_52206"
FT                   /note="gene_id=mCG52206.2"
FT   mRNA            complement(join(961461..962536,964255..964302))
FT                   /gene="Tnfaip8l2"
FT                   /locus_tag="mCG_52206"
FT                   /product="tumor necrosis factor, alpha-induced protein
FT                   8-like 2"
FT                   /note="gene_id=mCG52206.2 transcript_id=mCT52389.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(961936..962490)
FT                   /codon_start=1
FT                   /gene="Tnfaip8l2"
FT                   /locus_tag="mCG_52206"
FT                   /product="tumor necrosis factor, alpha-induced protein
FT                   8-like 2"
FT                   /note="gene_id=mCG52206.2 transcript_id=mCT52389.2
FT                   protein_id=mCP34913.1"
FT                   /protein_id="EDL38778.1"
FT   gene            966248..967642
FT                   /locus_tag="mCG_13714"
FT                   /note="gene_id=mCG13714.0"
FT   mRNA            966248..967642
FT                   /locus_tag="mCG_13714"
FT                   /product="mCG13714"
FT                   /note="gene_id=mCG13714.0 transcript_id=mCT17535.1 created
FT                   on 28-MAY-2002"
FT   CDS             966331..966534
FT                   /codon_start=1
FT                   /locus_tag="mCG_13714"
FT                   /product="mCG13714"
FT                   /note="gene_id=mCG13714.0 transcript_id=mCT17535.1
FT                   protein_id=mCP13712.2"
FT                   /protein_id="EDL38779.1"
FT   assembly_gap    971993..972096
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    972911..973031
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    975549..975568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <982391..995911
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /note="gene_id=mCG13711.3"
FT   mRNA            join(<982391..982598,984501..984549,985318..985407,
FT                   986225..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990472..990591,990694..990782,991049..991266,
FT                   991467..991598,991873..992025,992203..992376,
FT                   992636..992782,993058..993135,993219..993274,
FT                   993443..993487,993676..993771,994140..995910)
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, transcript variant
FT                   mCT193733"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT193733.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<982408..982598,986225..986399,988891..989005,
FT                   989298..989361,989509..989611,989884..989985,
FT                   990184..990274,990472..990591,990694..990782,
FT                   991049..991266,991467..991598,991873..992025,
FT                   992203..992376,992636..992782,993058..993135,
FT                   993219..993274,993443..993487,993676..993771,
FT                   994140..995897)
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, transcript variant
FT                   mCT193734"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT193734.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(982433..982598,984501..984549,985013..985157,
FT                   986225..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990472..990591,990694..990782,991049..991266,
FT                   991467..991598,991873..992025,992203..992376,
FT                   992636..992782,993058..993135,993219..993274,
FT                   993443..993487,994140..995911)
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, transcript variant
FT                   mCT17531"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT17531.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(986192..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990694..990782,991049..991266,991467..991598,
FT                   991873..992025,992203..992376,992636..992782,
FT                   993058..993135,993219..993274,993443..993487,
FT                   993676..993771,994140..995911)
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, transcript variant
FT                   mCT169556"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT169556.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(<986264..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990472..990591,990694..990782,991049..991266,
FT                   991467..991598,991873..992025,992203..992376,
FT                   992636..992782,993058..993135,993219..993274,
FT                   993443..993487,993676..993771,994140..995173)
FT                   /codon_start=1
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, isoform CRA_c"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT193733.0
FT                   protein_id=mCP114695.0 isoform=CRA_c"
FT                   /protein_id="EDL38782.1"
FT   CDS             join(986279..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990472..990591,990694..990782,991049..991266,
FT                   991467..991598,991873..992025,992203..992376,
FT                   992636..992782,993058..993135,993219..993274,
FT                   993443..993487,994140..995173)
FT                   /codon_start=1
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, isoform CRA_b"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT17531.2
FT                   protein_id=mCP13700.2 isoform=CRA_b"
FT                   /protein_id="EDL38781.1"
FT                   F"
FT   CDS             join(986279..986399,988891..989005,989298..989361,
FT                   989509..989565,989884..989985,990184..990274,
FT                   990694..990782,991049..991266,991467..991598,
FT                   991873..992025,992203..992376,992636..992782,
FT                   993058..993135,993219..993274,993443..993487,
FT                   993676..993771,994140..995173)
FT                   /codon_start=1
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, isoform CRA_a"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT169556.0
FT                   protein_id=mCP92867.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8N4"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR015514"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="InterPro:IPR036352"
FT                   /db_xref="MGI:MGI:1338032"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8N4"
FT                   /protein_id="EDL38780.1"
FT   CDS             join(<989570..989611,989884..989985,990184..990274,
FT                   990472..990591,990694..990782,991049..991266,
FT                   991467..991598,991873..992025,992203..992376,
FT                   992636..992782,993058..993135,993219..993274,
FT                   993443..993487,993676..993771,994140..995173)
FT                   /codon_start=1
FT                   /gene="Sema6c"
FT                   /locus_tag="mCG_13711"
FT                   /product="sema domain, transmembrane domain (TM), and
FT                   cytoplasmic domain, (semaphorin) 6C, isoform CRA_d"
FT                   /note="gene_id=mCG13711.3 transcript_id=mCT193734.0
FT                   protein_id=mCP114696.0 isoform=CRA_d"
FT                   /protein_id="EDL38783.1"
FT   gene            complement(1003642..1006765)
FT                   /locus_tag="mCG_1041506"
FT                   /note="gene_id=mCG1041506.1"
FT   mRNA            complement(join(1003642..1005419,1005790..1006765))
FT                   /locus_tag="mCG_1041506"
FT                   /product="mCG1041506"
FT                   /note="gene_id=mCG1041506.1 transcript_id=mCT159210.1
FT                   created on 28-MAY-2002"
FT   CDS             complement(1004884..1005084)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041506"
FT                   /product="mCG1041506"
FT                   /note="gene_id=mCG1041506.1 transcript_id=mCT159210.1
FT                   protein_id=mCP78296.1"
FT                   /protein_id="EDL38784.1"
FT   gene            complement(1009326..>1039483)
FT                   /gene="Gabpb2"
FT                   /locus_tag="mCG_145596"
FT                   /note="gene_id=mCG145596.1"
FT   mRNA            complement(join(1009326..1010851,1011030..1011160,
FT                   1012429..1012614,1021914..1022064,1025504..1025698,
FT                   1026415..1026582,1028237..1028376,1037985..1038039,
FT                   1039361..>1039483))
FT                   /gene="Gabpb2"
FT                   /locus_tag="mCG_145596"
FT                   /product="GA repeat binding protein, beta 2, transcript
FT                   variant mCT193746"
FT                   /note="gene_id=mCG145596.1 transcript_id=mCT193746.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1009599..1010851,1011030..1011160,
FT                   1012429..1012614,1021914..1022064,1025504..1026582,
FT                   1028237..1028376,1030614..1030710,1037985..1038039,
FT                   1039361..>1039482))
FT                   /gene="Gabpb2"
FT                   /locus_tag="mCG_145596"
FT                   /product="GA repeat binding protein, beta 2, transcript
FT                   variant mCT185020"
FT                   /note="gene_id=mCG145596.1 transcript_id=mCT185020.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1010546..1010851,1011030..1011160,
FT                   1012429..1012614,1021914..1022064,1025504..1025698,
FT                   1026415..1026582,1028237..1028376,1037985..>1038033))
FT                   /codon_start=1
FT                   /gene="Gabpb2"
FT                   /locus_tag="mCG_145596"
FT                   /product="GA repeat binding protein, beta 2, isoform CRA_b"
FT                   /note="gene_id=mCG145596.1 transcript_id=mCT193746.0
FT                   protein_id=mCP114698.0 isoform=CRA_b"
FT                   /protein_id="EDL38786.1"
FT   CDS             complement(join(1010546..1010851,1011030..1011160,
FT                   1012429..1012614,1021914..1022064,1025504..>1025740))
FT                   /codon_start=1
FT                   /gene="Gabpb2"
FT                   /locus_tag="mCG_145596"
FT                   /product="GA repeat binding protein, beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG145596.1 transcript_id=mCT185020.0
FT                   protein_id=mCP106331.0 isoform=CRA_a"
FT                   /protein_id="EDL38785.1"
FT   assembly_gap    1014354..1014373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1020447..1020466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1039228..1048563
FT                   /locus_tag="mCG_146332"
FT                   /note="gene_id=mCG146332.0"
FT   mRNA            join(<1039228..1039830,1041211..1041321,1043555..1043661,
FT                   1048428..1048563)
FT                   /locus_tag="mCG_146332"
FT                   /product="mCG146332"
FT                   /note="gene_id=mCG146332.0 transcript_id=mCT186435.0
FT                   created on 14-JUL-2003"
FT   CDS             <1039229..1039555
FT                   /codon_start=1
FT                   /locus_tag="mCG_146332"
FT                   /product="mCG146332"
FT                   /note="gene_id=mCG146332.0 transcript_id=mCT186435.0
FT                   protein_id=mCP107791.0"
FT                   /protein_id="EDL38787.1"
FT                   VKAL"
FT   gene            complement(1040319..1052330)
FT                   /gene="Mllt11"
FT                   /locus_tag="mCG_13708"
FT                   /note="gene_id=mCG13708.2"
FT   mRNA            complement(join(1040319..1042235,1049989..1050164,
FT                   1050957..1051110,1052228..1052330))
FT                   /gene="Mllt11"
FT                   /locus_tag="mCG_13708"
FT                   /product="myeloid/lymphoid or mixed-lineage leukemia
FT                   (trithorax homolog, Drosophila); translocated to, 11,
FT                   transcript variant mCT17528"
FT                   /note="gene_id=mCG13708.2 transcript_id=mCT17528.2 created
FT                   on 25-JUN-2002"
FT   mRNA            complement(join(1040319..1042235,1049989..1050164,
FT                   1050957..1051374))
FT                   /gene="Mllt11"
FT                   /locus_tag="mCG_13708"
FT                   /product="myeloid/lymphoid or mixed-lineage leukemia
FT                   (trithorax homolog, Drosophila); translocated to, 11,
FT                   transcript variant mCT170345"
FT                   /note="gene_id=mCG13708.2 transcript_id=mCT170345.0 created
FT                   on 25-JUN-2002"
FT   CDS             complement(1041957..1042229)
FT                   /codon_start=1
FT                   /gene="Mllt11"
FT                   /locus_tag="mCG_13708"
FT                   /product="myeloid/lymphoid or mixed-lineage leukemia
FT                   (trithorax homolog, Drosophila); translocated to, 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13708.2 transcript_id=mCT170345.0
FT                   protein_id=mCP93263.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q543U0"
FT                   /db_xref="InterPro:IPR026778"
FT                   /db_xref="InterPro:IPR033461"
FT                   /db_xref="MGI:MGI:1929671"
FT                   /db_xref="UniProtKB/TrEMBL:Q543U0"
FT                   /protein_id="EDL38788.1"
FT   CDS             complement(1041957..1042229)
FT                   /codon_start=1
FT                   /gene="Mllt11"
FT                   /locus_tag="mCG_13708"
FT                   /product="myeloid/lymphoid or mixed-lineage leukemia
FT                   (trithorax homolog, Drosophila); translocated to, 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13708.2 transcript_id=mCT17528.2
FT                   protein_id=mCP13692.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q543U0"
FT                   /db_xref="InterPro:IPR026778"
FT                   /db_xref="InterPro:IPR033461"
FT                   /db_xref="MGI:MGI:1929671"
FT                   /db_xref="UniProtKB/TrEMBL:Q543U0"
FT                   /protein_id="EDL38789.1"
FT   assembly_gap    1045568..1045733
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            1050653..1058267
FT                   /gene="Cdc42se1"
FT                   /locus_tag="mCG_13715"
FT                   /note="gene_id=mCG13715.1"
FT   mRNA            join(1050653..1050770,1053642..1053949,1054406..1054516,
FT                   1055345..1055436,1056107..1058267)
FT                   /gene="Cdc42se1"
FT                   /locus_tag="mCG_13715"
FT                   /product="CDC42 small effector 1"
FT                   /note="gene_id=mCG13715.1 transcript_id=mCT17536.1 created
FT                   on 28-MAY-2002"
FT   assembly_gap    1051914..1051933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1053896..1053949,1054406..1054516,1055345..1055422)
FT                   /codon_start=1
FT                   /gene="Cdc42se1"
FT                   /locus_tag="mCG_13715"
FT                   /product="CDC42 small effector 1"
FT                   /note="gene_id=mCG13715.1 transcript_id=mCT17536.1
FT                   protein_id=mCP13670.1"
FT                   /protein_id="EDL38790.1"
FT   gene            complement(1061806..1073053)
FT                   /gene="Bnipl"
FT                   /locus_tag="mCG_122511"
FT                   /note="gene_id=mCG122511.0"
FT   mRNA            complement(join(1061806..1063718,1064593..1064691,
FT                   1064859..1064945,1066003..1066134,1066846..1066948,
FT                   1067511..1067693,1070437..1070661,1071667..1071731,
FT                   1072028..1072123,1072528..1072579,1072826..1073053))
FT                   /gene="Bnipl"
FT                   /locus_tag="mCG_122511"
FT                   /product="BCL2/adenovirus E1B 19kD interacting protein
FT                   like, transcript variant mCT123736"
FT                   /note="gene_id=mCG122511.0 transcript_id=mCT123736.1
FT                   created on 28-MAY-2002"
FT   mRNA            complement(join(1063152..1063718,1064593..1064691,
FT                   1064859..1064945,1066003..1066134,1066846..1066948,
FT                   1067511..1067693,1070437..1070661,1071667..1071731,
FT                   1072028..1072123,1072826..>1072963))
FT                   /gene="Bnipl"
FT                   /locus_tag="mCG_122511"
FT                   /product="BCL2/adenovirus E1B 19kD interacting protein
FT                   like, transcript variant mCT193720"
FT                   /note="gene_id=mCG122511.0 transcript_id=mCT193720.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1063682..1063718,1064593..1064691,
FT                   1064859..1064945,1066003..1066134,1066846..1066948,
FT                   1067511..1067693,1070437..1070661,1071667..1071731,
FT                   1072028..1072123,1072826..>1072953))
FT                   /codon_start=1
FT                   /gene="Bnipl"
FT                   /locus_tag="mCG_122511"
FT                   /product="BCL2/adenovirus E1B 19kD interacting protein
FT                   like, isoform CRA_b"
FT                   /note="gene_id=mCG122511.0 transcript_id=mCT193720.0
FT                   protein_id=mCP114681.0 isoform=CRA_b"
FT                   /protein_id="EDL38792.1"
FT   CDS             complement(join(1063682..1063718,1064593..1064691,
FT                   1064859..1064945,1066003..1066134,1066846..1066948,
FT                   1067511..1067693,1070437..1070661,1071667..1071731,
FT                   1072028..1072083))
FT                   /codon_start=1
FT                   /gene="Bnipl"
FT                   /locus_tag="mCG_122511"
FT                   /product="BCL2/adenovirus E1B 19kD interacting protein
FT                   like, isoform CRA_a"
FT                   /note="gene_id=mCG122511.0 transcript_id=mCT123736.1
FT                   protein_id=mCP78195.1 isoform=CRA_a"
FT                   /protein_id="EDL38791.1"
FT   gene            complement(1075533..1103902)
FT                   /gene="Prune"
FT                   /locus_tag="mCG_13710"
FT                   /note="gene_id=mCG13710.1"
FT   mRNA            complement(join(1075533..1077346,1081317..1081413,
FT                   1084290..1084448,1085671..1085855,1087497..1087699,
FT                   1090310..1090402,1103695..1103902))
FT                   /gene="Prune"
FT                   /locus_tag="mCG_13710"
FT                   /product="prune homolog (Drosophila)"
FT                   /note="gene_id=mCG13710.1 transcript_id=mCT17530.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1076857..1077346,1081317..1081413,
FT                   1084290..1084448,1085671..1085855,1087497..1087699,
FT                   1090310..1090402,1103695..1103733))
FT                   /codon_start=1
FT                   /gene="Prune"
FT                   /locus_tag="mCG_13710"
FT                   /product="prune homolog (Drosophila)"
FT                   /note="gene_id=mCG13710.1 transcript_id=mCT17530.2
FT                   protein_id=mCP13705.2"
FT                   /protein_id="EDL38793.1"
FT   assembly_gap    1078006..1078025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1079581..1081286
FT                   /estimated_length=1706
FT                   /gap_type="unknown"
FT   assembly_gap    1097362..1097515
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    1102557..1102694
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   gene            1103582..1118273
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /note="gene_id=mCG140520.0"
FT   mRNA            join(1103582..1103734,1104793..1104854,1105341..1105735,
FT                   1109755..1110510,1113132..1113189,1113590..1113654,
FT                   1114235..1114393,1114735..1114837,1115735..1115877,
FT                   1116905..1117096,1117410..1117535,1117761..1118271)
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, transcript variant
FT                   mCT169920"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT169920.0
FT                   created on 17-JUL-2003"
FT   mRNA            join(1103954..1104041,1104793..1104854,1105030..1105735,
FT                   1106695..1106967,1109755..1110510,1113132..1113189,
FT                   1113590..1113654,1114235..1114393,1114735..1114837,
FT                   1115735..1115877,1116905..1117096,1117383..1117535,
FT                   1117761..1118273)
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, transcript variant
FT                   mCT169919"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT169919.0
FT                   created on 17-JUL-2003"
FT   mRNA            join(1103954..1104041,1104793..1104854,1105030..1105735,
FT                   1106695..1106967)
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, transcript variant
FT                   mCT185532"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT185532.0
FT                   created on 17-JUL-2003"
FT   CDS             join(1103964..1104041,1104793..1104854,1105030..1105234)
FT                   /codon_start=1
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, isoform CRA_b"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT185532.0
FT                   protein_id=mCP106790.0 isoform=CRA_b"
FT                   /protein_id="EDL38795.1"
FT                   SLPFCGSPGC"
FT   gene            complement(1104302..1110088)
FT                   /locus_tag="mCG_140522"
FT                   /note="gene_id=mCG140522.0"
FT   mRNA            complement(join(1104302..1105728,1109747..1110088))
FT                   /locus_tag="mCG_140522"
FT                   /product="mCG140522"
FT                   /note="gene_id=mCG140522.0 transcript_id=mCT169922.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(1105318..1105722)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140522"
FT                   /product="mCG140522"
FT                   /note="gene_id=mCG140522.0 transcript_id=mCT169922.0
FT                   protein_id=mCP92863.0"
FT                   /protein_id="EDL38797.1"
FT   CDS             join(1110058..1110510,1113132..1113189,1113590..1113654,
FT                   1114235..1114393,1114735..1114837,1115735..1115877,
FT                   1116905..1117096,1117383..1117535,1117761..1117841)
FT                   /codon_start=1
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, isoform CRA_c"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT169919.0
FT                   protein_id=mCP92888.0 isoform=CRA_c"
FT                   /db_xref="GOA:B7ZMR0"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="MGI:MGI:1922257"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZMR0"
FT                   /protein_id="EDL38796.1"
FT                   SKTESDCVLL"
FT   CDS             join(1110058..1110510,1113132..1113189,1113590..1113654,
FT                   1114235..1114393,1114735..1114837,1115735..1115877,
FT                   1116905..1117096,1117410..1117535,1117761..1117841)
FT                   /codon_start=1
FT                   /gene="4930504E06Rik"
FT                   /locus_tag="mCG_140520"
FT                   /product="RIKEN cDNA 4930504E06, isoform CRA_a"
FT                   /note="gene_id=mCG140520.0 transcript_id=mCT169920.0
FT                   protein_id=mCP92901.0 isoform=CRA_a"
FT                   /protein_id="EDL38794.1"
FT                   L"
FT   gene            complement(1118205..1129243)
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /note="gene_id=mCG122487.0"
FT   mRNA            complement(join(1118205..1118962,1119349..1119471,
FT                   1122265..1122323,1122414..1122509,1122643..1122727,
FT                   1123204..1123263,1123423..1123502,1124447..1124537,
FT                   1124778..1124891,1125098..1125192,1127973..1128069,
FT                   1128443..1128533,1129185..1129243))
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, transcript variant mCT123722"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT123722.0
FT                   created on 28-MAY-2002"
FT   mRNA            complement(join(1118206..1118962,1119349..1119471,
FT                   1122265..1122323,1122414..1122509,1122643..1122727,
FT                   1123204..1123263,1123423..1123502,1124447..1124537,
FT                   1124778..1124891,1125098..1125192,1127973..1128069,
FT                   1128443..1128533,1128792..>1128905))
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, transcript variant mCT193750"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT193750.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1118408..1118648,1118709..1118962,
FT                   1119349..1119471,1122265..1122323,1122414..1122509,
FT                   1122643..1122727,1123204..1123263,1123423..1123502,
FT                   1124447..1124537,1124778..1124891,1125098..1125192,
FT                   1127973..1128069,1128443..1128533,1128792..1128915))
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, transcript variant mCT169551"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT169551.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(1118900..1118962,1119349..1119471,
FT                   1122265..1122323,1122414..1122509,1122643..1122727,
FT                   1123204..1123263,1123423..1123502,1124447..1124537,
FT                   1124778..1124891,1125098..1125192,1127973..1128069,
FT                   1128443..1128533,1128792..>1128826))
FT                   /codon_start=1
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, isoform CRA_a"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT193750.0
FT                   protein_id=mCP114680.0 isoform=CRA_a"
FT                   /protein_id="EDL38798.1"
FT   CDS             complement(join(1118900..1118962,1119349..1119471,
FT                   1122265..1122323,1122414..1122509,1122643..1122727,
FT                   1123204..1123263,1123423..1123502,1124447..1124537,
FT                   1124778..1124891,1125098..1125192,1127973..1128069,
FT                   1128443..1128517))
FT                   /codon_start=1
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, isoform CRA_b"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT123722.0
FT                   protein_id=mCP78181.1 isoform=CRA_b"
FT                   /protein_id="EDL38799.1"
FT                   RAEDI"
FT   CDS             complement(join(1118900..1118962,1119349..1119471,
FT                   1122265..1122323,1122414..1122509,1122643..1122727,
FT                   1123204..1123263,1123423..1123502,1124447..1124537,
FT                   1124778..1124891,1125098..1125192,1127973..1128069,
FT                   1128443..1128517))
FT                   /codon_start=1
FT                   /gene="Anxa9"
FT                   /locus_tag="mCG_122487"
FT                   /product="annexin A9, isoform CRA_b"
FT                   /note="gene_id=mCG122487.0 transcript_id=mCT169551.0
FT                   protein_id=mCP92890.0 isoform=CRA_b"
FT                   /protein_id="EDL38800.1"
FT                   RAEDI"
FT   gene            complement(1133489..1137236)
FT                   /locus_tag="mCG_1041507"
FT                   /note="gene_id=mCG1041507.1"
FT   mRNA            complement(join(1133489..1133717,1136912..1137236))
FT                   /locus_tag="mCG_1041507"
FT                   /product="mCG1041507, transcript variant mCT169550"
FT                   /note="gene_id=mCG1041507.1 transcript_id=mCT169550.0
FT                   created on 28-MAY-2002"
FT   mRNA            complement(join(1133489..1133565,1133614..1134066,
FT                   1134202..>1134763))
FT                   /locus_tag="mCG_1041507"
FT                   /product="mCG1041507, transcript variant mCT159211"
FT                   /note="gene_id=mCG1041507.1 transcript_id=mCT159211.1
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(1133509..1133717,1136912..1137020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041507"
FT                   /product="mCG1041507, isoform CRA_b"
FT                   /note="gene_id=mCG1041507.1 transcript_id=mCT169550.0
FT                   protein_id=mCP92907.0 isoform=CRA_b"
FT                   /protein_id="EDL38802.1"
FT                   F"
FT   CDS             complement(join(1133509..1133565,1133614..>1133808))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041507"
FT                   /product="mCG1041507, isoform CRA_a"
FT                   /note="gene_id=mCG1041507.1 transcript_id=mCT159211.1
FT                   protein_id=mCP78298.1 isoform=CRA_a"
FT                   /protein_id="EDL38801.1"
FT   gene            <1136909..1145671
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /note="gene_id=mCG16756.3"
FT   mRNA            join(<1136909..1137011,1142171..1142344,1142751..1142868,
FT                   1143051..1143169,1143299..1143356,1143445..1143495,
FT                   1143684..1143776,1143940..>1143989)
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   transcript variant mCT193722"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT193722.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1136998..1137011,1142171..1142344,1142751..1142868,
FT                   1143051..1143169,1143299..1143356,1143445..1143495,
FT                   1143684..1143776,1143940..>1143989)
FT                   /codon_start=1
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT193722.0
FT                   protein_id=mCP114714.0 isoform=CRA_b"
FT                   /protein_id="EDL38805.1"
FT                   ILL"
FT   mRNA            join(1137319..1137454,1142171..1142344,1142751..1142868,
FT                   1143051..1143169,1143299..1143356,1143445..1143495,
FT                   1143684..1143776,1143940..1144068,1144236..1144342,
FT                   1144429..1144582,1144758..1145671)
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   transcript variant mCT12980"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT12980.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(1137385..1137454,1142171..1142344,1142751..1142868,
FT                   1143299..1143356,1143445..1143495,1143684..1143776,
FT                   1143940..1144068,1144236..>1144343)
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   transcript variant mCT193723"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT193723.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1140966..1141062,1142171..1142344,1142751..1142868,
FT                   1143051..1143169,1143299..1143356,1143445..1143495,
FT                   1143684..1143776,1143940..1144068,1144236..1144342,
FT                   1144429..1144582,1144758..1145671)
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   transcript variant mCT169803"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT169803.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(1142172..1142344,1142751..1142868,1143051..1143169,
FT                   1143299..1143356,1143445..1143495,1143684..1143776,
FT                   1143940..1144068,1144236..1144342,1144429..1144582,
FT                   1144758..1144898)
FT                   /codon_start=1
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT12980.2
FT                   protein_id=mCP13711.2 isoform=CRA_a"
FT                   /protein_id="EDL38803.1"
FT   CDS             join(1142172..1142344,1142751..1142868,1143051..1143169,
FT                   1143299..1143356,1143445..1143495,1143684..1143776,
FT                   1143940..1144068,1144236..1144342,1144429..1144582,
FT                   1144758..1144898)
FT                   /codon_start=1
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT169803.0
FT                   protein_id=mCP92904.0 isoform=CRA_a"
FT                   /protein_id="EDL38804.1"
FT   CDS             join(1142783..1142868,1143299..1143356,1143445..1143495,
FT                   1143684..1143776,1143940..1144068,1144236..>1144343)
FT                   /codon_start=1
FT                   /gene="Lass2"
FT                   /locus_tag="mCG_16756"
FT                   /product="longevity assurance homolog 2 (S. cerevisiae),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16756.3 transcript_id=mCT193723.0
FT                   protein_id=mCP114715.0 isoform=CRA_c"
FT                   /protein_id="EDL38806.1"
FT                   FIITRLVIMPFW"
FT   gene            complement(1145651..>1179339)
FT                   /locus_tag="mCG_16729"
FT                   /note="gene_id=mCG16729.2"
FT   mRNA            complement(join(1145651..1146299,1146414..1146502,
FT                   1146739..1146950,1147827..1147992,1148252..1148381,
FT                   1148495..1148523,1149317..1149945,1150657..1150826,
FT                   1159330..1159446,1160527..1161213,1162088..1162246,
FT                   1162343..1162493,1163515..1163644,1163837..1164027,
FT                   1167707..1167780,1168796..1168997,1169177..1169302,
FT                   1170177..1170276,1172020..1172054,1176724..1176875,
FT                   1178116..1178384,1179208..>1179339))
FT                   /locus_tag="mCG_16729"
FT                   /product="mCG16729, transcript variant mCT193718"
FT                   /note="gene_id=mCG16729.2 transcript_id=mCT193718.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1145651..1146299,1146414..1146502,
FT                   1146739..1146950,1147827..1147992,1148252..1148381,
FT                   1148495..1148523,1149317..1149945,1150657..1150826,
FT                   1159330..1159446,1160527..1161213,1162088..1162243,
FT                   1162343..1162493,1163515..1163644,1163837..1164027,
FT                   1167707..1167780,1168796..1168997,1169177..1169302,
FT                   1170177..1170276,1172020..1172054,1176724..1176875,
FT                   1178116..1178384,1179246..1179337))
FT                   /locus_tag="mCG_16729"
FT                   /product="mCG16729, transcript variant mCT12010"
FT                   /note="gene_id=mCG16729.2 transcript_id=mCT12010.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1146182..1146299,1146414..1146502,
FT                   1146739..1146950,1147827..1147992,1148252..1148381,
FT                   1148495..1148523,1149317..1149945,1150657..1150826,
FT                   1159330..1159446,1160527..1161213,1162088..1162246,
FT                   1162343..1162493,1163515..1163644,1163837..1164027,
FT                   1167707..1167780,1168796..1168997,1169177..1169302,
FT                   1170177..1170276,1172020..1172054,1176724..1176875,
FT                   1178116..1178384,1179208..>1179246))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16729"
FT                   /product="mCG16729, isoform CRA_b"
FT                   /note="gene_id=mCG16729.2 transcript_id=mCT193718.0
FT                   protein_id=mCP114709.0 isoform=CRA_b"
FT                   /protein_id="EDL38808.1"
FT   CDS             complement(join(1146182..1146299,1146414..1146502,
FT                   1146739..1146950,1147827..1147992,1148252..1148381,
FT                   1148495..1148523,1149317..1149945,1150657..1150826,
FT                   1159330..1159446,1160527..1161213,1162088..1162243,
FT                   1162343..1162493,1163515..1163644,1163837..1164027,
FT                   1167707..1167780,1168796..1168997,1169177..1169302,
FT                   1170177..1170276,1172020..1172054,1176724..1176875,
FT                   1178116..1178375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16729"
FT                   /product="mCG16729, isoform CRA_a"
FT                   /note="gene_id=mCG16729.2 transcript_id=mCT12010.1
FT                   protein_id=mCP13675.2 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8N3"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001739"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR007728"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR025796"
FT                   /db_xref="MGI:MGI:1934229"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8N3"
FT                   /protein_id="EDL38807.1"
FT   assembly_gap    1154020..1154312
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    1187543..1190559
FT                   /estimated_length=3017
FT                   /gap_type="unknown"
FT   gene            complement(1208856..1225156)
FT                   /locus_tag="mCG_148353"
FT                   /note="gene_id=mCG148353.0"
FT   mRNA            complement(join(1208856..1209452,1225021..1225156))
FT                   /locus_tag="mCG_148353"
FT                   /product="mCG148353"
FT                   /note="gene_id=mCG148353.0 transcript_id=mCT188616.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1209213..1209392)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148353"
FT                   /product="mCG148353"
FT                   /note="gene_id=mCG148353.0 transcript_id=mCT188616.0
FT                   protein_id=mCP109726.0"
FT                   /db_xref="GOA:A0A1B0GQX3"
FT                   /db_xref="InterPro:IPR020066"
FT                   /db_xref="MGI:MGI:1914904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GQX3"
FT                   /protein_id="EDL38809.1"
FT                   PYEVSSTTADLPLN"
FT   assembly_gap    1218286..1218305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1219380..1219399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1220501..1220710
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   gene            complement(<1232516..>1233512)
FT                   /locus_tag="mCG_122489"
FT                   /note="gene_id=mCG122489.1"
FT   mRNA            complement(join(<1232516..1232953,1233128..>1233512))
FT                   /locus_tag="mCG_122489"
FT                   /product="mCG122489, transcript variant mCT172363"
FT                   /note="gene_id=mCG122489.1 transcript_id=mCT172363.0
FT                   created on 21-AUG-2002"
FT   mRNA            complement(<1232516..>1233511)
FT                   /locus_tag="mCG_122489"
FT                   /product="mCG122489, transcript variant mCT123723"
FT                   /note="gene_id=mCG122489.1 transcript_id=mCT123723.1
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(1232516..1232953,1233128..>1233454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122489"
FT                   /product="mCG122489, isoform CRA_b"
FT                   /note="gene_id=mCG122489.1 transcript_id=mCT172363.0
FT                   protein_id=mCP95282.0 isoform=CRA_b"
FT                   /protein_id="EDL38811.1"
FT   CDS             complement(1232516..>1233454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122489"
FT                   /product="mCG122489, isoform CRA_a"
FT                   /note="gene_id=mCG122489.1 transcript_id=mCT123723.1
FT                   protein_id=mCP78270.1 isoform=CRA_a"
FT                   /protein_id="EDL38810.1"
FT   gene            complement(1237206..1237747)
FT                   /locus_tag="mCG_16739"
FT                   /note="gene_id=mCG16739.0"
FT   mRNA            complement(1237206..1237747)
FT                   /locus_tag="mCG_16739"
FT                   /product="mCG16739"
FT                   /note="gene_id=mCG16739.0 transcript_id=mCT12020.0 created
FT                   on 14-AUG-2002"
FT   CDS             complement(1237400..1237705)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16739"
FT                   /product="mCG16739"
FT                   /note="gene_id=mCG16739.0 transcript_id=mCT12020.0
FT                   protein_id=mCP13674.1"
FT                   /protein_id="EDL38812.1"
FT   gene            1249882..>1252717
FT                   /locus_tag="mCG_122530"
FT                   /note="gene_id=mCG122530.1"
FT   mRNA            join(1249882..1249973,1250832..1251100,1252566..>1252717)
FT                   /locus_tag="mCG_122530"
FT                   /product="mCG122530"
FT                   /note="gene_id=mCG122530.1 transcript_id=mCT123752.1
FT                   created on 28-MAY-2002"
FT   CDS             join(1250841..1251100,1252566..>1252717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122530"
FT                   /product="mCG122530"
FT                   /note="gene_id=mCG122530.1 transcript_id=mCT123752.1
FT                   protein_id=mCP78128.0"
FT                   /protein_id="EDL38813.1"
FT   gene            <1256666..1317483
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /note="gene_id=mCG16736.2"
FT   mRNA            join(1256666..1256840,1270649..1270760,1274861..1274905,
FT                   1282653..1282697,1289070..1289114,1292450..1292663,
FT                   1296452..1296665,1297993..1298095,1302108..1302173,
FT                   1302667..1302752,1305685..1305761,1306772..1306906,
FT                   1309162..1309236,1310268..1310419,1311505..1311615,
FT                   1311794..1311869,1312168..1312291,1312466..1312568,
FT                   1312936..1313083,1315611..1315773,1316360..1316526,
FT                   1317217..1317483)
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   transcript variant mCT12017"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT12017.1 created
FT                   on 28-MAY-2002"
FT   mRNA            join(<1256666..1256840,1270649..1270760,1274861..1274905,
FT                   1282653..1282697,1289070..1289114,1292450..1292663,
FT                   1296452..1296665,1297993..1298095,1302108..1302173,
FT                   1302667..1302752,1305685..1305761,1306772..1306906,
FT                   1309162..1309236,1310268..1310419,1311505..1311615,
FT                   1311794..1311869,1312168..1312291,1312466..1312568,
FT                   1312936..1313535)
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   transcript variant mCT193715"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT193715.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1256726..1256840,1270649..1270760,1274861..1274905,
FT                   1282653..1282697,1289070..1289114,1292450..1292663,
FT                   1296452..1296665,1297993..1298095,1302108..1302173,
FT                   1302667..1302752,1305685..1305761,1306772..1306906,
FT                   1309162..1309236,1310268..1310419,1311505..1311615,
FT                   1311794..1311869,1312168..1312291,1312466..1312568,
FT                   1312936..1313152)
FT                   /codon_start=1
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT193715.0
FT                   protein_id=mCP114711.0 isoform=CRA_b"
FT                   /protein_id="EDL38815.1"
FT                   VCGIFFFSSR"
FT   mRNA            join(<1256816..1256840,1270649..1270760,1274861..1274905,
FT                   1282653..1282702,1292470..1292663,1296452..1296665,
FT                   1297993..1298095,1302108..1302173,1302667..1302752,
FT                   1305685..1305761,1306772..1306906,1309162..1309236,
FT                   1310268..1310419,1311505..1311615,1311794..1311869,
FT                   1312168..1312291,1312466..1312568,1312936..1313083,
FT                   1315611..1315773,1316360..1316526,1317217..1317483)
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   transcript variant mCT193714"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT193714.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1256816..1256840,1270649..1270760,1274861..1274905,
FT                   1282653..1282697,1289070..1289114,1292450..1292663,
FT                   1296452..1296665,1297993..1298095,1302108..1302173,
FT                   1302667..1302752,1305685..1305761,1306772..1306906,
FT                   1309162..1309236,1310268..1310419,1311505..1311615,
FT                   1311794..1311869,1312168..1312291,1312466..1312568,
FT                   1312936..1313083,1315611..1315773,1316360..1316526,
FT                   1317217..1317306)
FT                   /codon_start=1
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT12017.1
FT                   protein_id=mCP13715.1 isoform=CRA_c"
FT                   /db_xref="GOA:P53762"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001067"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="MGI:MGI:88071"
FT                   /db_xref="PDB:4ZP4"
FT                   /db_xref="PDB:4ZPH"
FT                   /db_xref="PDB:4ZPK"
FT                   /db_xref="PDB:4ZPR"
FT                   /db_xref="PDB:4ZQD"
FT                   /db_xref="PDB:5SY5"
FT                   /db_xref="PDB:5SY7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53762"
FT                   /protein_id="EDL38816.1"
FT   CDS             join(<1292472..1292663,1296452..1296665,1297993..1298095,
FT                   1302108..1302173,1302667..1302752,1305685..1305761,
FT                   1306772..1306906,1309162..1309236,1310268..1310419,
FT                   1311505..1311615,1311794..1311869,1312168..1312291,
FT                   1312466..1312568,1312936..1313083,1315611..1315773,
FT                   1316360..1316526,1317217..1317306)
FT                   /codon_start=1
FT                   /gene="Arnt"
FT                   /locus_tag="mCG_16736"
FT                   /product="aryl hydrocarbon receptor nuclear translocator,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16736.2 transcript_id=mCT193714.0
FT                   protein_id=mCP114710.0 isoform=CRA_a"
FT                   /protein_id="EDL38814.1"
FT   gene            1321179..1331298
FT                   /gene="Ctsk"
FT                   /locus_tag="mCG_16733"
FT                   /note="gene_id=mCG16733.3"
FT   mRNA            join(1321179..1321249,1322747..1322867,1323260..1323382,
FT                   1323464..1323524,1324652..1324713,1328483..1328648,
FT                   1328834..1328939,1330750..1331298)
FT                   /gene="Ctsk"
FT                   /locus_tag="mCG_16733"
FT                   /product="cathepsin K, transcript variant mCT186613"
FT                   /note="gene_id=mCG16733.3 transcript_id=mCT186613.0 created
FT                   on 21-JUL-2003"
FT   mRNA            join(1321197..1321249,1322747..1322867,1323260..1323382,
FT                   1323464..1323619,1324495..1324713,1328483..1328648,
FT                   1328834..1328939,1330750..1331289)
FT                   /gene="Ctsk"
FT                   /locus_tag="mCG_16733"
FT                   /product="cathepsin K, transcript variant mCT12014"
FT                   /note="gene_id=mCG16733.3 transcript_id=mCT12014.1 created
FT                   on 21-JUL-2003"
FT   CDS             join(1322748..1322867,1323260..1323382,1323464..1323619,
FT                   1324495..1324713,1328483..1328648,1328834..1328939,
FT                   1330750..1330849)
FT                   /codon_start=1
FT                   /gene="Ctsk"
FT                   /locus_tag="mCG_16733"
FT                   /product="cathepsin K, isoform CRA_a"
FT                   /note="gene_id=mCG16733.3 transcript_id=mCT12014.1
FT                   protein_id=mCP13709.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q545T0"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR015644"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="MGI:MGI:107823"
FT                   /db_xref="UniProtKB/TrEMBL:Q545T0"
FT                   /protein_id="EDL38817.1"
FT   CDS             join(1322748..1322867,1323260..1323382,1323464..1323524,
FT                   1324652..1324713,1328483..1328648,1328834..1328939,
FT                   1330750..1330849)
FT                   /codon_start=1
FT                   /gene="Ctsk"
FT                   /locus_tag="mCG_16733"
FT                   /product="cathepsin K, isoform CRA_b"
FT                   /note="gene_id=mCG16733.3 transcript_id=mCT186613.0
FT                   protein_id=mCP107848.0 isoform=CRA_b"
FT                   /protein_id="EDL38818.1"
FT   gene            1348775..1378625
FT                   /gene="Ctss"
FT                   /locus_tag="mCG_16731"
FT                   /note="gene_id=mCG16731.1"
FT   mRNA            join(1348775..1348856,1351356..1351479,1360636..1360758,
FT                   1365242..1365391,1367562..1367792,1369025..1369190,
FT                   1372282..1372384,1378315..1378625)
FT                   /gene="Ctss"
FT                   /locus_tag="mCG_16731"
FT                   /product="cathepsin S"
FT                   /note="gene_id=mCG16731.1 transcript_id=mCT12012.1 created
FT                   on 28-MAY-2002"
FT   CDS             join(1348825..1348856,1351356..1351479,1360636..1360758,
FT                   1365242..1365391,1367562..1367792,1369025..1369190,
FT                   1372282..1372384,1378315..1378414)
FT                   /codon_start=1
FT                   /gene="Ctss"
FT                   /locus_tag="mCG_16731"
FT                   /product="cathepsin S"
FT                   /note="gene_id=mCG16731.1 transcript_id=mCT12012.1
FT                   protein_id=mCP13701.1"
FT                   /db_xref="GOA:Q8BSZ5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:107341"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BSZ5"
FT                   /protein_id="EDL38819.1"
FT                   EI"
FT   gene            1352224..1353054
FT                   /pseudo
FT                   /locus_tag="mCG_122529"
FT                   /note="gene_id=mCG122529.1"
FT   mRNA            1352224..1353054
FT                   /pseudo
FT                   /locus_tag="mCG_122529"
FT                   /note="gene_id=mCG122529.1 transcript_id=mCT123751.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    1362374..1362415
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1364739..1364758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1381903..1410291
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /note="gene_id=mCG16728.2"
FT   mRNA            join(<1381903..1381952,1383457..1383509,1384708..1384852,
FT                   1388848..1388911,1389911..1389947,1392893..1392913,
FT                   1393155..1393181,1397762..1397829,1398504..1398655,
FT                   1400488..1400735,1402439..1402505,1402592..1402668,
FT                   1403941..1404024,1407578..1407652,1407973..1408027,
FT                   1409819..1410291)
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, transcript variant
FT                   mCT12009"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT12009.2 created
FT                   on 28-MAY-2002"
FT   CDS             join(<1381904..1381952,1383457..1383509,1384708..1384852,
FT                   1388848..1388911,1389911..1389947,1392893..1392913,
FT                   1393155..1393181,1397762..1397829,1398504..1398655,
FT                   1400488..1400735,1402439..1402505,1402592..1402668,
FT                   1403941..1404024,1407578..1407652,1407973..1407996)
FT                   /codon_start=1
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT12009.2
FT                   protein_id=mCP13718.2 isoform=CRA_a"
FT                   /protein_id="EDL38820.1"
FT   mRNA            join(1381906..1381961,1383457..1383509,1384708..1384852,
FT                   1388848..1388911,1389911..1389947,1392893..1392913,
FT                   1393155..1393181,1397762..1397829,1398504..1398655,
FT                   1400488..1400735,1402439..1402505,1402592..1402668,
FT                   1403941..1404024,1407578..1407652,1409819..1410030)
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, transcript variant
FT                   mCT169563"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT169563.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(<1381907..1381961,1383457..1383509,1384708..1384852,
FT                   1388848..1388911,1389911..1389947,1392893..1392913,
FT                   1393155..1393181,1397762..1397829,1398504..1398655,
FT                   1400488..1400735,1402439..1402505,1402592..1402668,
FT                   1403941..1404024,1407578..1407652,1407973..1408027,
FT                   1409819..1410032)
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, transcript variant
FT                   mCT193713"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT193713.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1381961..1381961,1383457..1383509,1384708..1384852,
FT                   1388848..1388911,1389911..1389947,1392893..1392913,
FT                   1393155..1393181,1397762..1397829,1398504..1398655,
FT                   1400488..1400735,1402439..1402505,1402592..1402668,
FT                   1403941..1404024,1407578..1407652,1407973..1407996)
FT                   /codon_start=1
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT193713.0
FT                   protein_id=mCP114708.0 isoform=CRA_c"
FT                   /protein_id="EDL38822.1"
FT   CDS             join(1383474..1383509,1384708..1384852,1388848..1388911,
FT                   1389911..1389947,1392893..1392913,1393155..1393181,
FT                   1397762..1397829,1398504..1398655,1400488..1400735,
FT                   1402439..1402505,1402592..1402668,1403941..1404024,
FT                   1407578..1407652,1409819..1409896)
FT                   /codon_start=1
FT                   /gene="Hormad1"
FT                   /locus_tag="mCG_16728"
FT                   /product="HORMA domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG16728.2 transcript_id=mCT169563.0
FT                   protein_id=mCP92874.0 isoform=CRA_b"
FT                   /protein_id="EDL38821.1"
FT   gene            1411382..1441682
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /note="gene_id=mCG16764.2"
FT   mRNA            join(1411382..1411572,1414155..1414343,1430347..1430478,
FT                   1432113..1432227,1439485..1439683,1440304..1441682)
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, transcript variant
FT                   mCT12409"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT12409.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(1411382..1411572,1414155..1414343,1430347..1430478,
FT                   1432113..1432227,1439485..1440176)
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, transcript variant
FT                   mCT169805"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT169805.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(1411382..1411572,1430347..1430478,1432113..1432227,
FT                   1439485..1440176)
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, transcript variant
FT                   mCT169806"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT169806.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(1411405..1411572,1414155..1414343,1430347..1430478,
FT                   1432113..1432227,1439485..1439683,1440304..1440343)
FT                   /codon_start=1
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, isoform CRA_c"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT12409.2
FT                   protein_id=mCP13683.1 isoform=CRA_c"
FT                   /db_xref="GOA:K3W4Q3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="MGI:MGI:1917129"
FT                   /db_xref="UniProtKB/TrEMBL:K3W4Q3"
FT                   /protein_id="EDL38825.1"
FT   CDS             join(1411405..1411572,1414155..1414343,1430347..1430478,
FT                   1432113..1432227,1439485..1439912)
FT                   /codon_start=1
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, isoform CRA_a"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT169805.0
FT                   protein_id=mCP92896.0 isoform=CRA_a"
FT                   /db_xref="GOA:H3BJ07"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="MGI:MGI:1917129"
FT                   /db_xref="UniProtKB/TrEMBL:H3BJ07"
FT                   /protein_id="EDL38823.1"
FT                   NKS"
FT   CDS             join(1411405..1411572,1430347..1430478,1432113..1432227,
FT                   1439485..1439912)
FT                   /codon_start=1
FT                   /gene="Golph3l"
FT                   /locus_tag="mCG_16764"
FT                   /product="golgi phosphoprotein 3-like, isoform CRA_b"
FT                   /note="gene_id=mCG16764.2 transcript_id=mCT169806.0
FT                   protein_id=mCP92885.0 isoform=CRA_b"
FT                   /db_xref="GOA:K3W4N3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="MGI:MGI:1917129"
FT                   /db_xref="UniProtKB/TrEMBL:K3W4N3"
FT                   /protein_id="EDL38824.1"
FT   gene            1444680..1445252
FT                   /locus_tag="mCG_16751"
FT                   /note="gene_id=mCG16751.0"
FT   mRNA            1444680..1445252
FT                   /locus_tag="mCG_16751"
FT                   /product="mCG16751"
FT                   /note="gene_id=mCG16751.0 transcript_id=mCT12495.0 created
FT                   on 28-MAY-2002"
FT   CDS             1444719..1445216
FT                   /codon_start=1
FT                   /locus_tag="mCG_16751"
FT                   /product="mCG16751"
FT                   /note="gene_id=mCG16751.0 transcript_id=mCT12495.0
FT                   protein_id=mCP13690.1"
FT                   /protein_id="EDL38826.1"
FT                   PQ"
FT   assembly_gap    1445395..1445414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1447388..1454521
FT                   /locus_tag="mCG_16755"
FT                   /note="gene_id=mCG16755.2"
FT   mRNA            join(1447388..1447586,1449159..1449284,1450952..1451697)
FT                   /locus_tag="mCG_16755"
FT                   /product="mCG16755, transcript variant mCT12496"
FT                   /note="gene_id=mCG16755.2 transcript_id=mCT12496.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(1447420..1447586,1449159..1449284,1450952..1451118,
FT                   1453843..1454521)
FT                   /locus_tag="mCG_16755"
FT                   /product="mCG16755, transcript variant mCT169802"
FT                   /note="gene_id=mCG16755.2 transcript_id=mCT169802.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(1447530..1447586,1449159..1449284,1450952..1451118,
FT                   1453843..1453858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16755"
FT                   /product="mCG16755, isoform CRA_b"
FT                   /note="gene_id=mCG16755.2 transcript_id=mCT169802.0
FT                   protein_id=mCP92855.0 isoform=CRA_b"
FT                   /protein_id="EDL38828.1"
FT                   QRKSSLVTSKLAGGQVE"
FT   CDS             join(1447530..1447586,1449159..1449284,1450952..1451122)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16755"
FT                   /product="mCG16755, isoform CRA_a"
FT                   /note="gene_id=mCG16755.2 transcript_id=mCT12496.2
FT                   protein_id=mCP13708.2 isoform=CRA_a"
FT                   /db_xref="GOA:P60840"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="MGI:MGI:1891189"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60840"
FT                   /protein_id="EDL38827.1"
FT                   QRKSSLVTSKLAG"
FT   gene            1481200..1485431
FT                   /gene="Mcl1"
FT                   /locus_tag="mCG_16749"
FT                   /note="gene_id=mCG16749.1"
FT   mRNA            join(1481200..1481307,1481373..1481742,1482016..1482263,
FT                   1482962..1485431)
FT                   /gene="Mcl1"
FT                   /locus_tag="mCG_16749"
FT                   /product="myeloid cell leukemia sequence 1"
FT                   /note="gene_id=mCG16749.1 transcript_id=mCT12494.2 created
FT                   on 28-MAY-2002"
FT   CDS             join(1481248..1481307,1481373..1481742,1482016..1482263,
FT                   1482962..1483078)
FT                   /codon_start=1
FT                   /gene="Mcl1"
FT                   /locus_tag="mCG_16749"
FT                   /product="myeloid cell leukemia sequence 1"
FT                   /note="gene_id=mCG16749.1 transcript_id=mCT12494.2
FT                   protein_id=mCP13686.2"
FT                   /protein_id="EDL38829.1"
FT   assembly_gap    1481308..1481372
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    1497891..1498039
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(1498588..1510767)
FT                   /gene="Adamtsl4"
FT                   /locus_tag="mCG_16752"
FT                   /note="gene_id=mCG16752.2"
FT   mRNA            complement(join(1498588..1499350,1499492..1499636,
FT                   1499909..1500088,1500189..1500386,1502465..1502641,
FT                   1502868..1503072,1503323..1503452,1503615..1503800,
FT                   1503902..1504013,1504138..1504310,1504530..1504734,
FT                   1505086..1505222,1506183..1506285,1506508..1507114,
FT                   1507236..1507573,1507834..1507891,1508321..1508418,
FT                   1510704..1510767))
FT                   /gene="Adamtsl4"
FT                   /locus_tag="mCG_16752"
FT                   /product="ADAMTS-like 4"
FT                   /note="gene_id=mCG16752.2 transcript_id=mCT13152.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1499214..1499350,1499492..1499636,
FT                   1499909..1500088,1500189..1500386,1502465..1502641,
FT                   1502868..1503072,1503323..1503452,1503615..1503800,
FT                   1503902..1504013,1504138..1504310,1504530..1504734,
FT                   1505086..1505222,1506183..1506285,1506508..1507114,
FT                   1507236..1507573,1507834..1507891,1508321..1508340))
FT                   /codon_start=1
FT                   /gene="Adamtsl4"
FT                   /locus_tag="mCG_16752"
FT                   /product="ADAMTS-like 4"
FT                   /note="gene_id=mCG16752.2 transcript_id=mCT13152.2
FT                   protein_id=mCP13695.2"
FT                   /protein_id="EDL38830.1"
FT   assembly_gap    1501955..1501974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1509939..1510202
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    1512867..1513128
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    1534474..1534493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1545041..1545060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1550946..1550965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1557916..>1563336)
FT                   /gene="Ecm1"
FT                   /locus_tag="mCG_16748"
FT                   /note="gene_id=mCG16748.1"
FT   mRNA            complement(join(1557916..1558238,1558590..1558677,
FT                   1558966..1559186,1559614..1559988,1560239..1560558,
FT                   1560780..1560824,1561400..1561480,1561575..1561655,
FT                   1561779..1561883,1562006..1562068,1563140..1563329))
FT                   /gene="Ecm1"
FT                   /locus_tag="mCG_16748"
FT                   /product="extracellular matrix protein 1, transcript
FT                   variant mCT12028"
FT                   /note="gene_id=mCG16748.1 transcript_id=mCT12028.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(1557917..1558238,1558590..1558677,
FT                   1558966..1559186,1559614..1559988,1560239..1560558,
FT                   1560780..1560821,1561400..1561480,1561575..1561709,
FT                   1561779..1561880,1562006..1562068,1563140..>1563336))
FT                   /gene="Ecm1"
FT                   /locus_tag="mCG_16748"
FT                   /product="extracellular matrix protein 1, transcript
FT                   variant mCT193721"
FT                   /note="gene_id=mCG16748.1 transcript_id=mCT193721.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1558008..1558238,1558590..1558677,
FT                   1558966..1559186,1559614..1559988,1560239..1560558,
FT                   1560780..1560821,1561400..1561480,1561575..1561709,
FT                   1561779..1561880,1562006..1562068,1563140..>1563233))
FT                   /codon_start=1
FT                   /gene="Ecm1"
FT                   /locus_tag="mCG_16748"
FT                   /product="extracellular matrix protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16748.1 transcript_id=mCT193721.0
FT                   protein_id=mCP114713.0 isoform=CRA_a"
FT                   /protein_id="EDL38831.1"
FT                   APGSKEE"
FT   CDS             complement(join(1558008..1558238,1558590..1558677,
FT                   1558966..1559186,1559614..1559988,1560239..1560558,
FT                   1560780..1560824,1561400..1561480,1561575..1561655,
FT                   1561779..1561883,1562006..1562068,1563140..1563209))
FT                   /codon_start=1
FT                   /gene="Ecm1"
FT                   /locus_tag="mCG_16748"
FT                   /product="extracellular matrix protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16748.1 transcript_id=mCT12028.0
FT                   protein_id=mCP13678.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TDX7"
FT                   /db_xref="InterPro:IPR008605"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="MGI:MGI:103060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDX7"
FT                   /protein_id="EDL38832.1"
FT   gene            complement(1563736..>1576898)
FT                   /gene="Tarsl1"
FT                   /locus_tag="mCG_16754"
FT                   /note="gene_id=mCG16754.2"
FT   mRNA            complement(join(1563736..1564086,1565089..1565203,
FT                   1565841..1565913,1566083..1566184,1566345..1566445,
FT                   1569552..1569629,1569800..1569937,1570303..1570465,
FT                   1571207..1571424,1571810..1571908,1572255..1572401,
FT                   1574107..1574185,1574469..1574533,1574635..1574752,
FT                   1575274..1575398,1576775..>1576898))
FT                   /gene="Tarsl1"
FT                   /locus_tag="mCG_16754"
FT                   /product="threonyl-tRNA synthetase-like 1"
FT                   /note="gene_id=mCG16754.2 transcript_id=mCT12979.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1563938..1564086,1565089..1565203,
FT                   1565841..1565913,1566083..1566184,1566345..1566445,
FT                   1569552..1569629,1569800..1569937,1570303..1570465,
FT                   1571207..1571424,1571810..1571908,1572255..1572401,
FT                   1574107..1574185,1574469..1574533,1574635..1574752,
FT                   1575274..1575398,1576775..>1576897))
FT                   /codon_start=1
FT                   /gene="Tarsl1"
FT                   /locus_tag="mCG_16754"
FT                   /product="threonyl-tRNA synthetase-like 1"
FT                   /note="gene_id=mCG16754.2 transcript_id=mCT12979.2
FT                   protein_id=mCP13704.2"
FT                   /protein_id="EDL38833.1"
FT   assembly_gap    1577616..1583428
FT                   /estimated_length=5813
FT                   /gap_type="unknown"
FT   gene            complement(1587164..1643144)
FT                   /locus_tag="mCG_16744"
FT                   /note="gene_id=mCG16744.2"
FT   mRNA            complement(join(1587164..1587981,1588557..1590320,
FT                   1595882..1596082,1597998..1598258,1600398..1600680,
FT                   1604302..1604477,1608100..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..1643144))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT12025"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT12025.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1587563..1587981,1588557..1590320,
FT                   1595882..1596082,1597998..1598258,1600398..1600680,
FT                   1604302..1604477,1608100..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..1642638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_a"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT12025.2
FT                   protein_id=mCP13672.2 isoform=CRA_a"
FT                   /protein_id="EDL38834.1"
FT   assembly_gap    1588144..1588163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1596594..1598258,1600398..1600680,
FT                   1604302..1604477,1608100..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..>1642666))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT193716"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT193716.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1597990..1598258,1600398..1600680,
FT                   1604302..1604477,1608100..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..>1642665))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_f"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT193716.0
FT                   protein_id=mCP114712.0 isoform=CRA_f"
FT                   /protein_id="EDL38839.1"
FT   mRNA            complement(join(1607854..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..1643144))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT169798"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169798.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1608038..1608226,1608940..1608992,
FT                   1610206..1610283,1611170..1611270,1613986..1614115,
FT                   1642434..1642638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_b"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169798.0
FT                   protein_id=mCP92908.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="MGI:MGI:1922387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4Z4"
FT                   /protein_id="EDL38835.1"
FT   mRNA            complement(join(1610010..1610283,1611170..1611270,
FT                   1642434..1643144))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT169800"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169800.0 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1610030..1610283,1611170..1611270,
FT                   1613986..1614115,1642434..1643144))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT169801"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169801.0 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1610030..1611270,1613986..1614115,
FT                   1642434..1643144))
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, transcript variant mCT169799"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169799.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1610183..1610283,1611170..1611270,
FT                   1613986..1614115,1642434..1642638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_e"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169801.0
FT                   protein_id=mCP92900.0 isoform=CRA_e"
FT                   /protein_id="EDL38838.1"
FT                   NKQWKKSQSKEQNLN"
FT   CDS             complement(join(1611153..1611270,1613986..1614115,
FT                   1642434..1642638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_c"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169799.0
FT                   protein_id=mCP92857.0 isoform=CRA_c"
FT                   /protein_id="EDL38836.1"
FT   CDS             complement(join(1611245..1611270,1642434..1642638))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16744"
FT                   /product="mCG16744, isoform CRA_d"
FT                   /note="gene_id=mCG16744.2 transcript_id=mCT169800.0
FT                   protein_id=mCP92889.0 isoform=CRA_d"
FT                   /protein_id="EDL38837.1"
FT   gene            1628737..1629695
FT                   /pseudo
FT                   /locus_tag="mCG_52330"
FT                   /note="gene_id=mCG52330.2"
FT   mRNA            1628737..1629695
FT                   /pseudo
FT                   /locus_tag="mCG_52330"
FT                   /note="gene_id=mCG52330.2 transcript_id=mCT52513.2 created
FT                   on 29-MAY-2002"
FT   gene            1631672..1634393
FT                   /locus_tag="mCG_1041512"
FT                   /note="gene_id=mCG1041512.0"
FT   mRNA            join(1631672..1631720,1633816..1634393)
FT                   /locus_tag="mCG_1041512"
FT                   /product="mCG1041512"
FT                   /note="gene_id=mCG1041512.0 transcript_id=mCT159216.0
FT                   created on 29-MAY-2002"
FT   CDS             1634121..1634258
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041512"
FT                   /product="mCG1041512"
FT                   /note="gene_id=mCG1041512.0 transcript_id=mCT159216.0
FT                   protein_id=mCP78187.1"
FT                   /protein_id="EDL38840.1"
FT                   "
FT   assembly_gap    1651252..1651606
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   gene            complement(1654979..1680161)
FT                   /gene="Prpf3"
FT                   /locus_tag="mCG_16743"
FT                   /note="gene_id=mCG16743.1"
FT   mRNA            complement(join(1654979..1655332,1658056..1658139,
FT                   1658387..1658505,1659657..1659770,1659947..1660046,
FT                   1660718..1660861,1664973..1665052,1668489..1668655,
FT                   1669228..1669534,1671678..1671898,1672068..1672151,
FT                   1673218..1673364,1675866..1675996,1677747..1677940,
FT                   1680054..1680161))
FT                   /gene="Prpf3"
FT                   /locus_tag="mCG_16743"
FT                   /product="PRP3 pre-mRNA processing factor 3 homolog
FT                   (yeast)"
FT                   /note="gene_id=mCG16743.1 transcript_id=mCT12024.1 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1655184..1655332,1658056..1658139,
FT                   1658387..1658505,1659657..1659770,1659947..1660046,
FT                   1660718..1660861,1664973..1665052,1668489..1668655,
FT                   1669228..1669534,1671678..1671898,1672068..1672151,
FT                   1673218..1673364,1675866..1675996,1677747..1677891))
FT                   /codon_start=1
FT                   /gene="Prpf3"
FT                   /locus_tag="mCG_16743"
FT                   /product="PRP3 pre-mRNA processing factor 3 homolog
FT                   (yeast)"
FT                   /note="gene_id=mCG16743.1 transcript_id=mCT12024.1
FT                   protein_id=mCP13706.2"
FT                   /protein_id="EDL38841.1"
FT   assembly_gap    1656221..1657548
FT                   /estimated_length=1328
FT                   /gap_type="unknown"
FT   gene            complement(1686950..1695834)
FT                   /locus_tag="mCG_16762"
FT                   /note="gene_id=mCG16762.2"
FT   mRNA            complement(join(1686950..1687237,1694829..1694977,
FT                   1695657..1695705))
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, transcript variant mCT12407"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT12407.1 created
FT                   on 23-JUN-2003"
FT   mRNA            complement(join(1686959..1687237,1694829..1694950,
FT                   1695788..1695827))
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, transcript variant mCT169952"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT169952.0 created
FT                   on 23-JUN-2003"
FT   mRNA            complement(join(1686960..1687237,1694829..1694977,
FT                   1695788..1695834))
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, transcript variant mCT169954"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT169954.0 created
FT                   on 23-JUN-2003"
FT   CDS             complement(join(1687057..1687237,1694829..1694911))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, isoform CRA_a"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT12407.1
FT                   protein_id=mCP13666.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q059G7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="MGI:MGI:1913542"
FT                   /db_xref="UniProtKB/TrEMBL:Q059G7"
FT                   /protein_id="EDL38842.1"
FT   CDS             complement(join(1687057..1687237,1694829..1694911))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, isoform CRA_a"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT169952.0
FT                   protein_id=mCP92871.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q059G7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="MGI:MGI:1913542"
FT                   /db_xref="UniProtKB/TrEMBL:Q059G7"
FT                   /protein_id="EDL38843.1"
FT   CDS             complement(join(1687057..1687237,1694829..1694911))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16762"
FT                   /product="mCG16762, isoform CRA_a"
FT                   /note="gene_id=mCG16762.2 transcript_id=mCT169954.0
FT                   protein_id=mCP92886.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q059G7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="MGI:MGI:1913542"
FT                   /db_xref="UniProtKB/TrEMBL:Q059G7"
FT                   /protein_id="EDL38844.1"
FT   assembly_gap    1688248..1688267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1695780..1713424
FT                   /locus_tag="mCG_122523"
FT                   /note="gene_id=mCG122523.1"
FT   mRNA            join(1695780..1696020,1711126..1711278,1711448..1711831,
FT                   1712400..1713424)
FT                   /locus_tag="mCG_122523"
FT                   /product="mCG122523, transcript variant mCT123745"
FT                   /note="gene_id=mCG122523.1 transcript_id=mCT123745.1
FT                   created on 11-JUN-2003"
FT   mRNA            join(1695866..1696020,1699028..1699222)
FT                   /locus_tag="mCG_122523"
FT                   /product="mCG122523, transcript variant mCT169552"
FT                   /note="gene_id=mCG122523.1 transcript_id=mCT169552.0
FT                   created on 11-JUN-2003"
FT   CDS             join(1695987..1696020,1711126..1711139)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122523"
FT                   /product="mCG122523, isoform CRA_a"
FT                   /note="gene_id=mCG122523.1 transcript_id=mCT123745.1
FT                   protein_id=mCP78202.1 isoform=CRA_a"
FT                   /protein_id="EDL38845.1"
FT                   /translation="MEESRSSGLREGGRV"
FT   CDS             join(1695987..1696020,1699028..1699062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122523"
FT                   /product="mCG122523, isoform CRA_b"
FT                   /note="gene_id=mCG122523.1 transcript_id=mCT169552.0
FT                   protein_id=mCP92865.0 isoform=CRA_b"
FT                   /protein_id="EDL38846.1"
FT                   /translation="MEESRSSGLREGSRLVWKKMCS"
FT   gene            complement(1702838..1706587)
FT                   /locus_tag="mCG_16740"
FT                   /note="gene_id=mCG16740.2"
FT   mRNA            complement(join(1702838..1703485,1704745..1704856,
FT                   1704971..1705049,1705319..1705394,1705517..1705925,
FT                   1706491..1706586))
FT                   /locus_tag="mCG_16740"
FT                   /product="mCG16740, transcript variant mCT12021"
FT                   /note="gene_id=mCG16740.2 transcript_id=mCT12021.1 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1702839..1703485,1704745..1704856,
FT                   1704971..1705049,1705319..1705394,1706491..1706587))
FT                   /locus_tag="mCG_16740"
FT                   /product="mCG16740, transcript variant mCT169797"
FT                   /note="gene_id=mCG16740.2 transcript_id=mCT169797.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1702970..1703485,1704745..1704856,
FT                   1704971..1705049,1705319..1705394,1705517..1705861))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16740"
FT                   /product="mCG16740, isoform CRA_a"
FT                   /note="gene_id=mCG16740.2 transcript_id=mCT12021.1
FT                   protein_id=mCP13664.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2RTE4"
FT                   /db_xref="InterPro:IPR031373"
FT                   /db_xref="MGI:MGI:2684975"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTE4"
FT                   /protein_id="EDL38847.1"
FT   CDS             complement(join(1702970..1703485,1704745..1704856,
FT                   1704971..1705049,1705319..1705337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16740"
FT                   /product="mCG16740, isoform CRA_b"
FT                   /note="gene_id=mCG16740.2 transcript_id=mCT169797.0
FT                   protein_id=mCP92856.0 isoform=CRA_b"
FT                   /protein_id="EDL38848.1"
FT   gene            complement(1708309..1716301)
FT                   /gene="BC028528"
FT                   /locus_tag="mCG_16735"
FT                   /note="gene_id=mCG16735.2"
FT   mRNA            complement(join(1708309..1708571,1709305..1709403,
FT                   1712472..1712627,1713188..1713246,1714054..1714140,
FT                   1716216..1716301))
FT                   /gene="BC028528"
FT                   /locus_tag="mCG_16735"
FT                   /product="cDNA sequence BC028528, transcript variant
FT                   mCT12016"
FT                   /note="gene_id=mCG16735.2 transcript_id=mCT12016.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1709308..1709403,1712472..1712627,
FT                   1713188..1713246,1714054..1714140,1716216..1716261))
FT                   /codon_start=1
FT                   /gene="BC028528"
FT                   /locus_tag="mCG_16735"
FT                   /product="cDNA sequence BC028528, isoform CRA_a"
FT                   /note="gene_id=mCG16735.2 transcript_id=mCT12016.2
FT                   protein_id=mCP13716.2 isoform=CRA_a"
FT                   /protein_id="EDL38849.1"
FT   mRNA            complement(join(1712817..1713246,1714054..1714140,
FT                   1716216..1716292))
FT                   /gene="BC028528"
FT                   /locus_tag="mCG_16735"
FT                   /product="cDNA sequence BC028528, transcript variant
FT                   mCT169794"
FT                   /note="gene_id=mCG16735.2 transcript_id=mCT169794.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1713131..1713246,1714054..1714140,
FT                   1716216..1716261))
FT                   /codon_start=1
FT                   /gene="BC028528"
FT                   /locus_tag="mCG_16735"
FT                   /product="cDNA sequence BC028528, isoform CRA_b"
FT                   /note="gene_id=mCG16735.2 transcript_id=mCT169794.0
FT                   protein_id=mCP92895.0 isoform=CRA_b"
FT                   /protein_id="EDL38850.1"
FT   assembly_gap    1717257..1717334
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            1718297..1722946
FT                   /locus_tag="mCG_16760"
FT                   /note="gene_id=mCG16760.1"
FT   mRNA            join(1718297..1718645,1719183..1719353,1719505..1719578,
FT                   1719809..1719931,1720079..1720206,1720598..1720721,
FT                   1721055..1722946)
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, transcript variant mCT12406"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT12406.1 created
FT                   on 10-JUN-2003"
FT   mRNA            join(1718342..1718645,1719183..1719353,1719505..1719578,
FT                   1719809..1719931,1720079..1720206,1720598..1722168)
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, transcript variant mCT169804"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT169804.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(1718533..1718645,1719183..1719353,1719505..1719578,
FT                   1719809..1719931,1720079..1720206,1720598..1720721,
FT                   1721055..1721119)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, isoform CRA_a"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT12406.1
FT                   protein_id=mCP13703.1 isoform=CRA_a"
FT                   /protein_id="EDL38851.1"
FT   CDS             join(1718533..1718645,1719183..1719353,1719505..1719578,
FT                   1719809..1719931,1720079..1720206,1720598..1720732)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, isoform CRA_c"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT169804.0
FT                   protein_id=mCP92851.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6GTF1"
FT                   /db_xref="InterPro:IPR009294"
FT                   /db_xref="MGI:MGI:2385110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GTF1"
FT                   /protein_id="EDL38853.1"
FT   mRNA            join(1718827..1719353,1719505..1719931,1720079..1720206,
FT                   1720598..1722193)
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, transcript variant mCT185227"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT185227.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(1719760..1719931,1720079..1720206,1720598..1720732)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16760"
FT                   /product="mCG16760, isoform CRA_b"
FT                   /note="gene_id=mCG16760.1 transcript_id=mCT185227.0
FT                   protein_id=mCP106485.0 isoform=CRA_b"
FT                   /protein_id="EDL38852.1"
FT   gene            complement(1722161..1729071)
FT                   /gene="Car14"
FT                   /locus_tag="mCG_16730"
FT                   /note="gene_id=mCG16730.2"
FT   mRNA            complement(join(1722161..1722573,1723162..1723246,
FT                   1723338..1723358,1723585..1723705,1723792..1723949,
FT                   1724101..1724167,1724292..1724387,1724604..1724746,
FT                   1725453..1725632,1726471..1726491,1728707..1729026))
FT                   /gene="Car14"
FT                   /locus_tag="mCG_16730"
FT                   /product="carbonic anhydrase 14, transcript variant
FT                   mCT12011"
FT                   /note="gene_id=mCG16730.2 transcript_id=mCT12011.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1722507..1722573,1723162..1723246,
FT                   1723338..1723358,1723585..1723705,1723792..1723949,
FT                   1724101..1724167,1724292..1724387,1724604..1724746,
FT                   1725453..1725632,1726471..1726491,1728707..1728761))
FT                   /codon_start=1
FT                   /gene="Car14"
FT                   /locus_tag="mCG_16730"
FT                   /product="carbonic anhydrase 14, isoform CRA_a"
FT                   /note="gene_id=mCG16730.2 transcript_id=mCT12011.0
FT                   protein_id=mCP13691.1 isoform=CRA_a"
FT                   /protein_id="EDL38854.1"
FT   mRNA            complement(join(1726263..1726491,1728707..1729071))
FT                   /gene="Car14"
FT                   /locus_tag="mCG_16730"
FT                   /product="carbonic anhydrase 14, transcript variant
FT                   mCT169564"
FT                   /note="gene_id=mCG16730.2 transcript_id=mCT169564.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1726301..1726491,1728707..1728761))
FT                   /codon_start=1
FT                   /gene="Car14"
FT                   /locus_tag="mCG_16730"
FT                   /product="carbonic anhydrase 14, isoform CRA_b"
FT                   /note="gene_id=mCG16730.2 transcript_id=mCT169564.0
FT                   protein_id=mCP92861.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1344341"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CEY0"
FT                   /protein_id="EDL38855.1"
FT   assembly_gap    1727253..1727272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1728508..1728574
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    1735851..1737094
FT                   /estimated_length=1244
FT                   /gap_type="unknown"
FT   assembly_gap    1738869..1738888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1740273..1740870
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   assembly_gap    1742802..1743020
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   gene            <1754192..1772302
FT                   /gene="Anp32e"
FT                   /locus_tag="mCG_16759"
FT                   /note="gene_id=mCG16759.3"
FT   mRNA            join(<1754192..1754566,1758828..1758977,1759695..1759817,
FT                   1761942..1762113,1762800..1762921,1769225..1769279,
FT                   1770098..1770483)
FT                   /gene="Anp32e"
FT                   /locus_tag="mCG_16759"
FT                   /product="acidic (leucine-rich) nuclear phosphoprotein 32
FT                   family, member E, transcript variant mCT193726"
FT                   /note="gene_id=mCG16759.3 transcript_id=mCT193726.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1754195..1754566,1758828..1758977,1759695..1759817,
FT                   1761942..1762113,1762800..1762957,1769225..1769279,
FT                   1770098..1772302)
FT                   /gene="Anp32e"
FT                   /locus_tag="mCG_16759"
FT                   /product="acidic (leucine-rich) nuclear phosphoprotein 32
FT                   family, member E, transcript variant mCT12405"
FT                   /note="gene_id=mCG16759.3 transcript_id=mCT12405.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(<1754480..1754566,1758828..1758977,1759695..1759817,
FT                   1761942..1762113,1762800..1762921,1769225..1769279,
FT                   1770098..1770168)
FT                   /codon_start=1
FT                   /gene="Anp32e"
FT                   /locus_tag="mCG_16759"
FT                   /product="acidic (leucine-rich) nuclear phosphoprotein 32
FT                   family, member E, isoform CRA_b"
FT                   /note="gene_id=mCG16759.3 transcript_id=mCT193726.0
FT                   protein_id=mCP114716.0 isoform=CRA_b"
FT                   /protein_id="EDL38857.1"
FT   CDS             join(1754513..1754566,1758828..1758977,1759695..1759817,
FT                   1761942..1762113,1762800..1762957,1769225..1769279,
FT                   1770098..1770168)
FT                   /codon_start=1
FT                   /gene="Anp32e"
FT                   /locus_tag="mCG_16759"
FT                   /product="acidic (leucine-rich) nuclear phosphoprotein 32
FT                   family, member E, isoform CRA_a"
FT                   /note="gene_id=mCG16759.3 transcript_id=mCT12405.1
FT                   protein_id=mCP13714.1 isoform=CRA_a"
FT                   /protein_id="EDL38856.1"
FT   assembly_gap    1760691..1760710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1782038..1782057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1788865..1789284)
FT                   /pseudo
FT                   /locus_tag="mCG_52921"
FT                   /note="gene_id=mCG52921.2"
FT   mRNA            complement(1788865..1789284)
FT                   /pseudo
FT                   /locus_tag="mCG_52921"
FT                   /note="gene_id=mCG52921.2 transcript_id=mCT53104.1 created
FT                   on 29-MAY-2002"
FT   gene            1807525..1808414
FT                   /pseudo
FT                   /locus_tag="mCG_16758"
FT                   /note="gene_id=mCG16758.3"
FT   mRNA            1807525..1808414
FT                   /pseudo
FT                   /locus_tag="mCG_16758"
FT                   /note="gene_id=mCG16758.3 transcript_id=mCT12981.3 created
FT                   on 24-NOV-2004"
FT   gene            1810214..1811668
FT                   /locus_tag="mCG_1041513"
FT                   /note="gene_id=mCG1041513.0"
FT   mRNA            join(1810214..1810292,1810708..1810784,1811121..1811668)
FT                   /locus_tag="mCG_1041513"
FT                   /product="mCG1041513"
FT                   /note="gene_id=mCG1041513.0 transcript_id=mCT159217.0
FT                   created on 29-MAY-2002"
FT   CDS             join(1810286..1810292,1810708..1810784,1811121..1811297)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041513"
FT                   /product="mCG1041513"
FT                   /note="gene_id=mCG1041513.0 transcript_id=mCT159217.0
FT                   protein_id=mCP78188.1"
FT                   /protein_id="EDL38858.1"
FT   gene            complement(1813540..1820858)
FT                   /gene="Plekho1"
FT                   /locus_tag="mCG_16757"
FT                   /note="gene_id=mCG16757.2"
FT   mRNA            complement(join(1813540..1814331,1815491..1815592,
FT                   1816134..1816238,1816828..1816968,1820341..1820487,
FT                   1820590..1820712,1820831..1820858))
FT                   /gene="Plekho1"
FT                   /locus_tag="mCG_16757"
FT                   /product="pleckstrin homology domain containing, family O
FT                   member 1"
FT                   /note="gene_id=mCG16757.2 transcript_id=mCT12497.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1813627..1814331,1815491..1815592,
FT                   1816134..1816238,1816828..1816968,1820341..1820487,
FT                   1820590..1820616))
FT                   /codon_start=1
FT                   /gene="Plekho1"
FT                   /locus_tag="mCG_16757"
FT                   /product="pleckstrin homology domain containing, family O
FT                   member 1"
FT                   /note="gene_id=mCG16757.2 transcript_id=mCT12497.2
FT                   protein_id=mCP13710.1"
FT                   /protein_id="EDL38859.1"
FT                   HSQYRKSLM"
FT   assembly_gap    1817952..1817971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1820713..1820830
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            complement(1820969..1821875)
FT                   /locus_tag="mCG_1041514"
FT                   /note="gene_id=mCG1041514.0"
FT   mRNA            complement(join(1820969..1821798,1821832..1821875))
FT                   /locus_tag="mCG_1041514"
FT                   /product="mCG1041514"
FT                   /note="gene_id=mCG1041514.0 transcript_id=mCT159218.0
FT                   created on 29-MAY-2002"
FT   CDS             complement(1821353..1821505)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041514"
FT                   /product="mCG1041514"
FT                   /note="gene_id=mCG1041514.0 transcript_id=mCT159218.0
FT                   protein_id=mCP78192.1"
FT                   /protein_id="EDL38860.1"
FT                   VSGKK"
FT   gene            complement(1824708..1884749)
FT                   /gene="Vps45"
FT                   /locus_tag="mCG_16753"
FT                   /note="gene_id=mCG16753.2"
FT   mRNA            complement(join(1824708..1825023,1844452..1844583,
FT                   1855883..1856004,1857656..1857763,1858541..1858699,
FT                   1866217..1866384,1867168..1867281,1867653..1867787,
FT                   1872640..1872750,1873286..1873423,1873535..1873603,
FT                   1874596..1874675,1879327..1879387,1883263..1883397,
FT                   1883965..1884749))
FT                   /gene="Vps45"
FT                   /locus_tag="mCG_16753"
FT                   /product="vacuolar protein sorting 45 (yeast)"
FT                   /note="gene_id=mCG16753.2 transcript_id=mCT12962.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1824936..1825023,1844452..1844583,
FT                   1855883..1856004,1857656..1857763,1858541..1858699,
FT                   1866217..1866384,1867168..1867281,1867653..1867787,
FT                   1872640..1872750,1873286..1873423,1873535..1873603,
FT                   1874596..1874675,1879327..1879387,1883263..1883397,
FT                   1883965..1884057))
FT                   /codon_start=1
FT                   /gene="Vps45"
FT                   /locus_tag="mCG_16753"
FT                   /product="vacuolar protein sorting 45 (yeast)"
FT                   /note="gene_id=mCG16753.2 transcript_id=mCT12962.2
FT                   protein_id=mCP13693.1"
FT                   /protein_id="EDL38861.1"
FT   assembly_gap    1842054..1842073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1844100..1844119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1919647..1919666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1931269..1985871
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /note="gene_id=mCG122520.2"
FT   mRNA            join(<1931269..1931563,1935455..1935512,1963448..1963598,
FT                   1967374..1967562,1968445..1968672,1971198..1971299,
FT                   1971925..1972052,1977807..1977919,1978283..1978410,
FT                   1978840..1978989,1979458..1979572,1980365..1980449,
FT                   1981726..>1982044)
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, transcript variant
FT                   mCT193725"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT193725.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(1931271..1931563,1963448..1963598,1967374..1967562,
FT                   1968445..1968672,1971198..1971299,1971925..1972052,
FT                   1977807..1977919,1978283..1978410,1978840..1978989,
FT                   1979458..1979572,1980365..1980449,1981726..1985871)
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, transcript variant
FT                   mCT123742"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT123742.1
FT                   created on 29-MAY-2002"
FT   CDS             join(<1931502..1931563,1935455..1935512,1963448..1963598,
FT                   1967374..1967562,1968445..1968672,1971198..1971299,
FT                   1971925..1972052,1977807..1977919,1978283..1978410,
FT                   1978840..1978989,1979458..1979572,1980365..1980449,
FT                   1981726..>1982044)
FT                   /codon_start=1
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, isoform CRA_c"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT193725.0
FT                   protein_id=mCP114683.0 isoform=CRA_c"
FT                   /protein_id="EDL38864.1"
FT   mRNA            join(<1932036..1932067,1933831..1933954,1935455..1935512,
FT                   1957206..1957322,1963453..1963598,1967374..1967562,
FT                   1968445..1968672,1971198..1971299,1971925..1972052,
FT                   1977807..1977919,1978283..1978410,1978840..1978989,
FT                   1979458..1979572,1980365..1980449,1981726..>1982047)
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, transcript variant
FT                   mCT193724"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT193724.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1957285..1957322,1963453..1963598,1967374..1967562,
FT                   1968445..1968672,1971198..1971299,1971925..1972052,
FT                   1977807..1977919,1978283..1978410,1978840..1978989,
FT                   1979458..1979572,1980365..1980449,1981726..>1982047)
FT                   /codon_start=1
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, isoform CRA_b"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT193724.0
FT                   protein_id=mCP114682.0 isoform=CRA_b"
FT                   /protein_id="EDL38863.1"
FT                   GTETL"
FT   CDS             join(1963514..1963598,1967374..1967562,1968445..1968672,
FT                   1971198..1971299,1971925..1972052,1977807..1977919,
FT                   1978283..1978410,1978840..1978989,1979458..1979572,
FT                   1980365..1980449,1981726..1982925)
FT                   /codon_start=1
FT                   /gene="Otud7b"
FT                   /locus_tag="mCG_122520"
FT                   /product="OTU domain containing 7B, isoform CRA_a"
FT                   /note="gene_id=mCG122520.2 transcript_id=mCT123742.1
FT                   protein_id=mCP78186.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RUR8"
FT                   /db_xref="InterPro:IPR002653"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="MGI:MGI:2654703"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RUR8"
FT                   /protein_id="EDL38862.1"
FT   assembly_gap    1965591..1965610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1986823..1988081
FT                   /locus_tag="mCG_1041489"
FT                   /note="gene_id=mCG1041489.1"
FT   mRNA            1986823..1988081
FT                   /locus_tag="mCG_1041489"
FT                   /product="mCG1041489"
FT                   /note="gene_id=mCG1041489.1 transcript_id=mCT159193.1
FT                   created on 29-MAY-2002"
FT   CDS             1987703..1987834
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041489"
FT                   /product="mCG1041489"
FT                   /note="gene_id=mCG1041489.1 transcript_id=mCT159193.1
FT                   protein_id=mCP78240.1"
FT                   /protein_id="EDL38865.1"
FT   gene            1988970..>1991844
FT                   /locus_tag="mCG_16761"
FT                   /note="gene_id=mCG16761.3"
FT   mRNA            join(1988970..1989216,1989585..1989675,1990048..1990169,
FT                   1990424..1990484,1990624..1990766,1991204..1991282,
FT                   1991389..1991524,1991742..>1991844)
FT                   /locus_tag="mCG_16761"
FT                   /product="mCG16761, transcript variant mCT12982"
FT                   /note="gene_id=mCG16761.3 transcript_id=mCT12982.2 created
FT                   on 19-JUN-2003"
FT   CDS             join(1989151..1989216,1989585..1989675,1990048..1990169,
FT                   1990424..1990484,1990624..1990766,1991204..1991282,
FT                   1991389..1991524,1991742..>1991844)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16761"
FT                   /product="mCG16761, isoform CRA_a"
FT                   /note="gene_id=mCG16761.3 transcript_id=mCT12982.2
FT                   protein_id=mCP13719.2 isoform=CRA_a"
FT                   /protein_id="EDL38866.1"
FT   mRNA            join(<1989456..1989675,1990048..1990169,1990424..1990484,
FT                   1990624..1990766,1991204..1991282,1991389..1991524,
FT                   1991742..>1991836)
FT                   /locus_tag="mCG_16761"
FT                   /product="mCG16761, transcript variant mCT193717"
FT                   /note="gene_id=mCG16761.3 transcript_id=mCT193717.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1989456..1989675,1990048..1990169,1990424..1990484,
FT                   1990624..1990766,1991204..1991282,1991389..1991524,
FT                   1991742..>1991836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16761"
FT                   /product="mCG16761, isoform CRA_b"
FT                   /note="gene_id=mCG16761.3 transcript_id=mCT193717.0
FT                   protein_id=mCP114717.0 isoform=CRA_b"
FT                   /protein_id="EDL38867.1"
FT                   GPVS"
FT   gene            <1995674..1998671
FT                   /locus_tag="mCG_145595"
FT                   /note="gene_id=mCG145595.0"
FT   mRNA            join(<1995674..1995721,1995992..1996165,1996763..1996945,
FT                   1997309..1997602,1998042..1998671)
FT                   /locus_tag="mCG_145595"
FT                   /product="mCG145595"
FT                   /note="gene_id=mCG145595.0 transcript_id=mCT185019.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1995674..1995721,1995992..1996165,1996763..1996945,
FT                   1997309..1997602,1998042..1998188)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145595"
FT                   /product="mCG145595"
FT                   /note="gene_id=mCG145595.0 transcript_id=mCT185019.0
FT                   protein_id=mCP106330.0"
FT                   /protein_id="EDL38868.1"
FT                   "
FT   gene            1999490..2004185
FT                   /gene="Sf3b4"
FT                   /locus_tag="mCG_16747"
FT                   /note="gene_id=mCG16747.2"
FT   mRNA            join(1999490..1999563,1999927..2000055,2000497..2001039,
FT                   2001279..2001485,2003594..2003767,2003938..2004185)
FT                   /gene="Sf3b4"
FT                   /locus_tag="mCG_16747"
FT                   /product="splicing factor 3b, subunit 4"
FT                   /note="gene_id=mCG16747.2 transcript_id=mCT127771.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1999530..1999563,1999927..2000055,2000497..2001039,
FT                   2001279..2001485,2003594..2003767,2003938..2004125)
FT                   /codon_start=1
FT                   /gene="Sf3b4"
FT                   /locus_tag="mCG_16747"
FT                   /product="splicing factor 3b, subunit 4"
FT                   /note="gene_id=mCG16747.2 transcript_id=mCT127771.1
FT                   protein_id=mCP78165.1"
FT                   /protein_id="EDL38869.1"
FT   assembly_gap    2004186..2004635
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    2007875..2008522
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   gene            2011461..2021989
FT                   /gene="Sv2a"
FT                   /locus_tag="mCG_140498"
FT                   /note="gene_id=mCG140498.0"
FT   mRNA            join(2011461..2012433,2013789..2013969,2014915..2015066,
FT                   2015144..2015277,2015874..2015963,2016179..2016289,
FT                   2016463..2016551,2017095..2017259,2017439..2017572,
FT                   2019226..2019432,2020000..2020159,2020544..2021989)
FT                   /gene="Sv2a"
FT                   /locus_tag="mCG_140498"
FT                   /product="synaptic vesicle glycoprotein 2 a"
FT                   /note="gene_id=mCG140498.0 transcript_id=mCT12493.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(2011812..2012433,2013789..2013969,2014915..2015066,
FT                   2015144..2015277,2015874..2015963,2016179..2016289,
FT                   2016463..2016551,2017095..2017259,2017439..2017572,
FT                   2019226..2019432,2020000..2020159,2020544..2020727)
FT                   /codon_start=1
FT                   /gene="Sv2a"
FT                   /locus_tag="mCG_140498"
FT                   /product="synaptic vesicle glycoprotein 2 a"
FT                   /note="gene_id=mCG140498.0 transcript_id=mCT12493.1
FT                   protein_id=mCP13669.0"
FT                   /protein_id="EDL38870.1"
FT   gene            complement(2023051..2027298)
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /note="gene_id=mCG16738.2"
FT   mRNA            complement(join(2023051..2024089,2027200..2027298))
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), transcript variant
FT                   mCT169796"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT169796.0 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(2023051..2024089,2024360..2024547,
FT                   2027200..2027297))
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), transcript variant
FT                   mCT12019"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT12019.1 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(2023051..2024089,2024360..2024547,
FT                   2024971..2025036,2025247..2025299))
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), transcript variant
FT                   mCT169795"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT169795.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(2023673..2024086)
FT                   /codon_start=1
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), isoform CRA_a"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT12019.1
FT                   protein_id=mCP13717.1 isoform=CRA_a"
FT                   /protein_id="EDL38871.1"
FT   CDS             complement(2023673..2024086)
FT                   /codon_start=1
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), isoform CRA_a"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT169795.0
FT                   protein_id=mCP92868.0 isoform=CRA_a"
FT                   /protein_id="EDL38872.1"
FT   CDS             complement(2023673..2024086)
FT                   /codon_start=1
FT                   /gene="Bola1"
FT                   /locus_tag="mCG_16738"
FT                   /product="bolA-like 1 (E. coli), isoform CRA_a"
FT                   /note="gene_id=mCG16738.2 transcript_id=mCT169796.0
FT                   protein_id=mCP92866.0 isoform=CRA_a"
FT                   /protein_id="EDL38873.1"
FT   assembly_gap    2026764..2026783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2040826..>2041218
FT                   /locus_tag="mCG_48962"
FT                   /note="gene_id=mCG48962.0"
FT   mRNA            <2040826..>2041218
FT                   /locus_tag="mCG_48962"
FT                   /product="mCG48962"
FT                   /note="gene_id=mCG48962.0 transcript_id=mCT49145.0 created
FT                   on 29-MAY-2002"
FT   CDS             2040826..2041218
FT                   /codon_start=1
FT                   /locus_tag="mCG_48962"
FT                   /product="mCG48962"
FT                   /note="gene_id=mCG48962.0 transcript_id=mCT49145.0
FT                   protein_id=mCP34914.0"
FT                   /protein_id="EDL38874.1"
FT   gene            complement(<2041365..>2041754)
FT                   /locus_tag="mCG_50606"
FT                   /note="gene_id=mCG50606.0"
FT   mRNA            complement(<2041365..>2041754)
FT                   /locus_tag="mCG_50606"
FT                   /product="mCG50606"
FT                   /note="gene_id=mCG50606.0 transcript_id=mCT50789.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(2041365..2041754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50606"
FT                   /product="mCG50606"
FT                   /note="gene_id=mCG50606.0 transcript_id=mCT50789.1
FT                   protein_id=mCP34918.0"
FT                   /db_xref="GOA:Q149V4"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="MGI:MGI:2448316"
FT                   /db_xref="UniProtKB/TrEMBL:Q149V4"
FT                   /protein_id="EDL38875.1"
FT   gene            complement(2044104..2044654)
FT                   /gene="Hist2h2be"
FT                   /locus_tag="mCG_1041515"
FT                   /note="gene_id=mCG1041515.1"
FT   mRNA            complement(2044104..2044654)
FT                   /gene="Hist2h2be"
FT                   /locus_tag="mCG_1041515"
FT                   /product="histone 2, H2be"
FT                   /note="gene_id=mCG1041515.1 transcript_id=mCT159219.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(2044253..2044564)
FT                   /codon_start=1
FT                   /gene="Hist2h2be"
FT                   /locus_tag="mCG_1041515"
FT                   /product="histone 2, H2be"
FT                   /note="gene_id=mCG1041515.1 transcript_id=mCT159219.1
FT                   protein_id=mCP78193.1"
FT                   /protein_id="EDL38876.1"
FT   gene            complement(2058960..2059977)
FT                   /locus_tag="mCG_140445"
FT                   /note="gene_id=mCG140445.0"
FT   mRNA            complement(2058960..2059977)
FT                   /locus_tag="mCG_140445"
FT                   /product="mCG140445"
FT                   /note="gene_id=mCG140445.0 transcript_id=mCT169554.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(2059381..2059926)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140445"
FT                   /product="mCG140445"
FT                   /note="gene_id=mCG140445.0 transcript_id=mCT169554.0
FT                   protein_id=mCP92879.0"
FT                   /db_xref="GOA:A0A1W2P768"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:2448355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1W2P768"
FT                   /protein_id="EDL38877.1"
FT                   TIMPKDIQLARRIRGERA"
FT   gene            complement(2060237..2061777)
FT                   /locus_tag="mCG_140446"
FT                   /note="gene_id=mCG140446.0"
FT   mRNA            complement(2060237..2061777)
FT                   /locus_tag="mCG_140446"
FT                   /product="mCG140446"
FT                   /note="gene_id=mCG140446.0 transcript_id=mCT169553.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(2060708..2061100)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140446"
FT                   /product="mCG140446"
FT                   /note="gene_id=mCG140446.0 transcript_id=mCT169553.0
FT                   protein_id=mCP92880.0"
FT                   /db_xref="GOA:B2RWH3"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWH3"
FT                   /protein_id="EDL38878.1"
FT   assembly_gap    2066587..2066911
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   gene            2067024..2067860
FT                   /locus_tag="mCG_126480"
FT                   /note="gene_id=mCG126480.1"
FT   mRNA            2067024..2067860
FT                   /locus_tag="mCG_126480"
FT                   /product="mCG126480"
FT                   /note="gene_id=mCG126480.1 transcript_id=mCT127748.1
FT                   created on 30-MAY-2002"
FT   CDS             2067224..2067634
FT                   /codon_start=1
FT                   /locus_tag="mCG_126480"
FT                   /product="mCG126480"
FT                   /note="gene_id=mCG126480.1 transcript_id=mCT127748.1
FT                   protein_id=mCP78206.0"
FT                   /db_xref="GOA:B9EI85"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI85"
FT                   /protein_id="EDL38879.1"
FT   gene            complement(2074960..2113587)
FT                   /locus_tag="mCG_148359"
FT                   /note="gene_id=mCG148359.0"
FT   mRNA            complement(join(2074960..2075772,2113552..2113587))
FT                   /locus_tag="mCG_148359"
FT                   /product="mCG148359"
FT                   /note="gene_id=mCG148359.0 transcript_id=mCT188622.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2075181..2075402)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148359"
FT                   /product="mCG148359"
FT                   /note="gene_id=mCG148359.0 transcript_id=mCT188622.0
FT                   protein_id=mCP109732.0"
FT                   /protein_id="EDL38880.1"
FT   assembly_gap    2075776..2075857
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            complement(2083353..2083699)
FT                   /locus_tag="mCG_49679"
FT                   /note="gene_id=mCG49679.1"
FT   mRNA            complement(2083353..2083699)
FT                   /locus_tag="mCG_49679"
FT                   /product="mCG49679"
FT                   /note="gene_id=mCG49679.1 transcript_id=mCT49862.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(2083376..2083687)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49679"
FT                   /product="mCG49679"
FT                   /note="gene_id=mCG49679.1 transcript_id=mCT49862.1
FT                   protein_id=mCP34923.0"
FT                   /db_xref="GOA:B2RTM0"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTM0"
FT                   /protein_id="EDL38881.1"
FT   gene            complement(2087458..2088151)
FT                   /locus_tag="mCG_140526"
FT                   /note="gene_id=mCG140526.0"
FT   mRNA            complement(2087458..2088151)
FT                   /locus_tag="mCG_140526"
FT                   /product="mCG140526"
FT                   /note="gene_id=mCG140526.0 transcript_id=mCT169931.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(2087878..2088021)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140526"
FT                   /product="mCG140526"
FT                   /note="gene_id=mCG140526.0 transcript_id=mCT169931.0
FT                   protein_id=mCP92903.0"
FT                   /protein_id="EDL38882.1"
FT                   VK"
FT   gene            <2089077..>2089487
FT                   /locus_tag="mCG_16737"
FT                   /note="gene_id=mCG16737.0"
FT   mRNA            <2089077..>2089487
FT                   /locus_tag="mCG_16737"
FT                   /product="mCG16737"
FT                   /note="gene_id=mCG16737.0 transcript_id=mCT12018.0 created
FT                   on 30-MAY-2002"
FT   CDS             2089077..2089487
FT                   /codon_start=1
FT                   /locus_tag="mCG_16737"
FT                   /product="mCG16737"
FT                   /note="gene_id=mCG16737.0 transcript_id=mCT12018.0
FT                   protein_id=mCP13722.0"
FT                   /db_xref="GOA:B9EI85"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B9EI85"
FT                   /protein_id="EDL38883.1"
FT   gene            2090099..2097423
FT                   /locus_tag="mCG_48964"
FT                   /note="gene_id=mCG48964.1"
FT   mRNA            join(2090099..2090619,2095305..2095394,2096888..2097423)
FT                   /locus_tag="mCG_48964"
FT                   /product="mCG48964, transcript variant mCT49147"
FT                   /note="gene_id=mCG48964.1 transcript_id=mCT49147.1 created
FT                   on 30-MAY-2002"
FT   mRNA            join(2090108..2090360,2096888..2097423)
FT                   /locus_tag="mCG_48964"
FT                   /product="mCG48964, transcript variant mCT170004"
FT                   /note="gene_id=mCG48964.1 transcript_id=mCT170004.0 created
FT                   on 30-MAY-2002"
FT   CDS             join(2090135..2090360,2096888..2097024)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48964"
FT                   /product="mCG48964, isoform CRA_a"
FT                   /note="gene_id=mCG48964.1 transcript_id=mCT170004.0
FT                   protein_id=mCP92906.0 isoform=CRA_a"
FT                   /protein_id="EDL38884.1"
FT                   SGCLVLSSGNFALRIY"
FT   CDS             2090135..2090515
FT                   /codon_start=1
FT                   /locus_tag="mCG_48964"
FT                   /product="mCG48964, isoform CRA_b"
FT                   /note="gene_id=mCG48964.1 transcript_id=mCT49147.1
FT                   protein_id=mCP34917.0 isoform=CRA_b"
FT                   /protein_id="EDL38885.1"
FT   assembly_gap    2091560..2091579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2092933..2092952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2103346..2113097)
FT                   /gene="Fcgr1"
FT                   /locus_tag="mCG_16734"
FT                   /note="gene_id=mCG16734.2"
FT   mRNA            complement(join(2103346..2103748,2104939..2105223,
FT                   2106114..2106362,2111383..2111640,2112649..2112669,
FT                   2113035..2113097))
FT                   /gene="Fcgr1"
FT                   /locus_tag="mCG_16734"
FT                   /product="Fc receptor, IgG, high affinity I"
FT                   /note="gene_id=mCG16734.2 transcript_id=mCT12015.2 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(2103405..2103748,2104939..2105223,
FT                   2106114..2106362,2111383..2111640,2112649..2112669,
FT                   2113035..2113092))
FT                   /codon_start=1
FT                   /gene="Fcgr1"
FT                   /locus_tag="mCG_16734"
FT                   /product="Fc receptor, IgG, high affinity I"
FT                   /note="gene_id=mCG16734.2 transcript_id=mCT12015.2
FT                   protein_id=mCP13720.1"
FT                   /protein_id="EDL38886.1"
FT                   QTSQS"
FT   assembly_gap    2133518..2195742
FT                   /estimated_length=62225
FT                   /gap_type="unknown"
FT   assembly_gap    2197013..2197064
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    2213367..2213386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2214993..2215087
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    2216150..2216581
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   gene            complement(2216835..2217511)
FT                   /pseudo
FT                   /locus_tag="mCG_140523"
FT                   /note="gene_id=mCG140523.0"
FT   mRNA            complement(2216835..2217511)
FT                   /pseudo
FT                   /locus_tag="mCG_140523"
FT                   /note="gene_id=mCG140523.0 transcript_id=mCT169923.0
FT                   created on 30-MAY-2002"
FT   gene            complement(2220415..>2223287)
FT                   /locus_tag="mCG_140524"
FT                   /note="gene_id=mCG140524.1"
FT   mRNA            complement(2220415..>2223287)
FT                   /locus_tag="mCG_140524"
FT                   /product="mCG140524"
FT                   /note="gene_id=mCG140524.1 transcript_id=mCT169924.2
FT                   created on 28-JUL-2004"
FT   CDS             complement(2222844..>2223263)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140524"
FT                   /product="mCG140524"
FT                   /note="gene_id=mCG140524.1 transcript_id=mCT169924.2
FT                   protein_id=mCP92852.2"
FT                   /protein_id="EDL38887.1"
FT   assembly_gap    2233297..2233611
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   gene            complement(2242381..2257826)
FT                   /gene="BC107364"
FT                   /locus_tag="mCG_148358"
FT                   /note="gene_id=mCG148358.0"
FT   mRNA            complement(join(2242381..2243210,2247519..2247619,
FT                   2247721..2247907,2249498..2249651,2252439..2252563,
FT                   2257582..2257826))
FT                   /gene="BC107364"
FT                   /locus_tag="mCG_148358"
FT                   /product="cDNA sequence BC107364"
FT                   /note="gene_id=mCG148358.0 transcript_id=mCT188621.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(2247889..2247907,2249498..2249651,
FT                   2252439..2252547))
FT                   /codon_start=1
FT                   /gene="BC107364"
FT                   /locus_tag="mCG_148358"
FT                   /product="cDNA sequence BC107364"
FT                   /note="gene_id=mCG148358.0 transcript_id=mCT188621.0
FT                   protein_id=mCP109731.0"
FT                   /protein_id="EDL38888.1"
FT   assembly_gap    2252012..2252031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2254036..2254577
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   gene            2260094..2261323
FT                   /pseudo
FT                   /locus_tag="mCG_14862"
FT                   /note="gene_id=mCG14862.1"
FT   mRNA            2260094..2261323
FT                   /pseudo
FT                   /locus_tag="mCG_14862"
FT                   /note="gene_id=mCG14862.1 transcript_id=mCT20863.1 created
FT                   on 30-MAY-2002"
FT   assembly_gap    2262210..2266658
FT                   /estimated_length=4449
FT                   /gap_type="unknown"
FT   assembly_gap    2267878..2268945
FT                   /estimated_length=1068
FT                   /gap_type="unknown"
FT   assembly_gap    2282092..2282111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2293118..2295654
FT                   /estimated_length=2537
FT                   /gap_type="unknown"
FT   assembly_gap    2296890..2296909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2297919..2297938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2299133..2299152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2308462..2308604
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            complement(2311916..2313578)
FT                   /locus_tag="mCG_1041490"
FT                   /note="gene_id=mCG1041490.1"
FT   mRNA            complement(2311916..2313578)
FT                   /locus_tag="mCG_1041490"
FT                   /product="mCG1041490"
FT                   /note="gene_id=mCG1041490.1 transcript_id=mCT159194.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(2312056..2313357)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041490"
FT                   /product="mCG1041490"
FT                   /note="gene_id=mCG1041490.1 transcript_id=mCT159194.1
FT                   protein_id=mCP78244.1"
FT                   /protein_id="EDL38889.1"
FT   assembly_gap    2314520..2314539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2322952..2326933
FT                   /gene="Hfe2"
FT                   /locus_tag="mCG_14860"
FT                   /note="gene_id=mCG14860.1"
FT   mRNA            join(<2322952..2323101,2324200..2324373,2324759..2325306,
FT                   2325788..2326933)
FT                   /gene="Hfe2"
FT                   /locus_tag="mCG_14860"
FT                   /product="hemochromatosis type 2 (juvenile) (human
FT                   homolog)"
FT                   /note="gene_id=mCG14860.1 transcript_id=mCT20861.2 created
FT                   on 30-MAY-2002"
FT   CDS             join(<2324229..2324373,2324759..2325306,2325788..2326414)
FT                   /codon_start=1
FT                   /gene="Hfe2"
FT                   /locus_tag="mCG_14860"
FT                   /product="hemochromatosis type 2 (juvenile) (human
FT                   homolog)"
FT                   /note="gene_id=mCG14860.1 transcript_id=mCT20861.2
FT                   protein_id=mCP12582.2"
FT                   /protein_id="EDL38890.1"
FT   assembly_gap    2324459..2324488
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(2353524..2355550)
FT                   /locus_tag="mCG_126506"
FT                   /note="gene_id=mCG126506.1"
FT   mRNA            complement(join(2353524..2353810,2355103..2355550))
FT                   /locus_tag="mCG_126506"
FT                   /product="mCG126506"
FT                   /note="gene_id=mCG126506.1 transcript_id=mCT127777.1
FT                   created on 30-MAY-2002"
FT   assembly_gap    2354422..2354538
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   CDS             complement(2355189..2355395)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126506"
FT                   /product="mCG126506"
FT                   /note="gene_id=mCG126506.1 transcript_id=mCT127777.1
FT                   protein_id=mCP78266.1"
FT                   /db_xref="GOA:Q3UPP6"
FT                   /db_xref="MGI:MGI:3641753"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPP6"
FT                   /protein_id="EDL38891.1"
FT   gene            <2355775..2359692
FT                   /gene="Txnip"
FT                   /locus_tag="mCG_14853"
FT                   /note="gene_id=mCG14853.2"
FT   mRNA            join(<2355775..2356303,2356707..2356782,2356888..2357035,
FT                   2357151..2357253,2357407..2357663,2357756..2357912,
FT                   2358026..2358177,2358297..2359683)
FT                   /gene="Txnip"
FT                   /locus_tag="mCG_14853"
FT                   /product="thioredoxin interacting protein, transcript
FT                   variant mCT193704"
FT                   /note="gene_id=mCG14853.2 transcript_id=mCT193704.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2355776..2356303,2356710..2356782,2356888..2357035,
FT                   2357151..2357253,2357407..2357663,2357756..2357912,
FT                   2358026..2358177,2358297..2359692)
FT                   /gene="Txnip"
FT                   /locus_tag="mCG_14853"
FT                   /product="thioredoxin interacting protein, transcript
FT                   variant mCT20854"
FT                   /note="gene_id=mCG14853.2 transcript_id=mCT20854.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(<2355991..2356303,2356707..2356782,2356888..2357035,
FT                   2357151..2357253,2357407..2357663,2357756..2357912,
FT                   2358026..2358177,2358297..2358584)
FT                   /codon_start=1
FT                   /gene="Txnip"
FT                   /locus_tag="mCG_14853"
FT                   /product="thioredoxin interacting protein, isoform CRA_a"
FT                   /note="gene_id=mCG14853.2 transcript_id=mCT193704.0
FT                   protein_id=mCP114699.0 isoform=CRA_a"
FT                   /protein_id="EDL38892.1"
FT   CDS             join(2356054..2356303,2356710..2356782,2356888..2357035,
FT                   2357151..2357253,2357407..2357663,2357756..2357912,
FT                   2358026..2358177,2358297..2358584)
FT                   /codon_start=1
FT                   /gene="Txnip"
FT                   /locus_tag="mCG_14853"
FT                   /product="thioredoxin interacting protein, isoform CRA_b"
FT                   /note="gene_id=mCG14853.2 transcript_id=mCT20854.1
FT                   protein_id=mCP12575.2 isoform=CRA_b"
FT                   /protein_id="EDL38893.1"
FT                   CPHCGIGVFAGWMSEHS"
FT   gene            complement(2357534..2359684)
FT                   /locus_tag="mCG_140521"
FT                   /note="gene_id=mCG140521.0"
FT   mRNA            complement(join(2357534..2357660,2357753..2357775,
FT                   2359228..2359684))
FT                   /locus_tag="mCG_140521"
FT                   /product="mCG140521"
FT                   /note="gene_id=mCG140521.0 transcript_id=mCT169921.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(2357763..2357775,2359228..2359409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140521"
FT                   /product="mCG140521"
FT                   /note="gene_id=mCG140521.0 transcript_id=mCT169921.0
FT                   protein_id=mCP92869.0"
FT                   /protein_id="EDL38894.1"
FT   assembly_gap    2362880..2363084
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    2371213..2371232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2375729..>2392027)
FT                   /gene="Polr3gl"
FT                   /locus_tag="mCG_14863"
FT                   /note="gene_id=mCG14863.1"
FT   mRNA            complement(join(2375729..2376450,2377661..2377774,
FT                   2377879..2377952,2378313..2378369,2378698..2378766,
FT                   2379504..2379633,2379948..2380115,2391952..>2392027))
FT                   /gene="Polr3gl"
FT                   /locus_tag="mCG_14863"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide G
FT                   like, transcript variant mCT20864"
FT                   /note="gene_id=mCG14863.1 transcript_id=mCT20864.2 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(<2376364..2376450,2377661..2377774,
FT                   2377879..2377952,2378313..2378369,2378698..2378766,
FT                   2379504..2379633,2391952..>2392026))
FT                   /gene="Polr3gl"
FT                   /locus_tag="mCG_14863"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide G
FT                   like, transcript variant mCT193705"
FT                   /note="gene_id=mCG14863.1 transcript_id=mCT193705.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2376364..2376450,2377661..2377774,
FT                   2377879..2377952,2378313..2378369,2378698..2378766,
FT                   2379504..2379633,2391952..>2391969))
FT                   /codon_start=1
FT                   /gene="Polr3gl"
FT                   /locus_tag="mCG_14863"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide G
FT                   like, isoform CRA_a"
FT                   /note="gene_id=mCG14863.1 transcript_id=mCT193705.0
FT                   protein_id=mCP114702.0 isoform=CRA_a"
FT                   /protein_id="EDL38895.1"
FT   CDS             complement(join(2376364..2376450,2377661..2377774,
FT                   2377879..2377952,2378313..2378369,2378698..2378766,
FT                   2379504..2379633,2379948..2380115,2391952..>2391969))
FT                   /codon_start=1
FT                   /gene="Polr3gl"
FT                   /locus_tag="mCG_14863"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide G
FT                   like, isoform CRA_b"
FT                   /note="gene_id=mCG14863.1 transcript_id=mCT20864.2
FT                   protein_id=mCP12593.2 isoform=CRA_b"
FT                   /protein_id="EDL38896.1"
FT                   EDFGGDSDDNMDEAIY"
FT   assembly_gap    2392327..2392411
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2394428..2395399
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    2396198..2396336
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            2396859..2397613
FT                   /locus_tag="mCG_1041491"
FT                   /note="gene_id=mCG1041491.1"
FT   mRNA            2396859..2397613
FT                   /locus_tag="mCG_1041491"
FT                   /product="mCG1041491"
FT                   /note="gene_id=mCG1041491.1 transcript_id=mCT159195.1
FT                   created on 30-MAY-2002"
FT   CDS             2397242..2397523
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041491"
FT                   /product="mCG1041491"
FT                   /note="gene_id=mCG1041491.1 transcript_id=mCT159195.1
FT                   protein_id=mCP78245.1"
FT                   /protein_id="EDL38897.1"
FT   gene            2398946..2422670
FT                   /locus_tag="mCG_14859"
FT                   /note="gene_id=mCG14859.1"
FT   mRNA            join(2398946..2399306,2412239..2412402,2416449..2416589,
FT                   2419164..2419259,2419998..2420075,2421519..2422670)
FT                   /locus_tag="mCG_14859"
FT                   /product="mCG14859"
FT                   /note="gene_id=mCG14859.1 transcript_id=mCT20860.2 created
FT                   on 30-MAY-2002"
FT   CDS             join(2399015..2399306,2412239..2412402,2416449..2416589,
FT                   2419164..2419259,2419998..2420075,2421519..2421761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14859"
FT                   /product="mCG14859"
FT                   /note="gene_id=mCG14859.1 transcript_id=mCT20860.2
FT                   protein_id=mCP12601.2"
FT                   /db_xref="InterPro:IPR029270"
FT                   /db_xref="MGI:MGI:3036267"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9C8"
FT                   /protein_id="EDL38898.1"
FT   gene            complement(2404484..>2427644)
FT                   /locus_tag="mCG_14876"
FT                   /note="gene_id=mCG14876.1"
FT   mRNA            complement(join(2404484..2407245,2422382..2422485,
FT                   2427281..>2427644))
FT                   /locus_tag="mCG_14876"
FT                   /product="mCG14876"
FT                   /note="gene_id=mCG14876.1 transcript_id=mCT20877.2 created
FT                   on 15-JUL-2003"
FT   CDS             complement(2405447..>2406061)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14876"
FT                   /product="mCG14876"
FT                   /note="gene_id=mCG14876.1 transcript_id=mCT20877.2
FT                   protein_id=mCP12594.2"
FT                   /protein_id="EDL38899.1"
FT   assembly_gap    2417658..2417978
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    2424968..2425265
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   gene            2427047..2430730
FT                   /gene="Rbm8a"
FT                   /locus_tag="mCG_14854"
FT                   /note="gene_id=mCG14854.1"
FT   mRNA            join(2427047..2427186,2427733..2427851,2428125..2428184,
FT                   2428303..2428377,2428690..2428826,2429256..2429392,
FT                   2429513..2430730)
FT                   /gene="Rbm8a"
FT                   /locus_tag="mCG_14854"
FT                   /product="RNA binding motif protein 8a"
FT                   /note="gene_id=mCG14854.1 transcript_id=mCT20855.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(2427785..2427851,2428125..2428184,2428303..2428377,
FT                   2428690..2428826,2429256..2429392,2429513..2429558)
FT                   /codon_start=1
FT                   /gene="Rbm8a"
FT                   /locus_tag="mCG_14854"
FT                   /product="RNA binding motif protein 8a"
FT                   /note="gene_id=mCG14854.1 transcript_id=mCT20855.1
FT                   protein_id=mCP12584.1"
FT                   /db_xref="GOA:Q9CWZ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR033744"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1913129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CWZ3"
FT                   /protein_id="EDL38900.1"
FT                   RSRSPDRRRR"
FT   gene            2433280..2443181
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /note="gene_id=mCG14856.2"
FT   mRNA            join(2433280..2433559,2434490..2434605,2434947..2435148,
FT                   2441390..2441830,2442251..2442541)
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, transcript
FT                   variant mCT20857"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT20857.1 created
FT                   on 30-MAY-2002"
FT   mRNA            join(2433280..2433559,2434490..2434605,2434947..2435148,
FT                   2441390..2442539)
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, transcript
FT                   variant mCT169559"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT169559.0 created
FT                   on 30-MAY-2002"
FT   mRNA            join(<2433281..2433316,2434490..2434605,2434947..2435148,
FT                   2441390..2443181)
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, transcript
FT                   variant mCT193709"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT193709.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2433281..2433316,2434490..2434605,2434947..2435148,
FT                   2441390..2441830,2442251..2443181)
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, transcript
FT                   variant mCT169558"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT169558.0 created
FT                   on 30-MAY-2002"
FT   CDS             join(<2433282..2433316,2434490..2434605,2434947..2435148,
FT                   2441390..2441795)
FT                   /codon_start=1
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, isoform CRA_d"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT193709.0
FT                   protein_id=mCP114701.0 isoform=CRA_d"
FT                   /protein_id="EDL38904.1"
FT   mRNA            join(<2433489..2433555,2434490..2434605,2434947..2435148,
FT                   2441390..2442541)
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, transcript
FT                   variant mCT193708"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT193708.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2433491..2433555,2434490..2434605,2434947..2435148,
FT                   2441390..2441795)
FT                   /codon_start=1
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, isoform CRA_c"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT193708.0
FT                   protein_id=mCP114700.0 isoform=CRA_c"
FT                   /protein_id="EDL38903.1"
FT   CDS             join(2433504..2433559,2434490..2434605,2434947..2435148,
FT                   2441390..2441795)
FT                   /codon_start=1
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, isoform CRA_b"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT169559.0
FT                   protein_id=mCP92891.0 isoform=CRA_b"
FT                   /protein_id="EDL38902.1"
FT   CDS             join(2433504..2433559,2434490..2434605,2434947..2435148,
FT                   2441390..2441795)
FT                   /codon_start=1
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, isoform CRA_b"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT20857.1
FT                   protein_id=mCP12586.1 isoform=CRA_b"
FT                   /protein_id="EDL38905.1"
FT   CDS             2441412..2441795
FT                   /codon_start=1
FT                   /gene="Pex11b"
FT                   /locus_tag="mCG_14856"
FT                   /product="peroxisomal biogenesis factor 11b, isoform CRA_a"
FT                   /note="gene_id=mCG14856.2 transcript_id=mCT169558.0
FT                   protein_id=mCP92876.0 isoform=CRA_a"
FT                   /protein_id="EDL38901.1"
FT   gene            2443407..2461177
FT                   /locus_tag="mCG_14875"
FT                   /note="gene_id=mCG14875.2"
FT   mRNA            join(2443407..2443501,2444895..2445006,2445184..2445293,
FT                   2445444..2445535,2445916..2446030,2446850..2446977,
FT                   2447391..2447539,2448219..2448369,2448969..2449134,
FT                   2449241..2449314,2449564..2449708,2449901..2450050,
FT                   2450294..2450437,2450579..2450782,2451443..2451573,
FT                   2452523..2452689,2452795..2452937,2453377..2453463,
FT                   2453635..2453720,2453997..2454138,2454286..2454378,
FT                   2454541..2454617,2454779..2454868,2455272..2455356,
FT                   2455499..2455612,2455804..2455884,2456018..2456131,
FT                   2459620..2459715,2460392..2460505,2460762..2461177)
FT                   /locus_tag="mCG_14875"
FT                   /product="mCG14875"
FT                   /note="gene_id=mCG14875.2 transcript_id=mCT20876.2 created
FT                   on 30-MAY-2002"
FT   CDS             join(2450009..2450050,2450294..2450437,2450579..2450782,
FT                   2451443..2451573,2452523..2452689,2452795..2452937,
FT                   2453377..2453463,2453635..2453720,2453997..2454138,
FT                   2454286..2454378,2454541..2454617,2454779..2454868,
FT                   2455272..2455356,2455499..2455612,2455804..2455884,
FT                   2456018..2456131,2459620..2459715,2460392..2460505,
FT                   2460762..2460827)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14875"
FT                   /product="mCG14875"
FT                   /note="gene_id=mCG14875.2 transcript_id=mCT20876.2
FT                   protein_id=mCP12579.2"
FT                   /protein_id="EDL38906.1"
FT   assembly_gap    2453296..2453376
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    2461179..2461198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2464260..2464816)
FT                   /locus_tag="mCG_14858"
FT                   /note="gene_id=mCG14858.1"
FT   mRNA            complement(2464260..2464816)
FT                   /locus_tag="mCG_14858"
FT                   /product="mCG14858"
FT                   /note="gene_id=mCG14858.1 transcript_id=mCT20859.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(2464314..2464781)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14858"
FT                   /product="mCG14858"
FT                   /note="gene_id=mCG14858.1 transcript_id=mCT20859.1
FT                   protein_id=mCP12588.2"
FT                   /protein_id="EDL38907.1"
FT   assembly_gap    2467022..2467041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2468124..2489043
FT                   /locus_tag="mCG_14871"
FT                   /note="gene_id=mCG14871.2"
FT   mRNA            join(<2468124..2468247,2475941..2476075,2477198..2477286,
FT                   2477650..2477714,2478491..2478548,2478647..2478717,
FT                   2478982..2479088,2480047..2480231,2481014..2481051,
FT                   2481203..2483197,2487156..2487245,2487455..2487520,
FT                   2488202..2488306,2488849..2489019)
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, transcript variant mCT193707"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT193707.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2468135..2468247,2475941..2476071,2477198..2477286,
FT                   2477650..2477714,2478491..2478548,2478647..2478717,
FT                   2478982..2479088,2480047..2480231,2481567..2483197,
FT                   2487156..2487245,2487455..2487520,2488202..2488306,
FT                   2488849..2489043)
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, transcript variant mCT20872"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT20872.1 created
FT                   on 30-MAY-2002"
FT   mRNA            join(<2468136..2468247,2475941..2476071,2477198..2477286,
FT                   2477650..2477714,2478491..2478548,2478647..2478717,
FT                   2478982..2479088,2480047..2480231,2481014..2481051,
FT                   2481203..2483197,2487156..2487245,2487455..2487520,
FT                   2488202..2488478)
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, transcript variant mCT193706"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT193706.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2468152..2468247,2475941..2476071,2477198..2477286,
FT                   2477650..2477714,2478491..2478548,2478647..2478717,
FT                   2478982..2479088,2480047..2480231,2481014..2481051,
FT                   2481203..2483197,2487156..2487245,2487455..2487520,
FT                   2488202..2488261)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, isoform CRA_a"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT193706.0
FT                   protein_id=mCP114705.0 isoform=CRA_a"
FT                   /protein_id="EDL38908.1"
FT   CDS             join(2468209..2468247,2475941..2476071,2477198..2477286,
FT                   2477650..2477714,2478491..2478548,2478647..2478717,
FT                   2478982..2479088,2480047..2480231,2481567..2483197,
FT                   2487156..2487245,2487455..2487520,2488202..2488261)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, isoform CRA_c"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT20872.1
FT                   protein_id=mCP12587.2 isoform=CRA_c"
FT                   /protein_id="EDL38910.1"
FT   assembly_gap    2473937..2473956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<2476053..2476075,2477198..2477286,2477650..2477714,
FT                   2478491..2478548,2478647..2478717,2478982..2479088,
FT                   2480047..2480231,2481014..2481051,2481203..2483197,
FT                   2487156..2487245,2487455..2487520,2488202..2488261)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14871"
FT                   /product="mCG14871, isoform CRA_b"
FT                   /note="gene_id=mCG14871.2 transcript_id=mCT193707.0
FT                   protein_id=mCP114706.0 isoform=CRA_b"
FT                   /protein_id="EDL38909.1"
FT                   YMEQDVYNILLRILSMQE"
FT   assembly_gap    2476888..2476907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2490217..2490236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2491462..2491481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2496235..2505804
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /note="gene_id=mCG14864.1"
FT   mRNA            join(2496235..2496371,2499261..2499678,2499834..2499918,
FT                   2500059..2500109,2500330..2500420,2501128..2501262,
FT                   2501458..2501563,2502016..2502089,2502199..2502359,
FT                   2503367..2503500,2503580..2503748,2503900..2504033,
FT                   2504191..2504228,2504691..2505804)
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, transcript
FT                   variant mCT20865"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT20865.1 created
FT                   on 30-MAY-2002"
FT   mRNA            join(<2496281..2496371,2499261..2499678,2499834..2499918,
FT                   2500059..2500109,2500330..2500420,2501128..2501262,
FT                   2501458..2501563,2502016..2502089,2502199..2502359,
FT                   2503367..2503469,2503580..2503748,2503900..2504033,
FT                   2504191..2504228,2504691..2505316)
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, transcript
FT                   variant mCT193712"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT193712.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2496297..2496371,2499261..2499678,2499834..2499918,
FT                   2500059..2500109,2500330..2500420,2501128..2501262,
FT                   2501458..2501563,2502016..2502089,2502199..2502359,
FT                   2503367..2503469,2503580..2503651)
FT                   /codon_start=1
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT193712.0
FT                   protein_id=mCP114704.0 isoform=CRA_c"
FT                   /protein_id="EDL38913.1"
FT   mRNA            join(2496923..2497035,2499261..2499494,2499600..2499678,
FT                   2499834..2499918,2500059..2500109,2500330..2500420,
FT                   2501128..2501262,2501458..2501563,2502016..2502089,
FT                   2502199..2502359,2503367..2503500,2503580..2503748,
FT                   2503900..2504033,2504191..2504228,2504691..2505804)
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, transcript
FT                   variant mCT169560"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT169560.0 created
FT                   on 30-MAY-2002"
FT   mRNA            join(<2497006..2497035,2499261..2499678,2499834..2499918,
FT                   2500059..2500109,2500330..2500420,2501128..2501262,
FT                   2501458..2501563,2502016..2502089,2502199..2502359,
FT                   2503367..2503500,2503580..2503748,2503900..2504033,
FT                   2504191..2504228,2504691..2505804)
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, transcript
FT                   variant mCT193711"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT193711.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2497006..2497035,2499261..2499678,2499834..2499918,
FT                   2500059..2500109,2500330..2500420,2501128..2501262,
FT                   2501458..2501563,2502016..2502089,2502199..2502359,
FT                   2503367..2503500,2503580..2503748,2503900..2504033,
FT                   2504191..2504228,2504691..2504957)
FT                   /codon_start=1
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT193711.0
FT                   protein_id=mCP114703.0 isoform=CRA_b"
FT                   /protein_id="EDL38912.1"
FT   CDS             join(2497012..2497035,2499261..2499494,2499600..2499678,
FT                   2499834..2499918,2500059..2500109,2500330..2500420,
FT                   2501128..2501262,2501458..2501563,2502016..2502089,
FT                   2502199..2502359,2503367..2503500,2503580..2503748,
FT                   2503900..2504033,2504191..2504228,2504691..2504957)
FT                   /codon_start=1
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT169560.0
FT                   protein_id=mCP92875.0 isoform=CRA_a"
FT                   /protein_id="EDL38911.1"
FT                   PSGPSLTGCRSDVISLD"
FT   CDS             join(2499264..2499678,2499834..2499918,2500059..2500109,
FT                   2500330..2500420,2501128..2501262,2501458..2501563,
FT                   2502016..2502089,2502199..2502359,2503367..2503500,
FT                   2503580..2503748,2503900..2504033,2504191..2504228,
FT                   2504691..2504957)
FT                   /codon_start=1
FT                   /gene="Pias3"
FT                   /locus_tag="mCG_14864"
FT                   /product="protein inhibitor of activated STAT 3, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG14864.1 transcript_id=mCT20865.1
FT                   protein_id=mCP12590.1 isoform=CRA_d"
FT                   /protein_id="EDL38914.1"
FT   gene            complement(2505910..2508407)
FT                   /locus_tag="mCG_14855"
FT                   /note="gene_id=mCG14855.2"
FT   mRNA            complement(join(2505910..2506085,2506210..2506370,
FT                   2506752..2506888,2507044..2507142,2507400..2507492,
FT                   2507626..2507651,2507834..2508017,2508170..2508407))
FT                   /locus_tag="mCG_14855"
FT                   /product="mCG14855, transcript variant mCT20856"
FT                   /note="gene_id=mCG14855.2 transcript_id=mCT20856.2 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(2506211..2506370,2506752..2506888,
FT                   2507044..2507142,2507400..2507492,2507626..2507651,
FT                   2507834..2508017,2508170..2508361))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14855"
FT                   /product="mCG14855, isoform CRA_b"
FT                   /note="gene_id=mCG14855.2 transcript_id=mCT20856.2
FT                   protein_id=mCP12571.2 isoform=CRA_b"
FT                   /protein_id="EDL38916.1"
FT                   GTKFALQLWLQHLGR"
FT   mRNA            complement(join(2507199..2507651,2507834..2507978,
FT                   2508170..2508407))
FT                   /locus_tag="mCG_14855"
FT                   /product="mCG14855, transcript variant mCT169557"
FT                   /note="gene_id=mCG14855.2 transcript_id=mCT169557.0 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(2507593..2507651,2507834..2507978,
FT                   2508170..2508361))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14855"
FT                   /product="mCG14855, isoform CRA_a"
FT                   /note="gene_id=mCG14855.2 transcript_id=mCT169557.0
FT                   protein_id=mCP92905.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0G2JES0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="MGI:MGI:1925623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JES0"
FT                   /protein_id="EDL38915.1"
FT   gene            complement(2511368..2527328)
FT                   /locus_tag="mCG_14870"
FT                   /note="gene_id=mCG14870.2"
FT   mRNA            complement(join(2511368..2511900,2513321..2513470,
FT                   2513935..2513984,2514099..2514200,2514960..2515110,
FT                   2515474..2515534,2516270..2516321,2516508..2516588,
FT                   2519096..2519188,2519323..2519427,2522402..2522487,
FT                   2523376..2523561,2523659..2523914,2525696..2525861,
FT                   2527211..2527328))
FT                   /locus_tag="mCG_14870"
FT                   /product="mCG14870"
FT                   /note="gene_id=mCG14870.2 transcript_id=mCT20871.2 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(2511819..2511900,2513321..2513470,
FT                   2513935..2513984,2514099..2514200,2514960..2515110,
FT                   2515474..2515534,2516270..2516321,2516508..2516588,
FT                   2519096..2519188,2519323..2519427,2522402..2522487,
FT                   2523376..2523561,2523659..2523914,2525696..2525842))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14870"
FT                   /product="mCG14870"
FT                   /note="gene_id=mCG14870.2 transcript_id=mCT20871.2
FT                   protein_id=mCP12568.2"
FT                   /db_xref="GOA:B2RX77"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="MGI:MGI:1921664"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX77"
FT                   /protein_id="EDL38917.1"
FT                   TIFLLESYIESTMKRQ"
FT   assembly_gap    2517717..2518035
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            2527470..2591018
FT                   /gene="Zfp364"
FT                   /locus_tag="mCG_14873"
FT                   /note="gene_id=mCG14873.2"
FT   mRNA            join(2527470..2527772,2554133..2554192,2558168..2558225,
FT                   2575852..2576063,2583857..2583928,2585202..2585274,
FT                   2586140..2586233,2588779..2588894,2590870..2591018)
FT                   /gene="Zfp364"
FT                   /locus_tag="mCG_14873"
FT                   /product="zinc finger protein 364"
FT                   /note="gene_id=mCG14873.2 transcript_id=mCT20874.2 created
FT                   on 30-MAY-2002"
FT   assembly_gap    2534854..2534873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2542054..2542744
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    2551348..2551762
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    2553683..2554104
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   CDS             join(2554182..2554192,2558168..2558225,2575852..2576063,
FT                   2583857..2583928,2585202..2585274,2586140..2586233,
FT                   2588779..2588894,2590870..2590902)
FT                   /codon_start=1
FT                   /gene="Zfp364"
FT                   /locus_tag="mCG_14873"
FT                   /product="zinc finger protein 364"
FT                   /note="gene_id=mCG14873.2 transcript_id=mCT20874.2
FT                   protein_id=mCP12573.2"
FT                   /protein_id="EDL38918.1"
FT                   "
FT   assembly_gap    2556351..2556370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2574116..2574135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2582028..2582047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2589358..2590856
FT                   /estimated_length=1499
FT                   /gap_type="unknown"
FT   gene            complement(2600115..2614312)
FT                   /gene="Cd160"
FT                   /locus_tag="mCG_14869"
FT                   /note="gene_id=mCG14869.2"
FT   mRNA            complement(join(2600115..2600493,2602151..2602282,
FT                   2605412..2605738,2608581..2608725,2614264..2614312))
FT                   /gene="Cd160"
FT                   /locus_tag="mCG_14869"
FT                   /product="CD160 antigen"
FT                   /note="gene_id=mCG14869.2 transcript_id=mCT20870.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(2600477..2600493,2602151..2602282,
FT                   2605412..2605738,2608581..2608662))
FT                   /codon_start=1
FT                   /gene="Cd160"
FT                   /locus_tag="mCG_14869"
FT                   /product="CD160 antigen"
FT                   /note="gene_id=mCG14869.2 transcript_id=mCT20870.1
FT                   protein_id=mCP12603.1"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:1860383"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VC80"
FT                   /protein_id="EDL38919.1"
FT   assembly_gap    2616106..2616125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2629820..2668913
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /note="gene_id=mCG14872.2"
FT   mRNA            join(2629820..2629945,2647801..2648012,2649064..2649313,
FT                   2652483..2652619,2653808..2654003,2655171..2655367,
FT                   2666296..2666520,2666929..2667219,2668098..2668913)
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, transcript variant
FT                   mCT20873"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT20873.2 created
FT                   on 30-MAY-2002"
FT   gene            complement(2631129..2631839)
FT                   /locus_tag="mCG_148352"
FT                   /note="gene_id=mCG148352.0"
FT   mRNA            complement(join(2631129..2631617,2631812..2631839))
FT                   /locus_tag="mCG_148352"
FT                   /product="mCG148352"
FT                   /note="gene_id=mCG148352.0 transcript_id=mCT188615.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2631133..2631345)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148352"
FT                   /product="mCG148352"
FT                   /note="gene_id=mCG148352.0 transcript_id=mCT188615.0
FT                   protein_id=mCP109725.0"
FT                   /protein_id="EDL38924.1"
FT   mRNA            join(2631943..2632508,2647801..2648012,2649064..2649313,
FT                   2652483..2652619,2653808..2654003,2655171..2655367,
FT                   2666296..2666520,2666929..2667219,2668098..2668460)
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, transcript variant
FT                   mCT169561"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT169561.0 created
FT                   on 30-MAY-2002"
FT   mRNA            join(<2631958..2632508,2647801..2648012,2649064..2649313,
FT                   2652483..2652619,2653808..2654003,2655171..2655367,
FT                   2666296..2666520,2666929..2667219,2668098..2668266,
FT                   2668402..2668584)
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, transcript variant
FT                   mCT193710"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT193710.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2631958..2632307,2647801..2648012,2649064..2649313,
FT                   2652483..2652619,2653808..2654003,2655171..2655367,
FT                   2666296..2666520,2666929..2667219,2668098..2668460)
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, transcript variant
FT                   mCT169562"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT169562.0 created
FT                   on 30-MAY-2002"
FT   CDS             join(<2632490..2632508,2647801..2648012,2649064..2649313,
FT                   2652483..2652619,2653808..2654003,2655171..2655367,
FT                   2666296..2666520,2666929..2667219,2668098..2668151)
FT                   /codon_start=1
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT193710.0
FT                   protein_id=mCP114707.0 isoform=CRA_b"
FT                   /protein_id="EDL38921.1"
FT                   SSNSEDTEM"
FT   assembly_gap    2640771..2642452
FT                   /estimated_length=1682
FT                   /gap_type="unknown"
FT   assembly_gap    2646095..2646611
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   CDS             join(2647803..2648012,2649064..2649313,2652483..2652619,
FT                   2653808..2654003,2655171..2655367,2666296..2666520,
FT                   2666929..2667219,2668098..2668151)
FT                   /codon_start=1
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT169562.0
FT                   protein_id=mCP92893.0 isoform=CRA_a"
FT                   /protein_id="EDL38920.1"
FT                   EM"
FT   CDS             join(2647803..2648012,2649064..2649313,2652483..2652619,
FT                   2653808..2654003,2655171..2655367,2666296..2666520,
FT                   2666929..2667219,2668098..2668151)
FT                   /codon_start=1
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT20873.2
FT                   protein_id=mCP12569.2 isoform=CRA_a"
FT                   /protein_id="EDL38922.1"
FT                   EM"
FT   CDS             join(2647803..2648012,2649064..2649313,2652483..2652619,
FT                   2653808..2654003,2655171..2655367,2666296..2666520,
FT                   2666929..2667219,2668098..2668151)
FT                   /codon_start=1
FT                   /gene="Pdzk1"
FT                   /locus_tag="mCG_14872"
FT                   /product="PDZ domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG14872.2 transcript_id=mCT169561.0
FT                   protein_id=mCP92873.0 isoform=CRA_a"
FT                   /protein_id="EDL38923.1"
FT                   EM"
FT   assembly_gap    2651949..2651968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2654124..2654143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2667309..2703350)
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /note="gene_id=mCG126475.0"
FT   mRNA            complement(join(2667309..2669582,2670465..2670530,
FT                   2671448..2671537,2673616..2673711,2678044..2678136,
FT                   2678591..2678679,2680487..2680596,2687898..2687978,
FT                   2688792..2688912,2690855..2690956,2691454..2691593,
FT                   2695322..2695425,2696485..2696544,2703186..2703350))
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, transcript variant
FT                   mCT127776"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT127776.1
FT                   created on 31-MAY-2002"
FT   mRNA            complement(join(2667309..2669582,2670465..2670530,
FT                   2671448..2671537,2673616..2673711,2678044..2678136,
FT                   2678493..2678679,2680487..2680596,2687898..2687978,
FT                   2688792..2688912,2690855..2690956,2691454..2691593,
FT                   2695322..2695425,2696485..2696544,2703186..2703350))
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, transcript variant
FT                   mCT127773"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT127773.1
FT                   created on 31-MAY-2002"
FT   mRNA            complement(join(2669054..2669582,2670465..2670530,
FT                   2671448..2671537,2673616..2673711,2678044..2678136,
FT                   2678591..2678679,2680487..2680596,2687898..2687978,
FT                   2688792..2688912,2690855..2690956,2691487..2691593,
FT                   2695322..2695425,2696485..2696544,2703186..>2703302))
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, transcript variant
FT                   mCT193719"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT193719.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2669376..2669582,2670465..2670530,
FT                   2671448..2671537,2673616..2673711,2678044..2678136,
FT                   2678591..2678679,2680487..2680596,2687898..2687978,
FT                   2688792..2688912,2690855..2690956,2691487..2691593,
FT                   2695322..2695425,2696485..2696544,2703186..>2703266))
FT                   /codon_start=1
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, isoform CRA_c"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT193719.0
FT                   protein_id=mCP114684.0 isoform=CRA_c"
FT                   /protein_id="EDL38927.1"
FT                   KQAPEKHMAP"
FT   CDS             complement(join(2669376..2669582,2670465..2670530,
FT                   2671448..2671537,2673616..2673711,2678044..2678136,
FT                   2678591..2678679,2680487..2680596,2687898..2687978,
FT                   2688792..2688912,2690855..2690956,2691454..2691593,
FT                   2695322..2695425,2696485..2696544,2703186..2703227))
FT                   /codon_start=1
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, isoform CRA_b"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT127776.1
FT                   protein_id=mCP78176.1 isoform=CRA_b"
FT                   /protein_id="EDL38926.1"
FT                   APEKHMAP"
FT   CDS             complement(join(2678549..2678679,2680487..2680596,
FT                   2687898..2687978,2688792..2688912,2690855..2690956,
FT                   2691454..2691593,2695322..2695425,2696485..2696544,
FT                   2703186..2703227))
FT                   /codon_start=1
FT                   /gene="Gpr89"
FT                   /locus_tag="mCG_126475"
FT                   /product="G protein-coupled receptor 89, isoform CRA_a"
FT                   /note="gene_id=mCG126475.0 transcript_id=mCT127773.1
FT                   protein_id=mCP78168.1 isoform=CRA_a"
FT                   /protein_id="EDL38925.1"
FT                   TKVQSEETALLYQHG"
FT   assembly_gap    2687341..2687360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2700944..2700963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2717026..2723933)
FT                   /gene="Gja8"
FT                   /locus_tag="mCG_14874"
FT                   /note="gene_id=mCG14874.1"
FT   mRNA            complement(join(<2717026..2718354,2723869..2723933))
FT                   /gene="Gja8"
FT                   /locus_tag="mCG_14874"
FT                   /product="gap junction membrane channel protein alpha 8"
FT                   /note="gene_id=mCG14874.1 transcript_id=mCT20875.2 created
FT                   on 04-JUN-2002"
FT   CDS             complement(2717026..2718348)
FT                   /codon_start=1
FT                   /gene="Gja8"
FT                   /locus_tag="mCG_14874"
FT                   /product="gap junction membrane channel protein alpha 8"
FT                   /note="gene_id=mCG14874.1 transcript_id=mCT20875.2
FT                   protein_id=mCP12570.0"
FT                   /db_xref="GOA:Q548M7"
FT                   /db_xref="InterPro:IPR000500"
FT                   /db_xref="InterPro:IPR002266"
FT                   /db_xref="InterPro:IPR013092"
FT                   /db_xref="InterPro:IPR017990"
FT                   /db_xref="InterPro:IPR019570"
FT                   /db_xref="MGI:MGI:99953"
FT                   /db_xref="UniProtKB/TrEMBL:Q548M7"
FT                   /protein_id="EDL38928.1"
FT   assembly_gap    2734959..2734978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2796705..2798755)
FT                   /locus_tag="mCG_140495"
FT                   /note="gene_id=mCG140495.0"
FT   mRNA            complement(join(2796705..2796819,2798520..2798755))
FT                   /locus_tag="mCG_140495"
FT                   /product="mCG140495"
FT                   /note="gene_id=mCG140495.0 transcript_id=mCT169785.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(2796752..2796819,2798520..2798637))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140495"
FT                   /product="mCG140495"
FT                   /note="gene_id=mCG140495.0 transcript_id=mCT169785.0
FT                   protein_id=mCP92884.0"
FT                   /protein_id="EDL38929.1"
FT                   LEPLQLDPASTAQGWG"
FT   assembly_gap    2820557..2820576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2826714..2826737
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            2830399..2851634
FT                   /gene="Gja5"
FT                   /locus_tag="mCG_14861"
FT                   /note="gene_id=mCG14861.2"
FT   mRNA            join(2830399..2830484,2848598..2851634)
FT                   /gene="Gja5"
FT                   /locus_tag="mCG_14861"
FT                   /product="gap junction membrane channel protein alpha 5"
FT                   /note="gene_id=mCG14861.2 transcript_id=mCT20862.2 created
FT                   on 04-JUN-2002"
FT   gene            complement(2844648..2890690)
FT                   /locus_tag="mCG_140496"
FT                   /note="gene_id=mCG140496.0"
FT   mRNA            complement(join(2844648..2845004,2851796..2851845,
FT                   2852873..2852994,2890313..2890690))
FT                   /locus_tag="mCG_140496"
FT                   /product="mCG140496"
FT                   /note="gene_id=mCG140496.0 transcript_id=mCT169786.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(join(2844970..2845004,2851796..2851845,
FT                   2852873..2852994,2890313..2890393))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140496"
FT                   /product="mCG140496"
FT                   /note="gene_id=mCG140496.0 transcript_id=mCT169786.0
FT                   protein_id=mCP92877.0"
FT                   /protein_id="EDL38931.1"
FT   CDS             2848631..2849707
FT                   /codon_start=1
FT                   /gene="Gja5"
FT                   /locus_tag="mCG_14861"
FT                   /product="gap junction membrane channel protein alpha 5"
FT                   /note="gene_id=mCG14861.2 transcript_id=mCT20862.2
FT                   protein_id=mCP12589.1"
FT                   /protein_id="EDL38930.1"
FT                   KRRLSKASSKARSDDLSV"
FT   assembly_gap    2858102..2858439
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    2877690..2877767
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    2943487..2947540
FT                   /estimated_length=4054
FT                   /gap_type="unknown"
FT   assembly_gap    2955072..2955091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2957717..2975496
FT                   /gene="Acp6"
FT                   /locus_tag="mCG_14867"
FT                   /note="gene_id=mCG14867.2"
FT   mRNA            join(2957717..2958292,2964770..2964898,2965001..2965131,
FT                   2965467..2965543,2966914..2967001,2967368..2967500,
FT                   2970570..2970670,2972731..2972826,2974556..2974721,
FT                   2975259..2975496)
FT                   /gene="Acp6"
FT                   /locus_tag="mCG_14867"
FT                   /product="acid phosphatase 6, lysophosphatidic"
FT                   /note="gene_id=mCG14867.2 transcript_id=mCT20868.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(2958095..2958292,2964770..2964898,2965001..2965131,
FT                   2965467..2965543,2966914..2967001,2967368..2967500,
FT                   2970570..2970670,2972731..2972826,2974556..2974721,
FT                   2975259..2975396)
FT                   /codon_start=1
FT                   /gene="Acp6"
FT                   /locus_tag="mCG_14867"
FT                   /product="acid phosphatase 6, lysophosphatidic"
FT                   /note="gene_id=mCG14867.2 transcript_id=mCT20868.1
FT                   protein_id=mCP12599.1"
FT                   /protein_id="EDL38932.1"
FT   gene            complement(3002587..3009646)
FT                   /gene="Bcl9"
FT                   /locus_tag="mCG_14866"
FT                   /note="gene_id=mCG14866.2"
FT   mRNA            complement(join(3002587..3004907,3006077..3006337,
FT                   3007408..3009646))
FT                   /gene="Bcl9"
FT                   /locus_tag="mCG_14866"
FT                   /product="B-cell CLL/lymphoma 9"
FT                   /note="gene_id=mCG14866.2 transcript_id=mCT20867.2 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(3003790..3004907,3006077..3006337,
FT                   3007408..3009193))
FT                   /codon_start=1
FT                   /gene="Bcl9"
FT                   /locus_tag="mCG_14866"
FT                   /product="B-cell CLL/lymphoma 9"
FT                   /note="gene_id=mCG14866.2 transcript_id=mCT20867.2
FT                   protein_id=mCP12600.1"
FT                   /protein_id="EDL38933.1"
FT                   PGNMMF"
FT   assembly_gap    3010357..3010777
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   gene            complement(3015427..3090656)
FT                   /locus_tag="mCG_140497"
FT                   /note="gene_id=mCG140497.0"
FT   mRNA            complement(join(3015427..3015908,3021072..3021154,
FT                   3023135..3023270,3090496..3090656))
FT                   /locus_tag="mCG_140497"
FT                   /product="mCG140497, transcript variant mCT169792"
FT                   /note="gene_id=mCG140497.0 transcript_id=mCT169792.0
FT                   created on 04-JUN-2002"
FT   mRNA            complement(join(3015427..3015908,3021072..3021154,
FT                   3023135..3023270,3027543..3027626))
FT                   /locus_tag="mCG_140497"
FT                   /product="mCG140497, transcript variant mCT169793"
FT                   /note="gene_id=mCG140497.0 transcript_id=mCT169793.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(3015690..3015896)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140497"
FT                   /product="mCG140497, isoform CRA_a"
FT                   /note="gene_id=mCG140497.0 transcript_id=mCT169792.0
FT                   protein_id=mCP92859.0 isoform=CRA_a"
FT                   /protein_id="EDL38934.1"
FT   CDS             complement(3015690..3015896)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140497"
FT                   /product="mCG140497, isoform CRA_a"
FT                   /note="gene_id=mCG140497.0 transcript_id=mCT169793.0
FT                   protein_id=mCP92858.0 isoform=CRA_a"
FT                   /protein_id="EDL38935.1"
FT   assembly_gap    3026301..3027129
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   gene            complement(3055230..3058521)
FT                   /locus_tag="mCG_148354"
FT                   /note="gene_id=mCG148354.0"
FT   mRNA            complement(3055230..3058521)
FT                   /locus_tag="mCG_148354"
FT                   /product="mCG148354"
FT                   /note="gene_id=mCG148354.0 transcript_id=mCT188617.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3056123..3056620)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148354"
FT                   /product="mCG148354"
FT                   /note="gene_id=mCG148354.0 transcript_id=mCT188617.0
FT                   protein_id=mCP109727.0"
FT                   /protein_id="EDL38936.1"
FT                   AV"
FT   assembly_gap    3063111..3063429
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    3070479..3070525
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    3090823..3090842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3096743..3096762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3102426..3102445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3106535..3106884
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    3115268..3115288
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    3120020..3120691
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    3140758..3140777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3164906..3165061
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    3186487..3186525
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    3186975..3187137
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            complement(3200329..>3201322)
FT                   /gene="Olfr1402"
FT                   /locus_tag="mCG_60034"
FT                   /note="gene_id=mCG60034.2"
FT   mRNA            complement(3200329..>3201322)
FT                   /gene="Olfr1402"
FT                   /locus_tag="mCG_60034"
FT                   /product="olfactory receptor 1402"
FT                   /note="gene_id=mCG60034.2 transcript_id=mCT60217.2 created
FT                   on 04-JUN-2002"
FT   CDS             complement(3200360..3201322)
FT                   /codon_start=1
FT                   /gene="Olfr1402"
FT                   /locus_tag="mCG_60034"
FT                   /product="olfactory receptor 1402"
FT                   /note="gene_id=mCG60034.2 transcript_id=mCT60217.2
FT                   protein_id=mCP34199.2"
FT                   /db_xref="GOA:Q8VET1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VET1"
FT                   /protein_id="EDL38937.1"
FT   assembly_gap    3218424..3218706
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    3237326..3237345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3243711..3243730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3264269..3264288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3275810..3275865
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    3280185..3280225
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3298298..3298317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3333979..3333998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3343319..3343429
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(3351226..3400701)
FT                   /gene="Chd1l"
FT                   /locus_tag="mCG_11102"
FT                   /note="gene_id=mCG11102.2"
FT   mRNA            complement(join(3351226..3351565,3353057..3353165,
FT                   3353935..3354049,3357254..3357324,3359596..3359694,
FT                   3360697..3360899,3361399..3361562,3363056..3363204,
FT                   3371476..3371674,3373214..3373367,3374305..3374419,
FT                   3377608..3377718,3378737..3378810,3380403..3380499,
FT                   3381051..3381143,3381702..3381853,3384501..3384667,
FT                   3388189..3388270,3392519..3392550,3393506..3393620,
FT                   3394157..3394263,3395595..3395707,3400561..3400701))
FT                   /gene="Chd1l"
FT                   /locus_tag="mCG_11102"
FT                   /product="chromodomain helicase DNA binding protein 1-like"
FT                   /note="gene_id=mCG11102.2 transcript_id=mCT12436.1 created
FT                   on 04-JUN-2002"
FT   CDS             complement(join(3351493..3351565,3353057..3353165,
FT                   3353935..3354049,3357254..3357324,3359596..3359694,
FT                   3360697..3360899,3361399..3361562,3363056..3363204,
FT                   3371476..3371674,3373214..3373367,3374305..3374419,
FT                   3377608..3377718,3378737..3378810,3380403..3380499,
FT                   3381051..3381143,3381702..3381853,3384501..3384667,
FT                   3388189..3388270,3392519..3392550,3393506..3393620,
FT                   3394157..3394263,3395595..3395707,3400561..3400669))
FT                   /codon_start=1
FT                   /gene="Chd1l"
FT                   /locus_tag="mCG_11102"
FT                   /product="chromodomain helicase DNA binding protein 1-like"
FT                   /note="gene_id=mCG11102.2 transcript_id=mCT12436.1
FT                   protein_id=mCP12597.1"
FT                   /protein_id="EDL38938.1"
FT   assembly_gap    3354434..3354778
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    3418847..3418866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3419350..3443063
FT                   /gene="Fmo5"
FT                   /locus_tag="mCG_11104"
FT                   /note="gene_id=mCG11104.2"
FT   mRNA            join(3419350..3419672,3425988..3426176,3427958..3428120,
FT                   3429337..3429479,3432145..3432344,3436056..3436408,
FT                   3441124..3441196,3441971..3442463,3442508..3443063)
FT                   /gene="Fmo5"
FT                   /locus_tag="mCG_11104"
FT                   /product="flavin containing monooxygenase 5"
FT                   /note="gene_id=mCG11104.2 transcript_id=mCT12437.2 created
FT                   on 04-JUN-2002"
FT   CDS             join(3419538..3419672,3425988..3426176,3427958..3428120,
FT                   3429337..3429479,3432145..3432344,3436056..3436408,
FT                   3441124..3441196,3441971..3442316)
FT                   /codon_start=1
FT                   /gene="Fmo5"
FT                   /locus_tag="mCG_11104"
FT                   /product="flavin containing monooxygenase 5"
FT                   /note="gene_id=mCG11104.2 transcript_id=mCT12437.2
FT                   protein_id=mCP12567.2"
FT                   /db_xref="GOA:P97872"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR002257"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="MGI:MGI:1310004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97872"
FT                   /protein_id="EDL38939.1"
FT                   VLMLAVAFFAVILAYF"
FT   assembly_gap    3432379..3432398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3442464..3442507
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            3448781..3464283
FT                   /gene="Prkab2"
FT                   /locus_tag="mCG_11105"
FT                   /note="gene_id=mCG11105.1"
FT   mRNA            join(3448781..3448839,3449059..3449236,3452743..3452909,
FT                   3454052..3454145,3454338..3454458,3457052..3457185,
FT                   3457829..3457897,3460198..3464283)
FT                   /gene="Prkab2"
FT                   /locus_tag="mCG_11105"
FT                   /product="protein kinase, AMP-activated, beta 2
FT                   non-catalytic subunit, transcript variant mCT12438"
FT                   /note="gene_id=mCG11105.1 transcript_id=mCT12438.1 created
FT                   on 04-JUN-2002"
FT   mRNA            join(3448782..3448839,3449059..3449236,3452743..3452909,
FT                   3454052..3454145,3457052..3457185,3457829..3457897,
FT                   3460198..3464281)
FT                   /gene="Prkab2"
FT                   /locus_tag="mCG_11105"
FT                   /product="protein kinase, AMP-activated, beta 2
FT                   non-catalytic subunit, transcript variant mCT169790"
FT                   /note="gene_id=mCG11105.1 transcript_id=mCT169790.0 created
FT                   on 04-JUN-2002"
FT   CDS             join(3449084..3449236,3452743..3452909,3454052..3454145,
FT                   3454338..3454458,3457052..3457185,3457829..3457897,
FT                   3460198..3460275)
FT                   /codon_start=1
FT                   /gene="Prkab2"
FT                   /locus_tag="mCG_11105"
FT                   /product="protein kinase, AMP-activated, beta 2
FT                   non-catalytic subunit, isoform CRA_a"
FT                   /note="gene_id=mCG11105.1 transcript_id=mCT12438.1
FT                   protein_id=mCP12583.2 isoform=CRA_a"
FT                   /protein_id="EDL38940.1"
FT   CDS             join(3449084..3449236,3452743..3452909,3454052..3454145,
FT                   3457052..3457185,3457829..3457871)
FT                   /codon_start=1
FT                   /gene="Prkab2"
FT                   /locus_tag="mCG_11105"
FT                   /product="protein kinase, AMP-activated, beta 2
FT                   non-catalytic subunit, isoform CRA_b"
FT                   /note="gene_id=mCG11105.1 transcript_id=mCT169790.0
FT                   protein_id=mCP92872.0 isoform=CRA_b"
FT                   /protein_id="EDL38941.1"
FT   assembly_gap    3475493..3475512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3480477..3678516)
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /note="gene_id=mCG11103.2"
FT   mRNA            complement(join(3480477..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503765,
FT                   3505576..3506104,3507430..3507546,3508611..3508803,
FT                   3509742..3510177,3514549..3514781,3521287..3521375,
FT                   3531768..3531895,3532939..3533051,3533615..3533752,
FT                   3533936..3534052,3537143..3537234,3537988..3538069,
FT                   3538236..3538406,3542280..3542474,3543487..3543666,
FT                   3544597..3544734,3544903..3545016,3545910..3546068,
FT                   3547355..3547567,3547675..3547767,3548003..3548122,
FT                   3549270..3549401,3583096..3583213,3583502..3583677,
FT                   3583842..3583965,3587089..3587165,3614556..3614666,
FT                   3631430..3631581,3633455..3633510,3678289..3678516))
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), transcript variant mCT12433"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT12433.3 created
FT                   on 10-JUN-2004"
FT   mRNA            complement(join(3480477..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503650,
FT                   3503655..3503729,3503732..3503765,3505576..3506104,
FT                   3507430..3507546,3508611..3508803,3509742..3510177,
FT                   3514549..3514781,3521287..3521375,3531768..3531895,
FT                   3532939..3533051,3533615..3533752,3533936..3534052,
FT                   3537143..3537234,3537988..3538069,3538236..3538406,
FT                   3542280..3542474,3543487..3543666,3544597..3544734,
FT                   3544903..3545016,3545910..3546068,3547355..3547567,
FT                   3547675..3547767,3548003..3548122,3549270..3549401,
FT                   3583096..3583213,3583502..3583677,3583842..3583965,
FT                   3587089..3587165,3614556..3614666,3631430..3631581,
FT                   3633455..3633510,3657652..3657949))
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), transcript variant mCT194445"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194445.0 created
FT                   on 10-JUN-2004"
FT   mRNA            complement(join(3480477..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503765,
FT                   3505576..3506104,3507430..3507546,3508611..3508803,
FT                   3509742..3510177,3514549..3514781,3521287..3521375,
FT                   3531768..3531895,3532939..3533051,3533615..3533752,
FT                   3533936..3534052,3537143..3537234,3537988..3538069,
FT                   3538236..3538406,3542280..3542474,3543487..3543666,
FT                   3544597..3544734,3544903..3545016,3545910..3546068,
FT                   3547355..3547567,3547675..3547767,3548003..3548122,
FT                   3549270..3549401,3556945..3558453))
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), transcript variant mCT124684"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT124684.2 created
FT                   on 10-JUN-2004"
FT   assembly_gap    3481331..3481350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(3481453..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503765,
FT                   3505576..3506104,3507430..3507546,3508611..3508803,
FT                   3509742..3510177,3514549..3514781,3521287..3521375,
FT                   3531768..3531895,3532939..3533051,3533615..3533752,
FT                   3533936..3534052,3537143..3537234,3537988..3538069,
FT                   3538236..3538406,3542280..3542474,3543487..3543666,
FT                   3544597..3544734,3544903..3545016,3545910..3546068,
FT                   3547355..3547567,3547675..3547767,3548003..3548122,
FT                   3549270..3549401,3583096..3583213,3583502..3583677,
FT                   3583842..3583965,3587089..3587165,3614556..3614666,
FT                   3631430..3631581,3633455..3633510,3678289..3678470))
FT                   /codon_start=1
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), isoform CRA_a"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT12433.3
FT                   protein_id=mCP12596.3 isoform=CRA_a partial"
FT                   /db_xref="GOA:G3X9L9"
FT                   /db_xref="InterPro:IPR010630"
FT                   /db_xref="InterPro:IPR012943"
FT                   /db_xref="MGI:MGI:1891434"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9L9"
FT                   /protein_id="EDL38942.1"
FT   CDS             complement(join(3481453..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503650,
FT                   3503655..3503729,3503732..3503765,3505576..3506104,
FT                   3507430..3507546,3508611..3508803,3509742..3510177,
FT                   3514549..3514781,3521287..3521375,3531768..3531895,
FT                   3532939..3533051,3533615..3533752,3533936..3534052,
FT                   3537143..3537234,3537988..3538069,3538236..3538406,
FT                   3542280..3542474,3543487..3543666,3544597..3544734,
FT                   3544903..3545016,3545910..3546068,3547355..3547567,
FT                   3547675..3547767,3548003..3548122,3549270..3549401,
FT                   3583096..3583213,3583502..3583677,3583842..3583965,
FT                   3587089..3587165,3614556..3614666,3631430..3631581,
FT                   3633455..3633510,3657652..3657671))
FT                   /codon_start=1
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), isoform CRA_c"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194445.0
FT                   protein_id=mCP115476.0 isoform=CRA_c partial"
FT                   /protein_id="EDL38944.1"
FT                   AL"
FT   CDS             complement(join(3481453..3481494,3482962..3483008,
FT                   3483237..3483375,3484577..3484720,3485533..3485759,
FT                   3486520..3486639,3487631..3487855,3489667..3489791,
FT                   3490353..3490542,3492116..3492235,3492794..3492925,
FT                   3493725..3493976,3497334..3497519,3499944..3500096,
FT                   3500683..3500906,3501859..3501910,3503530..3503765,
FT                   3505576..3506104,3507430..3507546,3508611..3508803,
FT                   3509742..3510177,3514549..3514781,3521287..3521375,
FT                   3531768..3531895,3532939..3533051,3533615..3533752,
FT                   3533936..3534052,3537143..3537234,3537988..3538069,
FT                   3538236..3538406,3542280..3542474,3543487..3543666,
FT                   3544597..3544734,3544903..3545016,3545910..3546068,
FT                   3547355..3547567,3547675..3547767,3548003..3548122,
FT                   3549270..3549401,3556945..3558069))
FT                   /codon_start=1
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), isoform CRA_b"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT124684.2
FT                   protein_id=mCP78141.2 isoform=CRA_b partial"
FT                   /protein_id="EDL38943.1"
FT   assembly_gap    3488758..3488777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3494961..3495139
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    3528737..3528756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3529082..3531895,3532939..3533051,
FT                   3533615..3533752,3533936..3534052,3537143..3537234,
FT                   3537988..3538069,3538236..3538406,3542280..3542474,
FT                   3543487..3543666,3544597..3544734,3544903..3545016,
FT                   3545910..3546068,3547355..3547567,3547675..3547767,
FT                   3548003..3548122,3549270..3549401,3556945..3558453))
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), transcript variant mCT194446"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194446.0 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(3531721..3531895,3532939..3533051,
FT                   3533615..3533752,3533936..3534052,3537143..3537234,
FT                   3537988..3538069,3538236..3538406,3542280..3542474,
FT                   3543487..3543666,3544597..3544734,3544903..3545016,
FT                   3545910..3546068,3547355..3547567,3547675..3547767,
FT                   3548003..3548122,3549270..3549401,3556945..3558069))
FT                   /codon_start=1
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), isoform CRA_d"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194446.0
FT                   protein_id=mCP115474.0 isoform=CRA_d"
FT                   /protein_id="EDL38945.1"
FT                   ESVQARHKHAF"
FT   assembly_gap    3534460..3534479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3562199..3562287
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    3566412..3566470
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    3567987..3568006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3575805..3576030
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    3581553..3581641
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3611323..3614666,3631430..3631581,
FT                   3633455..3633510,3657652..3657949))
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), transcript variant mCT194447"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194447.0 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(3614502..3614666,3631430..3631581,
FT                   3633455..3633510,3657652..3657671))
FT                   /codon_start=1
FT                   /gene="Pde4dip"
FT                   /locus_tag="mCG_11103"
FT                   /product="phosphodiesterase 4D interacting protein
FT                   (myomegalin), isoform CRA_e"
FT                   /note="gene_id=mCG11103.2 transcript_id=mCT194447.0
FT                   protein_id=mCP115475.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8BKQ2"
FT                   /db_xref="InterPro:IPR012943"
FT                   /db_xref="MGI:MGI:1891434"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKQ2"
FT                   /protein_id="EDL38946.1"
FT   assembly_gap    3622633..3622652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3624020..3624135
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    3628318..3628337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3651541..3651560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3670088..3670167
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3677534..3677553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3682030..3690900)
FT                   /locus_tag="mCG_148357"
FT                   /note="gene_id=mCG148357.0"
FT   mRNA            complement(join(3682030..3683480,3690839..3690900))
FT                   /locus_tag="mCG_148357"
FT                   /product="mCG148357"
FT                   /note="gene_id=mCG148357.0 transcript_id=mCT188620.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3682536..3682730)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148357"
FT                   /product="mCG148357"
FT                   /note="gene_id=mCG148357.0 transcript_id=mCT188620.0
FT                   protein_id=mCP109730.0"
FT                   /protein_id="EDL38947.1"
FT   gene            3691023..3711701
FT                   /gene="Sec22b"
FT                   /locus_tag="mCG_11106"
FT                   /note="gene_id=mCG11106.2"
FT   mRNA            join(3691023..3691230,3697031..3697140,3702389..3702549,
FT                   3704310..3704456,3710926..3711701)
FT                   /gene="Sec22b"
FT                   /locus_tag="mCG_11106"
FT                   /product="SEC22 vesicle trafficking protein homolog B (S.
FT                   cerevisiae), transcript variant mCT12434"
FT                   /note="gene_id=mCG11106.2 transcript_id=mCT12434.1 created
FT                   on 06-JUN-2002"
FT   mRNA            join(<3691024..3691230,3697035..3697140,3702389..3702549,
FT                   3704310..3704456,3710926..3711661)
FT                   /gene="Sec22b"
FT                   /locus_tag="mCG_11106"
FT                   /product="SEC22 vesicle trafficking protein homolog B (S.
FT                   cerevisiae), transcript variant mCT193749"
FT                   /note="gene_id=mCG11106.2 transcript_id=mCT193749.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3691128..3691230,3697035..3697140,3702389..3702549,
FT                   3704310..3704456,3710926..3711080)
FT                   /codon_start=1
FT                   /gene="Sec22b"
FT                   /locus_tag="mCG_11106"
FT                   /product="SEC22 vesicle trafficking protein homolog B (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG11106.2 transcript_id=mCT193749.0
FT                   protein_id=mCP114679.0 isoform=CRA_b"
FT                   /protein_id="EDL38949.1"
FT                   L"
FT   CDS             join(3691156..3691230,3697031..3697140,3702389..3702549,
FT                   3704310..3704456,3710926..3711080)
FT                   /codon_start=1
FT                   /gene="Sec22b"
FT                   /locus_tag="mCG_11106"
FT                   /product="SEC22 vesicle trafficking protein homolog B (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG11106.2 transcript_id=mCT12434.1
FT                   protein_id=mCP12572.1 isoform=CRA_a"
FT                   /protein_id="EDL38948.1"
FT   assembly_gap    3726693..3726741
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3740494..3741342
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    3777511..3777530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3778827..3778848
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            3803313..3939004
FT                   /gene="Notch2"
FT                   /locus_tag="mCG_11101"
FT                   /note="gene_id=mCG11101.2"
FT   mRNA            join(3803313..3803547,3837488..3837569,3860624..3860883,
FT                   3862351..3862686,3871681..3871803,3887850..3888083,
FT                   3889178..3889333,3889954..3890142,3891275..3891388,
FT                   3892080..3892193,3894103..3894336,3896801..3896911,
FT                   3901304..3901496,3902764..3902909,3904999..3905112,
FT                   3906468..3906587,3906960..3907112,3910494..3910722,
FT                   3911671..3911872,3913512..3913665,3913916..3914100,
FT                   3915829..3915961,3921150..3921386,3924511..3924623,
FT                   3925278..3925783,3927227..3927580,3928338..3928480,
FT                   3928594..3928804,3929538..3929634,3931323..3931488,
FT                   3932752..3933053,3934221..3934368,3934981..3935078,
FT                   3935912..3939004)
FT                   /gene="Notch2"
FT                   /locus_tag="mCG_11101"
FT                   /product="Notch gene homolog 2 (Drosophila), transcript
FT                   variant mCT12432"
FT                   /note="gene_id=mCG11101.2 transcript_id=mCT12432.2 created
FT                   on 06-JUN-2002"
FT   mRNA            join(3803365..3803547,3837488..3837569,3860624..3860883,
FT                   3862351..3862686,3871681..3872533)
FT                   /gene="Notch2"
FT                   /locus_tag="mCG_11101"
FT                   /product="Notch gene homolog 2 (Drosophila), transcript
FT                   variant mCT169789"
FT                   /note="gene_id=mCG11101.2 transcript_id=mCT169789.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(3803475..3803547,3837488..3837569,3860624..3860883,
FT                   3862351..3862686,3871681..3871803,3887850..3888083,
FT                   3889178..3889333,3889954..3890142,3891275..3891388,
FT                   3892080..3892193,3894103..3894336,3896801..3896911,
FT                   3901304..3901496,3902764..3902909,3904999..3905112,
FT                   3906468..3906587,3906960..3907112,3910494..3910722,
FT                   3911671..3911872,3913512..3913665,3913916..3914100,
FT                   3915829..3915961,3921150..3921386,3924511..3924623,
FT                   3925278..3925783,3927227..3927580,3928338..3928480,
FT                   3928594..3928804,3929538..3929634,3931323..3931488,
FT                   3932752..3933053,3934221..3934368,3934981..3935078,
FT                   3935912..3937303)
FT                   /codon_start=1
FT                   /gene="Notch2"
FT                   /locus_tag="mCG_11101"
FT                   /product="Notch gene homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG11101.2 transcript_id=mCT12432.2
FT                   protein_id=mCP12576.2 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8J0"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000800"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008297"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR010660"
FT                   /db_xref="InterPro:IPR011656"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR022336"
FT                   /db_xref="InterPro:IPR024600"
FT                   /db_xref="InterPro:IPR035993"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="MGI:MGI:97364"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J0"
FT                   /protein_id="EDL38950.1"
FT                   PHSNMQVYA"
FT   CDS             join(3803475..3803547,3837488..3837569,3860624..3860883,
FT                   3862351..3862686,3871681..3871904)
FT                   /codon_start=1
FT                   /gene="Notch2"
FT                   /locus_tag="mCG_11101"
FT                   /product="Notch gene homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG11101.2 transcript_id=mCT169789.0
FT                   protein_id=mCP92882.0 isoform=CRA_b"
FT                   /protein_id="EDL38951.1"
FT   assembly_gap    3819143..3819162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3829295..3829314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3884464..3884483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3904250..3904316
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3915277..3915296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3917729..3917985
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    3946005..3946170
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            3950657..3954198
FT                   /gene="Adam30"
FT                   /locus_tag="mCG_11099"
FT                   /note="gene_id=mCG11099.2"
FT   mRNA            join(3950657..3950679,3951080..3954198)
FT                   /gene="Adam30"
FT                   /locus_tag="mCG_11099"
FT                   /product="a disintegrin and metallopeptidase domain 30,
FT                   transcript variant mCT169787"
FT                   /note="gene_id=mCG11099.2 transcript_id=mCT169787.0 created
FT                   on 06-JUN-2002"
FT   mRNA            <3950882..3954198
FT                   /gene="Adam30"
FT                   /locus_tag="mCG_11099"
FT                   /product="a disintegrin and metallopeptidase domain 30,
FT                   transcript variant mCT12431"
FT                   /note="gene_id=mCG11099.2 transcript_id=mCT12431.2 created
FT                   on 06-JUN-2002"
FT   CDS             3950882..3953080
FT                   /codon_start=1
FT                   /gene="Adam30"
FT                   /locus_tag="mCG_11099"
FT                   /product="a disintegrin and metallopeptidase domain 30,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11099.2 transcript_id=mCT12431.2
FT                   protein_id=mCP12591.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q811Q3"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="MGI:MGI:1918328"
FT                   /db_xref="UniProtKB/TrEMBL:Q811Q3"
FT                   /protein_id="EDL38952.1"
FT   CDS             3951266..3953080
FT                   /codon_start=1
FT                   /gene="Adam30"
FT                   /locus_tag="mCG_11099"
FT                   /product="a disintegrin and metallopeptidase domain 30,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11099.2 transcript_id=mCT169787.0
FT                   protein_id=mCP92854.0 isoform=CRA_b"
FT                   /protein_id="EDL38953.1"
FT   gene            complement(3979958..3981101)
FT                   /pseudo
FT                   /locus_tag="mCG_51401"
FT                   /note="gene_id=mCG51401.2"
FT   mRNA            complement(3979958..3981101)
FT                   /pseudo
FT                   /locus_tag="mCG_51401"
FT                   /note="gene_id=mCG51401.2 transcript_id=mCT51584.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    3985050..3985332
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    3990276..3990373
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    3992204..3992385
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    3996062..3996240
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    4004937..4004956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4006669..4006749
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            4012181..4026792
FT                   /gene="Reg4"
FT                   /locus_tag="mCG_11108"
FT                   /note="gene_id=mCG11108.1"
FT   mRNA            join(4012181..4012230,4014685..4014868,4019818..4019912,
FT                   4021182..4021319,4023039..4023144,4026346..4026792)
FT                   /gene="Reg4"
FT                   /locus_tag="mCG_11108"
FT                   /product="regenerating islet-derived family, member 4"
FT                   /note="gene_id=mCG11108.1 transcript_id=mCT12440.1 created
FT                   on 06-JUN-2002"
FT   CDS             join(4014802..4014868,4019818..4019912,4021182..4021319,
FT                   4023039..4023144,4026346..4026413)
FT                   /codon_start=1
FT                   /gene="Reg4"
FT                   /locus_tag="mCG_11108"
FT                   /product="regenerating islet-derived family, member 4"
FT                   /note="gene_id=mCG11108.1 transcript_id=mCT12440.1
FT                   protein_id=mCP12577.1"
FT                   /protein_id="EDL38954.1"
FT   assembly_gap    4031930..4031949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4035938..4035957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4063423..4063442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4070370..4100672
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /note="gene_id=mCG11100.2"
FT   mRNA            join(4070370..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093219,
FT                   4098969..4098998,4099759..4100671)
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   transcript variant mCT169788"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT169788.0 created
FT                   on 06-JUN-2002"
FT   mRNA            join(4070372..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093219,
FT                   4098969..4100672)
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   transcript variant mCT12435"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT12435.1 created
FT                   on 06-JUN-2002"
FT   mRNA            join(<4070373..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093215,
FT                   4098969..4100671)
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   transcript variant mCT193740"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT193740.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4070374..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093215,
FT                   4098969..4098998,4099759..4100671)
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   transcript variant mCT193741"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT193741.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4070375..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093210)
FT                   /codon_start=1
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT193740.0
FT                   protein_id=mCP114677.0 isoform=CRA_b"
FT                   /protein_id="EDL38956.1"
FT                   KYARCPV"
FT   CDS             join(<4070375..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093210)
FT                   /codon_start=1
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT193741.0
FT                   protein_id=mCP114678.0 isoform=CRA_b"
FT                   /protein_id="EDL38957.1"
FT                   KYARCPV"
FT   CDS             join(4070423..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093210)
FT                   /codon_start=1
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT169788.0
FT                   protein_id=mCP92853.0 isoform=CRA_a"
FT                   /protein_id="EDL38955.1"
FT   CDS             join(4070423..4070526,4080826..4081280,4086075..4086200,
FT                   4086909..4087073,4087317..4087482,4089059..4089229,
FT                   4091512..4091618,4092561..4092686,4093104..4093210)
FT                   /codon_start=1
FT                   /gene="Hmgcs2"
FT                   /locus_tag="mCG_11100"
FT                   /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11100.2 transcript_id=mCT12435.1
FT                   protein_id=mCP12592.1 isoform=CRA_a"
FT                   /protein_id="EDL38958.1"
FT   gene            complement(4103105..4129488)
FT                   /locus_tag="mCG_11110"
FT                   /note="gene_id=mCG11110.2"
FT   mRNA            complement(join(4103105..4103396,4104103..4104340,
FT                   4104999..4105129,4106340..4106472,4109554..4109706,
FT                   4110580..4110728,4111147..4111279,4117540..4117638,
FT                   4117782..4117836,4122728..4122793,4123989..4124140,
FT                   4129178..4129488))
FT                   /locus_tag="mCG_11110"
FT                   /product="mCG11110"
FT                   /note="gene_id=mCG11110.2 transcript_id=mCT12442.2 created
FT                   on 06-DEC-2004"
FT   CDS             complement(join(4103242..4103396,4104103..4104340,
FT                   4104999..4105129,4106340..4106472,4109554..4109706,
FT                   4110580..4110728,4111147..4111279,4117540..4117638,
FT                   4117782..4117836,4122728..4122793,4123989..4124140,
FT                   4129178..4129315))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11110"
FT                   /product="mCG11110"
FT                   /note="gene_id=mCG11110.2 transcript_id=mCT12442.2
FT                   protein_id=mCP12585.2"
FT                   /protein_id="EDL38959.1"
FT                   LETWKQHVLEAFQFCF"
FT   assembly_gap    4129795..4129911
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    4148216..4148243
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    4152562..4152581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4172034..4220933
FT                   /gene="Zfp697"
FT                   /locus_tag="mCG_1041496"
FT                   /note="gene_id=mCG1041496.1"
FT   mRNA            join(4172034..4172133,4214206..4214483,4216145..4220933)
FT                   /gene="Zfp697"
FT                   /locus_tag="mCG_1041496"
FT                   /product="zinc finger protein 697, transcript variant
FT                   mCT159200"
FT                   /note="gene_id=mCG1041496.1 transcript_id=mCT159200.1
FT                   created on 11-JUN-2003"
FT   mRNA            join(4172034..4172133,4199111..>4199697)
FT                   /gene="Zfp697"
FT                   /locus_tag="mCG_1041496"
FT                   /product="zinc finger protein 697, transcript variant
FT                   mCT185531"
FT                   /note="gene_id=mCG1041496.1 transcript_id=mCT185531.0
FT                   created on 11-JUN-2003"
FT   assembly_gap    4177787..4177806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4182666..4182760
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4186776..4191576
FT                   /estimated_length=4801
FT                   /gap_type="unknown"
FT   assembly_gap    4195091..4195702
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   CDS             4199342..>4199697
FT                   /codon_start=1
FT                   /gene="Zfp697"
FT                   /locus_tag="mCG_1041496"
FT                   /product="zinc finger protein 697, isoform CRA_b"
FT                   /note="gene_id=mCG1041496.1 transcript_id=mCT185531.0
FT                   protein_id=mCP106789.0 isoform=CRA_b"
FT                   /protein_id="EDL38961.1"
FT                   SSGCPQWPCVLTEL"
FT   assembly_gap    4210871..4210909
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   CDS             join(4214243..4214483,4216145..4217613)
FT                   /codon_start=1
FT                   /gene="Zfp697"
FT                   /locus_tag="mCG_1041496"
FT                   /product="zinc finger protein 697, isoform CRA_a"
FT                   /note="gene_id=mCG1041496.1 transcript_id=mCT159200.1
FT                   protein_id=mCP78277.1 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8C0"
FT                   /db_xref="InterPro:IPR009017"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:2139736"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8C0"
FT                   /protein_id="EDL38960.1"
FT   assembly_gap    4223435..4223458
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            complement(<4230442..4246034)
FT                   /locus_tag="mCG_119545"
FT                   /note="gene_id=mCG119545.0"
FT   mRNA            complement(join(<4230442..4230487,4239334..4239498,
FT                   4245332..4245528,4245962..4246034))
FT                   /locus_tag="mCG_119545"
FT                   /product="mCG119545, transcript variant mCT120720"
FT                   /note="gene_id=mCG119545.0 transcript_id=mCT120720.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(<4230442..4230487,4239334..4239498,
FT                   4245332..4245476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119545"
FT                   /product="mCG119545, isoform CRA_b"
FT                   /note="gene_id=mCG119545.0 transcript_id=mCT120720.1
FT                   protein_id=mCP78249.1 isoform=CRA_b"
FT                   /protein_id="EDL38963.1"
FT                   ASLPFGIPQVRILC"
FT   assembly_gap    4233716..4237389
FT                   /estimated_length=3674
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4244982..4245528,4245962..4246034))
FT                   /locus_tag="mCG_119545"
FT                   /product="mCG119545, transcript variant mCT169791"
FT                   /note="gene_id=mCG119545.0 transcript_id=mCT169791.0
FT                   created on 06-JUN-2002"
FT   CDS             complement(4245324..4245476)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119545"
FT                   /product="mCG119545, isoform CRA_a"
FT                   /note="gene_id=mCG119545.0 transcript_id=mCT169791.0
FT                   protein_id=mCP92887.0 isoform=CRA_a"
FT                   /protein_id="EDL38962.1"
FT                   ELSSK"
FT   assembly_gap    4251870..4294079
FT                   /estimated_length=42210
FT                   /gap_type="unknown"
FT   assembly_gap    4297302..4303377
FT                   /estimated_length=6076
FT                   /gap_type="unknown"
FT   assembly_gap    4305015..4305056
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            complement(4307655..4308708)
FT                   /pseudo
FT                   /locus_tag="mCG_140551"
FT                   /note="gene_id=mCG140551.0"
FT   mRNA            complement(4307655..4308708)
FT                   /pseudo
FT                   /locus_tag="mCG_140551"
FT                   /note="gene_id=mCG140551.0 transcript_id=mCT170005.0
FT                   created on 06-JUN-2002"
FT   gene            complement(4309392..4316460)
FT                   /pseudo
FT                   /locus_tag="mCG_140552"
FT                   /note="gene_id=mCG140552.0"
FT   mRNA            complement(join(4309392..4310191,4312450..4312572,
FT                   4316391..4316460))
FT                   /pseudo
FT                   /locus_tag="mCG_140552"
FT                   /note="gene_id=mCG140552.0 transcript_id=mCT170006.0
FT                   created on 06-JUN-2002"
FT   assembly_gap    4333934..4334186
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    4342249..4342331
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            complement(4346137..4372485)
FT                   /locus_tag="mCG_20398"
FT                   /note="gene_id=mCG20398.1"
FT   mRNA            complement(join(4346137..4347319,4349503..4349667,
FT                   4357547..4357743,4372457..4372485))
FT                   /locus_tag="mCG_20398"
FT                   /product="mCG20398"
FT                   /note="gene_id=mCG20398.1 transcript_id=mCT20724.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(4346508..4347319,4349503..4349667,
FT                   4357547..4357691))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20398"
FT                   /product="mCG20398"
FT                   /note="gene_id=mCG20398.1 transcript_id=mCT20724.1
FT                   protein_id=mCP7463.2"
FT                   /protein_id="EDL38964.1"
FT   assembly_gap    4364364..4368982
FT                   /estimated_length=4619
FT                   /gap_type="unknown"
FT   assembly_gap    4386796..4388049
FT                   /estimated_length=1254
FT                   /gap_type="unknown"
FT   gene            complement(4397384..4405770)
FT                   /pseudo
FT                   /locus_tag="mCG_140553"
FT                   /note="gene_id=mCG140553.0"
FT   mRNA            complement(join(4397384..4397671,4400067..4400235,
FT                   4405625..4405770))
FT                   /pseudo
FT                   /locus_tag="mCG_140553"
FT                   /note="gene_id=mCG140553.0 transcript_id=mCT170010.0
FT                   created on 06-JUN-2002"
FT   assembly_gap    4400299..4400318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4404467..4404654
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            complement(4408348..4415645)
FT                   /pseudo
FT                   /locus_tag="mCG_50963"
FT                   /note="gene_id=mCG50963.2"
FT   mRNA            complement(join(4408348..4409036,4411413..4411610,
FT                   4415497..4415645))
FT                   /pseudo
FT                   /locus_tag="mCG_50963"
FT                   /note="gene_id=mCG50963.2 transcript_id=mCT51146.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    4428407..4428436
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(4438372..4451825)
FT                   /locus_tag="mCG_119535"
FT                   /note="gene_id=mCG119535.0"
FT   mRNA            complement(join(4438372..4439581,4440692..4440856,
FT                   4443684..4443894,4446932..4447013,4451105..4451164,
FT                   4451743..4451825))
FT                   /locus_tag="mCG_119535"
FT                   /product="mCG119535, transcript variant mCT120718"
FT                   /note="gene_id=mCG119535.0 transcript_id=mCT120718.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(4438372..4439581,4440692..4440856,
FT                   4443684..4443894,4446932..4447056,4451105..4451164,
FT                   4451743..4451825))
FT                   /locus_tag="mCG_119535"
FT                   /product="mCG119535, transcript variant mCT120715"
FT                   /note="gene_id=mCG119535.0 transcript_id=mCT120715.1
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(4438770..4439581,4440692..4440856,
FT                   4443684..4443828))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119535"
FT                   /product="mCG119535, isoform CRA_a"
FT                   /note="gene_id=mCG119535.0 transcript_id=mCT120715.1
FT                   protein_id=mCP78150.1 isoform=CRA_a"
FT                   /protein_id="EDL38965.1"
FT   CDS             complement(join(4438770..4439581,4440692..4440856,
FT                   4443684..4443828))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119535"
FT                   /product="mCG119535, isoform CRA_a"
FT                   /note="gene_id=mCG119535.0 transcript_id=mCT120718.0
FT                   protein_id=mCP78159.1 isoform=CRA_a"
FT                   /protein_id="EDL38966.1"
FT   assembly_gap    4454913..4459038
FT                   /estimated_length=4126
FT                   /gap_type="unknown"
FT   gene            complement(4468336..4490603)
FT                   /locus_tag="mCG_140534"
FT                   /note="gene_id=mCG140534.0"
FT   mRNA            complement(join(4468336..4469511,4470639..4470803,
FT                   4480129..4480281,4489122..4489181,4490546..4490603))
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, transcript variant mCT169950"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169950.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(4468336..4469511,4470639..4470803,
FT                   4480129..4480281,4489122..4489181,4489839..4489907))
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, transcript variant mCT169951"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169951.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(4468337..4469511,4470639..4470803,
FT                   4480129..4480281,4489839..4489899))
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, transcript variant mCT169949"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169949.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(4468340..4469511,4470639..4470803,
FT                   4480129..4480281,4490546..>4490588))
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, transcript variant mCT193739"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT193739.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4468700..4469511,4470639..4470803,
FT                   4480129..4480281,4490546..>4490588))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, isoform CRA_b"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT193739.0
FT                   protein_id=mCP114697.0 isoform=CRA_b"
FT                   /protein_id="EDL38970.1"
FT   CDS             complement(join(4468700..4469511,4470639..4470803,
FT                   4480129..4480273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, isoform CRA_a"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169949.0
FT                   protein_id=mCP92892.0 isoform=CRA_a"
FT                   /protein_id="EDL38967.1"
FT   CDS             complement(join(4468700..4469511,4470639..4470803,
FT                   4480129..4480273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, isoform CRA_a"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169950.0
FT                   protein_id=mCP92902.0 isoform=CRA_a"
FT                   /protein_id="EDL38968.1"
FT   CDS             complement(join(4468700..4469511,4470639..4470803,
FT                   4480129..4480273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140534"
FT                   /product="mCG140534, isoform CRA_a"
FT                   /note="gene_id=mCG140534.0 transcript_id=mCT169951.0
FT                   protein_id=mCP92850.0 isoform=CRA_a"
FT                   /protein_id="EDL38969.1"
FT   assembly_gap    4505366..4505385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4506527..4506546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4508021..4508410
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    4510849..4510868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4517510..4517752
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    4519273..4519849
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   gene            complement(4530885..4539797)
FT                   /locus_tag="mCG_19918"
FT                   /note="gene_id=mCG19918.2"
FT   mRNA            complement(join(4530885..4532051,4533145..4533309,
FT                   4536284..4536490,4539564..4539797))
FT                   /locus_tag="mCG_19918"
FT                   /product="mCG19918"
FT                   /note="gene_id=mCG19918.2 transcript_id=mCT17279.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(4531240..4532051,4533145..4533309,
FT                   4536284..4536428))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19918"
FT                   /product="mCG19918"
FT                   /note="gene_id=mCG19918.2 transcript_id=mCT17279.2
FT                   protein_id=mCP3015.2"
FT                   /db_xref="GOA:O35469"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:109598"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35469"
FT                   /protein_id="EDL38971.1"
FT   assembly_gap    4533751..4533770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4546319..4547915
FT                   /pseudo
FT                   /locus_tag="mCG_19919"
FT                   /note="gene_id=mCG19919.1"
FT   mRNA            4546319..4547915
FT                   /pseudo
FT                   /locus_tag="mCG_19919"
FT                   /note="gene_id=mCG19919.1 transcript_id=mCT17280.1 created
FT                   on 06-JUN-2002"
FT   assembly_gap    4558690..4558709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4560478..4560497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4572329..4572348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4573421..4573440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4578824..4586427)
FT                   /locus_tag="mCG_19920"
FT                   /note="gene_id=mCG19920.2"
FT   mRNA            complement(join(4578824..4579992,4582623..4582787,
FT                   4584449..4584655,4584781..4584970,4586304..4586427))
FT                   /locus_tag="mCG_19920"
FT                   /product="mCG19920"
FT                   /note="gene_id=mCG19920.2 transcript_id=mCT17281.2 created
FT                   on 29-NOV-2004"
FT   CDS             complement(join(4579181..4579992,4582623..4582787,
FT                   4584449..4584593))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19920"
FT                   /product="mCG19920"
FT                   /note="gene_id=mCG19920.2 transcript_id=mCT17281.2
FT                   protein_id=mCP2991.2"
FT                   /db_xref="GOA:Q3UI20"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:96233"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UI20"
FT                   /protein_id="EDL38972.1"
FT   assembly_gap    4590439..4592982
FT                   /estimated_length=2544
FT                   /gap_type="unknown"
FT   assembly_gap    4597875..4597894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4601133..4619789)
FT                   /gene="Hao3"
FT                   /locus_tag="mCG_19913"
FT                   /note="gene_id=mCG19913.2"
FT   mRNA            complement(join(4601133..4601914,4603266..4603335,
FT                   4603652..4603810,4606865..4607074,4608328..4608611,
FT                   4610093..4610244,4611220..4611358,4612126..4612229,
FT                   4619716..4619789))
FT                   /gene="Hao3"
FT                   /locus_tag="mCG_19913"
FT                   /product="hydroxyacid oxidase (glycolate oxidase) 3"
FT                   /note="gene_id=mCG19913.2 transcript_id=mCT17275.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(4601859..4601914,4603266..4603335,
FT                   4603652..4603810,4606865..4607074,4608328..4608611,
FT                   4610093..4610244,4611220..4611350))
FT                   /codon_start=1
FT                   /gene="Hao3"
FT                   /locus_tag="mCG_19913"
FT                   /product="hydroxyacid oxidase (glycolate oxidase) 3"
FT                   /note="gene_id=mCG19913.2 transcript_id=mCT17275.2
FT                   protein_id=mCP2995.2"
FT                   /protein_id="EDL38973.1"
FT                   AEISPDLIQFSRL"
FT   assembly_gap    4617440..4617732
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    4643916..4644756
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    4657025..4657057
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(<4662675..>4668303)
FT                   /locus_tag="mCG_1041499"
FT                   /note="gene_id=mCG1041499.1"
FT   mRNA            complement(join(<4662675..4662878,4664674..4664773,
FT                   4668140..>4668303))
FT                   /locus_tag="mCG_1041499"
FT                   /product="mCG1041499"
FT                   /note="gene_id=mCG1041499.1 transcript_id=mCT159203.1
FT                   created on 26-MAR-2003"
FT   CDS             complement(<4662675..>4662871)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041499"
FT                   /product="mCG1041499"
FT                   /note="gene_id=mCG1041499.1 transcript_id=mCT159203.1
FT                   protein_id=mCP78282.1"
FT                   /protein_id="EDL38974.1"
FT   assembly_gap    4670309..4671548
FT                   /estimated_length=1240
FT                   /gap_type="unknown"
FT   assembly_gap    4712628..4712647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4714723..4714979
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    4728135..4729816
FT                   /estimated_length=1682
FT                   /gap_type="unknown"
FT   assembly_gap    4731436..4731455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4734008..4734027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4756664..4757958
FT                   /estimated_length=1295
FT                   /gap_type="unknown"
FT   assembly_gap    4762770..4762789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4769689..4769749
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    4770972..4772125
FT                   /estimated_length=1154
FT                   /gap_type="unknown"
FT   gene            4773458..4777380
FT                   /locus_tag="mCG_1041531"
FT                   /note="gene_id=mCG1041531.1"
FT   mRNA            join(4773458..4773519,4775904..4776631,4776817..4776883,
FT                   4777167..4777380)
FT                   /locus_tag="mCG_1041531"
FT                   /product="mCG1041531"
FT                   /note="gene_id=mCG1041531.1 transcript_id=mCT159235.1
FT                   created on 06-JUN-2002"
FT   CDS             join(4776558..4776631,4776817..4776847)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041531"
FT                   /product="mCG1041531"
FT                   /note="gene_id=mCG1041531.1 transcript_id=mCT159235.1
FT                   protein_id=mCP78125.1"
FT                   /protein_id="EDL38975.1"
FT   assembly_gap    4778511..4778580
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    4779591..4779610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4781076..4781095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4782184..4782203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4784103..4784122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4785279..4785298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4790593..4790612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4792139..4792798
FT                   /estimated_length=660
FT                   /gap_type="unknown"
CO   join(AAHY01029197.1:1..5116,gap(87),AAHY01029198.1:1..7521,gap(1817),
CO   complement(AAHY01029199.1:1..1325),gap(3913),AAHY01029200.1:1..2326,
CO   gap(20),AAHY01029201.1:1..15904,gap(2846),AAHY01029202.1:1..5643,gap(5043),
CO   AAHY01029203.1:1..24467,gap(8651),AAHY01029204.1:1..28007,gap(20),
CO   complement(AAHY01029205.1:1..1272),gap(302),
CO   complement(AAHY01029206.1:1..6429),gap(2029),AAHY01029207.1:1..959,
CO   gap(2408),AAHY01029208.1:1..7906,gap(292),AAHY01029209.1:1..34130,gap(187),
CO   AAHY01029210.1:1..51480,gap(375),complement(AAHY01029211.1:1..4600),
CO   gap(100),AAHY01029212.1:1..4963,gap(154),
CO   complement(AAHY01029213.1:1..44994),gap(195),AAHY01029214.1:1..11530,
CO   gap(125),AAHY01029215.1:1..2012,gap(23),AAHY01029216.1:1..23212,gap(106),
CO   AAHY01029217.1:1..2976,gap(20),complement(AAHY01029218.1:1..54068),
CO   gap(144),complement(AAHY01029219.1:1..6355),gap(20),
CO   AAHY01029220.1:1..42896,gap(92),complement(AAHY01029221.1:1..1595),gap(20),
CO   AAHY01029222.1:1..26600,gap(60),AAHY01029223.1:1..21322,gap(892),
CO   AAHY01029224.1:1..2023,gap(2310),AAHY01029225.1:1..3357,gap(20),
CO   AAHY01029226.1:1..3956,gap(2740),AAHY01029227.1:1..2824,gap(565),
CO   AAHY01029228.1:1..3887,gap(196),AAHY01029229.1:1..38541,gap(20),
CO   AAHY01029230.1:1..4750,gap(20),AAHY01029231.1:1..1529,gap(20),
CO   AAHY01029232.1:1..1397,gap(1223),AAHY01029233.1:1..2700,gap(20),
CO   AAHY01029234.1:1..12324,gap(1458),AAHY01029235.1:1..8399,gap(24663),
CO   AAHY01029236.1:1..32120,gap(20),AAHY01029237.1:1..31076,gap(334),
CO   complement(AAHY01029238.1:1..7078),gap(511),AAHY01029239.1:1..64070,
CO   gap(26),AAHY01029240.1:1..10300,gap(20),AAHY01029241.1:1..16484,gap(20),
CO   AAHY01029242.1:1..5500,gap(233),AAHY01029243.1:1..141670,gap(109),
CO   AAHY01029244.1:1..73930,gap(104),complement(AAHY01029245.1:1..814),
CO   gap(121),AAHY01029246.1:1..2517,gap(20),AAHY01029247.1:1..38785,gap(20),
CO   AAHY01029248.1:1..6073,gap(20),complement(AAHY01029249.1:1..25101),
CO   gap(166),AAHY01029250.1:1..6180,gap(20),
CO   complement(AAHY01029251.1:1..26072),gap(20),
CO   complement(AAHY01029252.1:1..1555),gap(1706),
CO   complement(AAHY01029253.1:1..16075),gap(154),
CO   complement(AAHY01029254.1:1..5041),gap(138),AAHY01029255.1:1..51325,
CO   gap(293),AAHY01029256.1:1..33230,gap(3017),AAHY01029257.1:1..27726,gap(20),
CO   AAHY01029258.1:1..1074,gap(20),complement(AAHY01029259.1:1..1101),gap(210),
CO   AAHY01029260.1:1..141663,gap(42),AAHY01029261.1:1..2323,gap(20),
CO   AAHY01029262.1:1..80636,gap(20),AAHY01029263.1:1..35893,gap(65),
CO   AAHY01029264.1:1..16518,gap(149),complement(AAHY01029265.1:1..3915),
CO   gap(20),AAHY01029266.1:1..7964,gap(264),AAHY01029267.1:1..2664,gap(262),
CO   AAHY01029268.1:1..21345,gap(20),AAHY01029269.1:1..10547,gap(20),
CO   AAHY01029270.1:1..5885,gap(20),AAHY01029271.1:1..26650,gap(5813),
CO   AAHY01029272.1:1..4715,gap(20),AAHY01029273.1:1..63088,gap(355),
CO   AAHY01029274.1:1..4614,gap(1328),AAHY01029275.1:1..30699,gap(20),
CO   AAHY01029276.1:1..28989,gap(78),AAHY01029277.1:1..9918,gap(20),
CO   AAHY01029278.1:1..1235,gap(67),AAHY01029279.1:1..7276,gap(1244),
CO   AAHY01029280.1:1..1774,gap(20),AAHY01029281.1:1..1384,gap(598),
CO   AAHY01029282.1:1..1931,gap(219),AAHY01029283.1:1..17670,gap(20),
CO   AAHY01029284.1:1..21327,gap(20),AAHY01029285.1:1..35894,gap(20),
CO   AAHY01029286.1:1..2741,gap(118),AAHY01029287.1:1..21223,gap(20),
CO   AAHY01029288.1:1..2026,gap(20),AAHY01029289.1:1..75527,gap(20),
CO   AAHY01029290.1:1..45924,gap(20),AAHY01029291.1:1..38575,gap(450),
CO   complement(AAHY01029292.1:1..3239),gap(648),AAHY01029293.1:1..18241,
CO   gap(20),AAHY01029294.1:1..39803,gap(325),AAHY01029295.1:1..8864,gap(82),
CO   complement(AAHY01029296.1:1..15702),gap(20),
CO   complement(AAHY01029297.1:1..1353),gap(20),AAHY01029298.1:1..40565,
CO   gap(62225),complement(AAHY01029299.1:1..1270),gap(52),
CO   AAHY01029300.1:1..16302,gap(20),AAHY01029301.1:1..1606,gap(95),
CO   AAHY01029302.1:1..1062,gap(432),AAHY01029303.1:1..16715,gap(315),
CO   AAHY01029304.1:1..18400,gap(20),AAHY01029305.1:1..2004,gap(542),
CO   AAHY01029306.1:1..7632,gap(4449),AAHY01029307.1:1..1219,gap(1068),
CO   complement(AAHY01029308.1:1..13146),gap(20),AAHY01029309.1:1..11006,
CO   gap(2537),AAHY01029310.1:1..1235,gap(20),
CO   complement(AAHY01029311.1:1..1009),gap(20),AAHY01029312.1:1..1194,gap(20),
CO   AAHY01029313.1:1..9309,gap(143),AAHY01029314.1:1..5915,gap(20),
CO   complement(AAHY01029315.1:1..9919),gap(30),
CO   complement(AAHY01029316.1:1..29933),gap(117),
CO   complement(AAHY01029317.1:1..8341),gap(205),
CO   complement(AAHY01029318.1:1..8128),gap(20),
CO   complement(AAHY01029319.1:1..21094),gap(85),AAHY01029320.1:1..2016,
CO   gap(972),AAHY01029321.1:1..798,gap(139),
CO   complement(AAHY01029322.1:1..21321),gap(321),AAHY01029323.1:1..6989,
CO   gap(298),AAHY01029324.1:1..28030,gap(81),
CO   complement(AAHY01029325.1:1..7802),gap(20),
CO   complement(AAHY01029326.1:1..5823),gap(20),AAHY01029327.1:1..6895,gap(20),
CO   complement(AAHY01029328.1:1..2931),gap(20),AAHY01029329.1:1..13309,gap(20),
CO   complement(AAHY01029330.1:1..1225),gap(20),
CO   complement(AAHY01029331.1:1..26235),gap(319),AAHY01029332.1:1..16818,
CO   gap(20),AAHY01029333.1:1..7180,gap(691),complement(AAHY01029334.1:1..8603),
CO   gap(415),complement(AAHY01029335.1:1..1920),gap(422),
CO   AAHY01029336.1:1..2246,gap(20),complement(AAHY01029337.1:1..17745),gap(20),
CO   complement(AAHY01029338.1:1..7892),gap(20),
CO   complement(AAHY01029339.1:1..7310),gap(1499),
CO   complement(AAHY01029340.1:1..25249),gap(20),
CO   complement(AAHY01029341.1:1..24645),gap(1682),AAHY01029342.1:1..3642,
CO   gap(517),complement(AAHY01029343.1:1..5337),gap(20),
CO   complement(AAHY01029344.1:1..2155),gap(20),AAHY01029345.1:1..33197,gap(20),
CO   complement(AAHY01029346.1:1..13583),gap(20),AAHY01029347.1:1..33995,
CO   gap(20),complement(AAHY01029348.1:1..85578),gap(20),
CO   complement(AAHY01029349.1:1..6137),gap(24),
CO   complement(AAHY01029350.1:1..31364),gap(338),AAHY01029351.1:1..19250,
CO   gap(78),AAHY01029352.1:1..65719,gap(4054),AAHY01029353.1:1..7531,gap(20),
CO   complement(AAHY01029354.1:1..55265),gap(421),
CO   complement(AAHY01029355.1:1..15523),gap(829),AAHY01029356.1:1..35981,
CO   gap(319),complement(AAHY01029357.1:1..7049),gap(47),
CO   AAHY01029358.1:1..20297,gap(20),AAHY01029359.1:1..5900,gap(20),
CO   complement(AAHY01029360.1:1..5663),gap(20),AAHY01029361.1:1..4089,gap(350),
CO   AAHY01029362.1:1..8383,gap(21),complement(AAHY01029363.1:1..4731),gap(672),
CO   complement(AAHY01029364.1:1..20066),gap(20),AAHY01029365.1:1..24128,
CO   gap(156),AAHY01029366.1:1..21425,gap(39),complement(AAHY01029367.1:1..449),
CO   gap(163),AAHY01029368.1:1..31286,gap(283),AAHY01029369.1:1..18619,gap(20),
CO   AAHY01029370.1:1..6365,gap(20),AAHY01029371.1:1..20538,gap(20),
CO   AAHY01029372.1:1..11521,gap(56),complement(AAHY01029373.1:1..4319),gap(41),
CO   AAHY01029374.1:1..18072,gap(20),AAHY01029375.1:1..35661,gap(20),
CO   complement(AAHY01029376.1:1..9320),gap(111),AAHY01029377.1:1..11004,
CO   gap(345),AAHY01029378.1:1..64068,gap(20),
CO   complement(AAHY01029379.1:1..13512),gap(20),AAHY01029380.1:1..10065,
CO   gap(44),AAHY01029381.1:1..32985,gap(20),AAHY01029382.1:1..5818,gap(20),
CO   AAHY01029383.1:1..7407,gap(20),complement(AAHY01029384.1:1..6183),gap(179),
CO   AAHY01029385.1:1..33597,gap(20),complement(AAHY01029386.1:1..5703),gap(20),
CO   AAHY01029387.1:1..27719,gap(89),complement(AAHY01029388.1:1..4124),gap(59),
CO   AAHY01029389.1:1..1516,gap(20),AAHY01029390.1:1..7798,gap(226),
CO   AAHY01029391.1:1..5522,gap(89),AAHY01029392.1:1..40991,gap(20),
CO   AAHY01029393.1:1..1367,gap(116),AAHY01029394.1:1..4182,gap(20),
CO   AAHY01029395.1:1..23203,gap(20),AAHY01029396.1:1..18527,gap(80),
CO   complement(AAHY01029397.1:1..7366),gap(20),
CO   complement(AAHY01029398.1:1..49139),gap(49),AAHY01029399.1:1..13752,
CO   gap(849),AAHY01029400.1:1..36168,gap(20),AAHY01029401.1:1..1296,gap(22),
CO   complement(AAHY01029402.1:1..40294),gap(20),
CO   complement(AAHY01029403.1:1..10132),gap(20),
CO   complement(AAHY01029404.1:1..55149),gap(20),
CO   complement(AAHY01029405.1:1..19766),gap(67),AAHY01029406.1:1..10960,
CO   gap(20),complement(AAHY01029407.1:1..2432),gap(257),
CO   AAHY01029408.1:1..28019,gap(166),AAHY01029409.1:1..38879,gap(283),
CO   complement(AAHY01029410.1:1..4943),gap(98),
CO   complement(AAHY01029411.1:1..1830),gap(182),AAHY01029412.1:1..3676,
CO   gap(179),complement(AAHY01029413.1:1..8696),gap(20),AAHY01029414.1:1..1712,
CO   gap(81),complement(AAHY01029415.1:1..25180),gap(20),AAHY01029416.1:1..3988,
CO   gap(20),AAHY01029417.1:1..27465,gap(20),AAHY01029418.1:1..66352,gap(117),
CO   AAHY01029419.1:1..18304,gap(28),complement(AAHY01029420.1:1..4318),gap(20),
CO   complement(AAHY01029421.1:1..25205),gap(20),AAHY01029422.1:1..4859,gap(95),
CO   AAHY01029423.1:1..4015,gap(4801),AAHY01029424.1:1..3514,gap(612),
CO   AAHY01029425.1:1..15168,gap(39),AAHY01029426.1:1..12525,gap(24),
CO   AAHY01029427.1:1..10257,gap(3674),AAHY01029428.1:1..14480,gap(42210),
CO   AAHY01029429.1:1..3222,gap(6076),AAHY01029430.1:1..1637,gap(42),
CO   AAHY01029431.1:1..28877,gap(253),AAHY01029432.1:1..8062,gap(83),
CO   AAHY01029433.1:1..22032,gap(4619),AAHY01029434.1:1..17813,gap(1254),
CO   AAHY01029435.1:1..12249,gap(20),complement(AAHY01029436.1:1..4148),
CO   gap(188),AAHY01029437.1:1..23752,gap(30),AAHY01029438.1:1..26476,gap(4126),
CO   AAHY01029439.1:1..46327,gap(20),complement(AAHY01029440.1:1..1141),gap(20),
CO   complement(AAHY01029441.1:1..1474),gap(390),
CO   complement(AAHY01029442.1:1..2438),gap(20),AAHY01029443.1:1..6641,gap(243),
CO   AAHY01029444.1:1..1520,gap(577),AAHY01029445.1:1..13901,gap(20),
CO   AAHY01029446.1:1..24919,gap(20),complement(AAHY01029447.1:1..1768),gap(20),
CO   AAHY01029448.1:1..11831,gap(20),AAHY01029449.1:1..1072,gap(20),
CO   AAHY01029450.1:1..16998,gap(2544),AAHY01029451.1:1..4892,gap(20),
CO   AAHY01029452.1:1..19545,gap(293),AAHY01029453.1:1..26183,gap(841),
CO   AAHY01029454.1:1..12268,gap(33),AAHY01029455.1:1..13251,gap(1240),
CO   AAHY01029456.1:1..41079,gap(20),AAHY01029457.1:1..2075,gap(257),
CO   AAHY01029458.1:1..13155,gap(1682),AAHY01029459.1:1..1619,gap(20),
CO   AAHY01029460.1:1..2552,gap(20),AAHY01029461.1:1..22636,gap(1295),
CO   AAHY01029462.1:1..4811,gap(20),AAHY01029463.1:1..6899,gap(61),
CO   AAHY01029464.1:1..1222,gap(1154),AAHY01029465.1:1..6385,gap(70),
CO   complement(AAHY01029466.1:1..1010),gap(20),
CO   complement(AAHY01029467.1:1..1465),gap(20),
CO   complement(AAHY01029468.1:1..1088),gap(20),AAHY01029469.1:1..1899,gap(20),
CO   complement(AAHY01029470.1:1..1156),gap(20),AAHY01029471.1:1..5294,gap(20),
CO   AAHY01029472.1:1..1526,gap(660),AAHY01029473.1:1..20035)